spacer

EBI Dbfetch

ID   CH466570; SV 1; linear; genomic DNA; CON; MUS; 16191835 BP.
XX
AC   CH466570;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009803914 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-16191835
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-16191835
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 51ef012651d98bba899f24bcc6b358b6.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000228.
DR   Ensembl-Gn; ENSMUSG00000001986; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006200; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016150; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016327; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016534; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025860; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031095; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031104; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036109; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037005; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041453; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044533; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045996; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048047; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054626; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054727; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055555; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055653; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068048; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073207; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079593; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079619; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079627; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091957; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095180; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097200; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097306; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097436; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006362; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016294; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016471; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026978; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033430; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035983; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049740; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050083; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054289; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055483; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061755; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067763; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067782; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067940; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069209; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069360; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074913; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075453; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089062; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101588; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114810; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114876; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115094; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115095; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115162; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129769; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170335; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170715; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179626; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180893; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181131; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181916; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184866; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185127; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..16191835
FT                   /organism="Mus musculus"
FT                   /chromosome="X"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(13262..17542)
FT                   /locus_tag="mCG_119345"
FT                   /note="gene_id=mCG119345.0"
FT   mRNA            complement(join(13262..13487,15285..15330,16872..17283,
FT                   17446..17542))
FT                   /locus_tag="mCG_119345"
FT                   /product="mCG119345"
FT                   /note="gene_id=mCG119345.0 transcript_id=mCT120517.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(13437..13487,15285..15330,16872..17283,
FT                   17446..17512))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119345"
FT                   /product="mCG119345"
FT                   /note="gene_id=mCG119345.0 transcript_id=mCT120517.0
FT                   protein_id=mCP87567.1"
FT                   /db_xref="GOA:K7N6P1"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:3713490"
FT                   /db_xref="UniProtKB/TrEMBL:K7N6P1"
FT                   /protein_id="EDL28997.1"
FT                   /translation="MEKRSINYLLDVGPEEDEENANGVKTLMVLLAGEGRNEGESGRGL
FT                   PGSGVSAAEGYRAGELSAGGPAAPVAGLMDNSNQEDLSATGCAQEKETQPEEPVPDSMG
FT                   DLENVKPMSGPWSTVNPVRVLVPKFRHLWRHNFNVLQLQELESIFQCNHYISTTEENRL
FT                   ARSMGVSEATVQEWFLKRREKYRSYKRL"
FT   gene            58479..64556
FT                   /gene="Rhox5"
FT                   /locus_tag="mCG_119349"
FT                   /note="gene_id=mCG119349.0"
FT   mRNA            join(58479..58513,60091..60159,60782..60863,61040..61397,
FT                   62008..62053,64293..64556)
FT                   /gene="Rhox5"
FT                   /locus_tag="mCG_119349"
FT                   /product="reproductive homeobox 5"
FT                   /note="gene_id=mCG119349.0 transcript_id=mCT120521.0
FT                   created on 04-SEP-2002"
FT   CDS             join(60785..60863,61040..61397,62008..62053,64293..64442)
FT                   /codon_start=1
FT                   /gene="Rhox5"
FT                   /locus_tag="mCG_119349"
FT                   /product="reproductive homeobox 5"
FT                   /note="gene_id=mCG119349.0 transcript_id=mCT120521.0
FT                   protein_id=mCP87571.1"
FT                   /db_xref="GOA:Q3UJH4"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:97538"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UJH4"
FT                   /protein_id="EDL28998.1"
FT                   /translation="MEAEGSSRKVTRLLRLGVKEDSEEQHDVKAEAFFQAGEGRDEQGA
FT                   QGQPGVGAVGTEGEGEELNGGKGHFGPGAPGPMGDGDKDSGTRAGGVEQEQNEPVAEGT
FT                   ESQENGNPGGRQMPLQGSRFAQHRLRELESILQRTNSFDVPREDLDRLMDACVSRVQNW
FT                   FKIRRAAARRNRRRATPVPEHFRGTFECPACRGVRWGERCPFATPRF"
FT   gene            83403..86204
FT                   /locus_tag="mCG_17933"
FT                   /note="gene_id=mCG17933.1"
FT   mRNA            join(83403..83527,83714..84173,84763..84808,85972..86204)
FT                   /locus_tag="mCG_17933"
FT                   /product="mCG17933"
FT                   /note="gene_id=mCG17933.1 transcript_id=mCT17268.1 created
FT                   on 04-SEP-2002"
FT   CDS             join(83446..83527,83714..84173,84763..84808,85972..86067)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17933"
FT                   /product="mCG17933"
FT                   /note="gene_id=mCG17933.1 transcript_id=mCT17268.1
FT                   protein_id=mCP1339.2"
FT                   /db_xref="GOA:O70238"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:1202888"
FT                   /db_xref="UniProtKB/TrEMBL:O70238"
FT                   /protein_id="EDL28999.1"
FT                   /translation="METPQDSRQSIQKPPSPAAEEDKEEQPGGNAVVSGAPEERIDKKE
FT                   LVLNWLAQGEFDQGEGAQGEVAGGEQAQEEPAPLSPAQEATGGEEEGENKEGEMEGRHA
FT                   GDGASSSEDDSILEEGGENIDQQPPQQEAASPDSIRNPHVLNRLAQLRYRRTRFTHSQL
FT                   HDLERLFQETRYPSLRARRDLARWMGVDECDVQNWFRMRRALFQRNRRVLMFCELPPLP
FT                   QSDSP"
FT   gene            complement(132821..>136489)
FT                   /gene="Rhox8"
FT                   /locus_tag="mCG_59536"
FT                   /note="gene_id=mCG59536.2"
FT   mRNA            complement(join(132821..133022,134242..134287,
FT                   135869..136214,136309..136352,136431..>136489))
FT                   /gene="Rhox8"
FT                   /locus_tag="mCG_59536"
FT                   /product="reproductive homeobox 8"
FT                   /note="gene_id=mCG59536.2 transcript_id=mCT59719.2 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(132975..133022,134242..134287,
FT                   135869..136214,136309..136352,136431..>136483))
FT                   /codon_start=1
FT                   /gene="Rhox8"
FT                   /locus_tag="mCG_59536"
FT                   /product="reproductive homeobox 8"
FT                   /note="gene_id=mCG59536.2 transcript_id=mCT59719.2
FT                   protein_id=mCP24273.2"
FT                   /protein_id="EDL29000.1"
FT                   /translation="RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRREEEEEEEEEEEE
FT                   EEEEEEEEEEEEEEAAAAAAARDETTAGSSAPVDDRSHDAGASSNGEDRGQGEELIPGG
FT                   TKGLEALPSPSGQLPRNRYRFTKFQLQELERIFERNHYPSAAARRELARWIGVTESRVE
FT                   NWFKSRRAKYRKCLM"
FT   gene            complement(151597..154268)
FT                   /locus_tag="mCG_119347"
FT                   /note="gene_id=mCG119347.0"
FT   mRNA            complement(join(151597..151797,152778..152823,
FT                   153450..153909,154096..154268))
FT                   /locus_tag="mCG_119347"
FT                   /product="mCG119347"
FT                   /note="gene_id=mCG119347.0 transcript_id=mCT120519.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(151702..151797,152778..152823,
FT                   153450..153909,154096..154177))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119347"
FT                   /product="mCG119347"
FT                   /note="gene_id=mCG119347.0 transcript_id=mCT120519.0
FT                   protein_id=mCP87569.1"
FT                   /db_xref="GOA:Q9EQM5"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:1890128"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EQM5"
FT                   /protein_id="EDL29001.1"
FT                   /translation="METPQDSRQSIQKPPSPGAEEDKEEQHGGNAVVSGAGEEGIDKKE
FT                   LVMSGLAQGGLDQGEGAQGEVAGGEQAQEEPAPLSPAQEATGGEEEGENKEGEMEGRHA
FT                   GDGASGPEDDNIQEEGGENIDQQPPQQEAAIPEGMRNPQAGNYLAHQRTRRTRFTHSQL
FT                   RDLERLFQENRFPSLRVRRDLARWMGVDESDVQEWFKMRRALFRRHSRLMMFCELPPIT
FT                   ENNSP"
FT   gene            complement(265281..>265910)
FT                   /locus_tag="mCG_141010"
FT                   /note="gene_id=mCG141010.0"
FT   mRNA            complement(265281..>265910)
FT                   /locus_tag="mCG_141010"
FT                   /product="mCG141010"
FT                   /note="gene_id=mCG141010.0 transcript_id=mCT172687.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(265401..>265910)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141010"
FT                   /product="mCG141010"
FT                   /note="gene_id=mCG141010.0 transcript_id=mCT172687.0
FT                   protein_id=mCP95606.0"
FT                   /protein_id="EDL29002.1"
FT                   /translation="PFLTLAATMIGEICAAATFICKFLCTKGLRNEELLQTFSQSLQEL
FT                   LVEHYKHHWFPEQPCKGSGYRCIRINHKMDPLVSQAAQQIGLSSRELFRLLPSELTLWV
FT                   DPYEVSYRIGEDGSICVLYEASPVGGSSHNSTNAQMVDSRISFKEEPLLGRTGPSKNYN
FT                   MMAVSV"
FT   gene            complement(289760..>290398)
FT                   /locus_tag="mCG_141009"
FT                   /note="gene_id=mCG141009.0"
FT   mRNA            complement(289760..>290398)
FT                   /locus_tag="mCG_141009"
FT                   /product="mCG141009"
FT                   /note="gene_id=mCG141009.0 transcript_id=mCT172688.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(289908..>290396)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141009"
FT                   /product="mCG141009"
FT                   /note="gene_id=mCG141009.0 transcript_id=mCT172688.0
FT                   protein_id=mCP95607.0"
FT                   /protein_id="EDL29003.1"
FT                   /translation="TMIGEICAAATFICKFLCTKGLRNEELLQTFSQSLQELLVEHYKH
FT                   HWFPEQPCKGSGYRCIRINHKMDPLVSQAAQQIGLSSRELFRLLPSELTLWVDPYEVSY
FT                   RIGEDGSICVLYEASPVGGSSHNSTNAQMVDSRSGCKEERLLRRTNSAKNYNMMTVLG"
FT   gene            complement(<329753..334485)
FT                   /gene="Rhox11"
FT                   /locus_tag="mCG_147981"
FT                   /note="gene_id=mCG147981.0"
FT   mRNA            complement(join(<329753..329804,333963..334485))
FT                   /gene="Rhox11"
FT                   /locus_tag="mCG_147981"
FT                   /product="reproductive homeobox 11"
FT                   /note="gene_id=mCG147981.0 transcript_id=mCT188244.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(<329753..329804,333963..334321))
FT                   /codon_start=1
FT                   /gene="Rhox11"
FT                   /locus_tag="mCG_147981"
FT                   /product="reproductive homeobox 11"
FT                   /note="gene_id=mCG147981.0 transcript_id=mCT188244.0
FT                   protein_id=mCP109519.0"
FT                   /protein_id="EDL29004.1"
FT                   /translation="MSRKYFYFDYDYYGMSFCEEEITTEPEEKVAYTSNSGGFADEVTG
FT                   IPKEGHQSSIGEHSCVMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPGQLWE
FT                   LQAVFVENQYPDALKRKELAGLLNVDEQKIKVS"
FT   gene            <367763..367973
FT                   /locus_tag="mCG_1041001"
FT                   /note="gene_id=mCG1041001.0"
FT   mRNA            join(<367763..367812,367839..367973)
FT                   /locus_tag="mCG_1041001"
FT                   /product="mCG1041001"
FT                   /note="gene_id=mCG1041001.0 transcript_id=mCT158705.1
FT                   created on 04-SEP-2002"
FT   CDS             join(<367764..367812,367839..367924)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041001"
FT                   /product="mCG1041001"
FT                   /note="gene_id=mCG1041001.0 transcript_id=mCT158705.1
FT                   protein_id=mCP87669.1"
FT                   /protein_id="EDL29005.1"
FT                   /translation="PRSKKPWTTHPSKDTERVPILTRPPTLSISLTVSIPGPHNKGGA"
FT   gene            <370851..379236
FT                   /locus_tag="mCG_16054"
FT                   /note="gene_id=mCG16054.1"
FT   mRNA            join(<370851..370993,372245..372290,379013..379236)
FT                   /locus_tag="mCG_16054"
FT                   /product="mCG16054"
FT                   /note="gene_id=mCG16054.1 transcript_id=mCT15269.0 created
FT                   on 04-SEP-2002"
FT   CDS             join(<370851..370993,372245..372290,379013..379132)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16054"
FT                   /product="mCG16054"
FT                   /note="gene_id=mCG16054.1 transcript_id=mCT15269.0
FT                   protein_id=mCP2283.0"
FT                   /protein_id="EDL29006.1"
FT                   /translation="IPGPYRYRPPRRHVRRRRRGPPFHFAQWQVEEMESLFEETQYPDL
FT                   LTRGELARTLNVPEVKVKVWFTNRRAKQRKIERREMLRNIPPGAEDFIFITDFEEPS"
FT   gene            <439085..443958
FT                   /gene="Zbtb33"
FT                   /locus_tag="mCG_16053"
FT                   /note="gene_id=mCG16053.2"
FT   mRNA            join(<439085..439182,441489..443958)
FT                   /gene="Zbtb33"
FT                   /locus_tag="mCG_16053"
FT                   /product="zinc finger and BTB domain containing 33,
FT                   transcript variant mCT192569"
FT                   /note="gene_id=mCG16053.2 transcript_id=mCT192569.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<439086..439182,441489..443506)
FT                   /codon_start=1
FT                   /gene="Zbtb33"
FT                   /locus_tag="mCG_16053"
FT                   /product="zinc finger and BTB domain containing 33, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16053.2 transcript_id=mCT192569.0
FT                   protein_id=mCP113537.0 isoform=CRA_b"
FT                   /protein_id="EDL29008.1"
FT                   /translation="KAAAAALRSPAAWGRTLTLPRPRGGESGRRGAGMESRKLISATDI
FT                   QYSASLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFSVAGQVVELS
FT                   FIRAEIFAEILNYIYSSKVVRVRADLLDELIKSGQLLGVKFIAELGVPLSQVKSISGTE
FT                   QDGTAETLPSSSSDKSLDMEKSKDEAQDNGATVMPIITESFSLSAEDNEMKKIIVTDSD
FT                   DDDDDDVIFCSEILPAKEDLPSNNTATQVQPNPASVAISEVTPCASNNSPPVTNITPTQ
FT                   LPTPVNQATLSQTQGSEELLVSSASTHLTPNIILLNQAPLTAPPSASSSLPNHMSSSVN
FT                   VLVQNQQTPNSAVLTGNKAEEEEEIIDDDDDIISSSPDSAVSNTSLVPQADNSKSTTLD
FT                   GSLTQKMQIPVLPQEPPSNSLKISDVITRNTNDPGLRSKHVMEGQKIITLDTATEIEGL
FT                   STGCKVYANIGEDTYDIVIPVKDDPDGGEAKLDNELPKTSGSEPPNKRMKVKHDDHYEL
FT                   IVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYQCRYCDKVFPLAEYRTKHEIHHT
FT                   GERRYQCLTCGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCKSLQIRQYAYLSNKS
FT                   SAMPVMKDDAVGYKVDAGKEPPVGTTSTPPQNKSTFWEDIFIQQENDSIFKQNVTDGST
FT                   EFEFIIPESY"
FT   mRNA            join(439115..439356,441489..443814)
FT                   /gene="Zbtb33"
FT                   /locus_tag="mCG_16053"
FT                   /product="zinc finger and BTB domain containing 33,
FT                   transcript variant mCT15439"
FT                   /note="gene_id=mCG16053.2 transcript_id=mCT15439.1 created
FT                   on 04-SEP-2002"
FT   CDS             441491..443506
FT                   /codon_start=1
FT                   /gene="Zbtb33"
FT                   /locus_tag="mCG_16053"
FT                   /product="zinc finger and BTB domain containing 33, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16053.2 transcript_id=mCT15439.1
FT                   protein_id=mCP2282.2 isoform=CRA_a"
FT                   /db_xref="GOA:A2A3Z3"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1927290"
FT                   /db_xref="UniProtKB/TrEMBL:A2A3Z3"
FT                   /protein_id="EDL29007.1"
FT                   /translation="MESRKLISATDIQYSASLLNSLNEQRGHGLFCDVTVIVEDRKFRA
FT                   HRNILSASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIYSSKVVRVRADLLDELIKS
FT                   GQLLGVKFIAELGVPLSQVKSISGTEQDGTAETLPSSSSDKSLDMEKSKDEAQDNGATV
FT                   MPIITESFSLSAEDNEMKKIIVTDSDDDDDDDVIFCSEILPAKEDLPSNNTATQVQPNP
FT                   ASVAISEVTPCASNNSPPVTNITPTQLPTPVNQATLSQTQGSEELLVSSASTHLTPNII
FT                   LLNQAPLTAPPSASSSLPNHMSSSVNVLVQNQQTPNSAVLTGNKAEEEEEIIDDDDDII
FT                   SSSPDSAVSNTSLVPQADNSKSTTLDGSLTQKMQIPVLPQEPPSNSLKISDVITRNTND
FT                   PGLRSKHVMEGQKIITLDTATEIEGLSTGCKVYANIGEDTYDIVIPVKDDPDGGEAKLD
FT                   NELPKTSGSEPPNKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWE
FT                   KKYQCRYCDKVFPLAEYRTKHEIHHTGERRYQCLTCGKSFINYQFMSSHIKSVHSQDPS
FT                   GDSKLYRLHPCKSLQIRQYAYLSNKSSAMPVMKDDAVGYKVDAGKEPPVGTTSTPPQNK
FT                   STFWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY"
FT   gene            complement(448258..>501687)
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /note="gene_id=mCG16055.1"
FT   mRNA            complement(join(448258..448930,457239..457382,
FT                   464407..464569,473810..473898,474283..474354,
FT                   476117..476185,482332..482421,485070..485132,
FT                   494945..495087,501473..>501687))
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /product="RIKEN cDNA 6430550H21, transcript variant
FT                   mCT15440"
FT                   /note="gene_id=mCG16055.1 transcript_id=mCT15440.2 created
FT                   on 04-SEP-2002"
FT   mRNA            complement(join(448259..448930,457239..457382,
FT                   464407..464569,473810..473898,474283..474354,
FT                   482332..482421,485070..485132,494945..495087,
FT                   501473..501650))
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /product="RIKEN cDNA 6430550H21, transcript variant
FT                   mCT172686"
FT                   /note="gene_id=mCG16055.1 transcript_id=mCT172686.0 created
FT                   on 04-SEP-2002"
FT   mRNA            complement(join(448259..448930,457239..457382,
FT                   464514..464569,473810..473898,482332..482421,
FT                   485070..485132,494945..495087,501473..>501630))
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /product="RIKEN cDNA 6430550H21, transcript variant
FT                   mCT172685"
FT                   /note="gene_id=mCG16055.1 transcript_id=mCT172685.0 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(448766..448930,457239..457382,
FT                   464407..464569,473810..473898,474283..474354,
FT                   476117..476185,482332..482421,485070..485132,
FT                   494945..495087,501473..>501569))
FT                   /codon_start=1
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /product="RIKEN cDNA 6430550H21, isoform CRA_a"
FT                   /note="gene_id=mCG16055.1 transcript_id=mCT15440.2
FT                   protein_id=mCP2284.2 isoform=CRA_a"
FT                   /protein_id="EDL29009.1"
FT                   /translation="SSFGDRGNWTAFTMHQSLTQQRSSDMSLPDSMGAFNRRKRNSIYV
FT                   TVTLLIVSMLILTVGLAATTRTQNVTVGGYYPGVILGFGSFLGIIGSNLIENKRQMLVA
FT                   SIVFISFGVIAAFCCAIVDGVFAARHIDLKPLYANRCHYVPKTSQREAEEVITSSSKIT
FT                   PSTRALRNLTQAVKEVNCPQLSRGLCTPRIRGNTCFCCDLYNCGNRVEITGGYYEYIDV
FT                   SSCQDIIHLYHLLWSATILNIVGLFLGIITAAVLGGFKDMNPTLPALNCSVENAHPTVS
FT                   YYARPQVASYNTYYHSPPHLPPYSAYDFQHSGVFPSSPPSGLSDEQEPQSPSPSPSYMW
FT                   SSSAPPRYSPPYYPPFEKPPPYSP"
FT   CDS             complement(join(448766..448930,457239..457382,
FT                   464407..464569,473810..473898,474283..474354,
FT                   482332..482421,485070..485132,494945..495087,
FT                   501473..501530))
FT                   /codon_start=1
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /product="RIKEN cDNA 6430550H21, isoform CRA_c"
FT                   /note="gene_id=mCG16055.1 transcript_id=mCT172686.0
FT                   protein_id=mCP95604.0 isoform=CRA_c"
FT                   /protein_id="EDL29011.1"
FT                   /translation="MHQSLTQQRSSDMSLPDSMGAFNRRKRNSIYVTVTLLIVSMLILT
FT                   VGLAATTRTQNVTVGGYYPGVILGFGSFLGIIGSNLIENKRQMLVASIVFISFGVIAAF
FT                   CCAIVDGVFAARHIVITSSSKITPSTRALRNLTQAVKEVNCPQLSRGLCTPRIRGNTCF
FT                   CCDLYNCGNRVEITGGYYEYIDVSSCQDIIHLYHLLWSATILNIVGLFLGIITAAVLGG
FT                   FKDMNPTLPALNCSVENAHPTVSYYARPQVASYNTYYHSPPHLPPYSAYDFQHSGVFPS
FT                   SPPSGLSDEQEPQSPSPSPSYMWSSSAPPRYSPPYYPPFEKPPPYSP"
FT   CDS             complement(join(457348..457382,464514..464569,
FT                   473810..473898,482332..482421,485070..485132,
FT                   494945..495087,501473..>501569))
FT                   /codon_start=1
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /product="RIKEN cDNA 6430550H21, isoform CRA_b"
FT                   /note="gene_id=mCG16055.1 transcript_id=mCT172685.0
FT                   protein_id=mCP95605.0 isoform=CRA_b"
FT                   /protein_id="EDL29010.1"
FT                   /translation="SSFGDRGNWTAFTMHQSLTQQRSSDMSLPDSMGAFNRRKRNSIYV
FT                   TVTLLIVSMLILTVGLAATTRTQNVTVGGYYPGVILGFGSFLGIIGSNLIENKRQMLVA
FT                   SIVFISFGVIAAFCCAIVDGVFAARHIVNCPQLSRGLCTPRIRGNTCFCCDLYNCGNRV
FT                   EITGGYYEYIDVSSCQEPYSSGTELLC"
FT   gene            566603..587139
FT                   /gene="Atp1b4"
FT                   /locus_tag="mCG_1448"
FT                   /note="gene_id=mCG1448.2"
FT   mRNA            join(566603..566745,570927..571188,575061..575189,
FT                   575427..575531,579680..579876,580980..581036,
FT                   583180..583275,583987..587139)
FT                   /gene="Atp1b4"
FT                   /locus_tag="mCG_1448"
FT                   /product="ATPase, (Na+)/K+ transporting, beta 4
FT                   polypeptide, transcript variant mCT7867"
FT                   /note="gene_id=mCG1448.2 transcript_id=mCT7867.2 created on
FT                   04-SEP-2002"
FT   mRNA            join(<566683..566745,570927..571176,575061..575189,
FT                   575427..575531,579680..579876,580980..581036,
FT                   583180..583275,583987..587139)
FT                   /gene="Atp1b4"
FT                   /locus_tag="mCG_1448"
FT                   /product="ATPase, (Na+)/K+ transporting, beta 4
FT                   polypeptide, transcript variant mCT192587"
FT                   /note="gene_id=mCG1448.2 transcript_id=mCT192587.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(566683..566745,570927..571188,575061..575189,
FT                   575427..575531,579680..579876,580980..581036,
FT                   583180..583275,583987..584148)
FT                   /codon_start=1
FT                   /gene="Atp1b4"
FT                   /locus_tag="mCG_1448"
FT                   /product="ATPase, (Na+)/K+ transporting, beta 4
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG1448.2 transcript_id=mCT7867.2
FT                   protein_id=mCP2640.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q99ME6"
FT                   /db_xref="InterPro:IPR000402"
FT                   /db_xref="MGI:MGI:1915071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99ME6"
FT                   /protein_id="EDL29013.1"
FT                   /translation="MRRQLRSRRAPAFPYGYRYRLDDQDEANHNYLADEEEEAEEEAQV
FT                   MMVPGLEEEEEEEEGKEEEEEREEEEGQGQSTGSAWWRKLQIVNEYLWDPEKRMSLART
FT                   GQSRSLILVIYFFFYASLAAVITLFIYMLFLAISPYMPTFTEQVKPPGVMIRPFAHSLN
FT                   FNFNVSEPETWQRYVISLNGFLQGYNDSLQEEMNIDCPPGRYFIQDGDEDEDKKACQFK
FT                   RSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPEFGDPVKVSCKVQKGDENDIRSI
FT                   NYYPESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIVNDVI
FT                   NDRFVGRIIFTLNIET"
FT   CDS             join(566683..566745,570927..571176,575061..575189,
FT                   575427..575531,579680..579876,580980..581036,
FT                   583180..583275,583987..584148)
FT                   /codon_start=1
FT                   /gene="Atp1b4"
FT                   /locus_tag="mCG_1448"
FT                   /product="ATPase, (Na+)/K+ transporting, beta 4
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG1448.2 transcript_id=mCT192587.0
FT                   protein_id=mCP113536.0 isoform=CRA_a"
FT                   /db_xref="GOA:B1APX1"
FT                   /db_xref="InterPro:IPR000402"
FT                   /db_xref="MGI:MGI:1915071"
FT                   /db_xref="UniProtKB/TrEMBL:B1APX1"
FT                   /protein_id="EDL29012.1"
FT                   /translation="MRRQLRSRRAPAFPYGYRYRLDDQDEANHNYLADEEEEAEEEAQV
FT                   MMVPGLEEEEEEEEGKEEEEEREEEEGQGQSTGSAWWRKLQIVNEYLWDPEKRMSLART
FT                   GLILVIYFFFYASLAAVITLFIYMLFLAISPYMPTFTEQVKPPGVMIRPFAHSLNFNFN
FT                   VSEPETWQRYVISLNGFLQGYNDSLQEEMNIDCPPGRYFIQDGDEDEDKKACQFKRSFL
FT                   KNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPEFGDPVKVSCKVQKGDENDIRSINYYP
FT                   ESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIVNDVINDRF
FT                   VGRIIFTLNIET"
FT   gene            647314..647779
FT                   /locus_tag="mCG_1451"
FT                   /note="gene_id=mCG1451.1"
FT   mRNA            647314..647779
FT                   /locus_tag="mCG_1451"
FT                   /product="mCG1451"
FT                   /note="gene_id=mCG1451.1 transcript_id=mCT7870.1 created on
FT                   04-SEP-2002"
FT   CDS             647364..647678
FT                   /codon_start=1
FT                   /locus_tag="mCG_1451"
FT                   /product="mCG1451"
FT                   /note="gene_id=mCG1451.1 transcript_id=mCT7870.1
FT                   protein_id=mCP2639.1"
FT                   /protein_id="EDL29014.1"
FT                   /translation="MAKLICNFTETAPSMVAAAVTYSKPRLATFWHYAKVELVPPTPGE
FT                   IPTAIQSVKKKTIQSAKTGSFKHLTVKEAVLNGLVATEVWMWFYIGEIIGKRGIVGYDV
FT                   "
FT   gene            complement(651788..706789)
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /note="gene_id=mCG1450.2"
FT   mRNA            complement(join(651788..652710,674602..674766,
FT                   675698..675761,681253..681375,682185..682396,
FT                   685731..685889,690466..690679,692360..692475,
FT                   706584..706789))
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, transcript
FT                   variant mCT172682"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT172682.0 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(652568..652710,674602..674766,
FT                   675698..675761,681253..681375,682185..682396,
FT                   685731..685889,690466..690679,692360..692475,
FT                   706584..706638))
FT                   /codon_start=1
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, isoform CRA_a"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT172682.0
FT                   protein_id=mCP95602.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8C5K0"
FT                   /db_xref="InterPro:IPR002000"
FT                   /db_xref="InterPro:IPR018134"
FT                   /db_xref="MGI:MGI:96748"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C5K0"
FT                   /protein_id="EDL29015.1"
FT                   /translation="MCLSPVKGAKLILIFLFLGAVQSNALIVNLTDSKGTCLYAEWEMN
FT                   FTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASH
FT                   YSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQK
FT                   YWGIHLQAFVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPT
FT                   PTVGNYSIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNN
FT                   SQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQ
FT                   VLSVSRAFQINTFNLKVQPFNVTKGQYSTAEECAADSDLNFLIPVAVGVALGFLIIAVF
FT                   ISYMIGRRKSRTGYQSV"
FT   mRNA            complement(join(655493..656000,674602..674766,
FT                   675698..675761,681253..681375,682185..682396,
FT                   685731..685889,690466..690679,692360..692475,
FT                   706584..706714))
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, transcript
FT                   variant mCT7869"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT7869.1 created on
FT                   04-SEP-2002"
FT   mRNA            complement(join(655506..656000,674602..674766,
FT                   675698..675761,681253..681375,682185..682248,
FT                   692398..692475,706584..706745))
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, transcript
FT                   variant mCT172684"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT172684.0 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(655861..656000,674602..674766,
FT                   675698..675761,681253..681375,682185..682396,
FT                   685731..685889,690466..690679,692360..692475,
FT                   706584..706638))
FT                   /codon_start=1
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, isoform CRA_d"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT7869.1
FT                   protein_id=mCP2638.2 isoform=CRA_d"
FT                   /db_xref="GOA:P17047"
FT                   /db_xref="InterPro:IPR002000"
FT                   /db_xref="InterPro:IPR018134"
FT                   /db_xref="MGI:MGI:96748"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17047"
FT                   /protein_id="EDL29018.1"
FT                   /translation="MCLSPVKGAKLILIFLFLGAVQSNALIVNLTDSKGTCLYAEWEMN
FT                   FTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASH
FT                   YSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQK
FT                   YWGIHLQAFVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPT
FT                   PTVGNYSIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNN
FT                   SQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQ
FT                   VLSVSRAFQINTFNLKVQPFNVTKGQYSTAQDCSADEDNFLVPIAVGAALGGVLILVLL
FT                   AYFIGLKRHHTGYEQF"
FT   CDS             complement(join(655861..656000,674602..674766,
FT                   675698..675761,681253..681375,682185..682248,
FT                   692398..692408))
FT                   /codon_start=1
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, isoform CRA_c"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT172684.0
FT                   protein_id=mCP95603.0 isoform=CRA_c"
FT                   /protein_id="EDL29017.1"
FT                   /translation="MGDENGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQP
FT                   QSAQLRLNNSQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLG
FT                   SSYMCNKEQVLSVSRAFQINTFNLKVQPFNVTKGQYSTAQDCSADEDNFLVPIAVGAAL
FT                   GGVLILVLLAYFIGLKRHHTGYEQF"
FT   mRNA            complement(join(671454..672186,674602..674766,
FT                   675698..675761,681253..681375,682185..682396,
FT                   685731..685889,690466..690679,692360..692475,
FT                   706584..706755))
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, transcript
FT                   variant mCT172683"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT172683.0 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(672047..672186,674602..674766,
FT                   675698..675761,681253..681375,682185..682396,
FT                   685731..685889,690466..690679,692360..692475,
FT                   706584..706638))
FT                   /codon_start=1
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, isoform CRA_b"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT172683.0
FT                   protein_id=mCP95601.0 isoform=CRA_b"
FT                   /db_xref="GOA:P17047"
FT                   /db_xref="InterPro:IPR002000"
FT                   /db_xref="InterPro:IPR018134"
FT                   /db_xref="MGI:MGI:96748"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17047"
FT                   /protein_id="EDL29016.1"
FT                   /translation="MCLSPVKGAKLILIFLFLGAVQSNALIVNLTDSKGTCLYAEWEMN
FT                   FTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASH
FT                   YSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQK
FT                   YWGIHLQAFVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPT
FT                   PTVGNYSIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNN
FT                   SQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQ
FT                   VLSVSRAFQINTFNLKVQPFNVTKGQYSTAQECSLDDDTILIPIIVGAGLSGLIIVIVI
FT                   AYLIGRRKTYAGYQTL"
FT   gene            complement(782657..825984)
FT                   /gene="Cul4b"
FT                   /locus_tag="mCG_10889"
FT                   /note="gene_id=mCG10889.2"
FT   mRNA            complement(join(782657..783527,786921..787073,
FT                   788753..788925,789799..789904,790736..790849,
FT                   791850..791957,793131..793216,794548..794658,
FT                   795295..795399,796491..796683,797646..797764,
FT                   798228..798295,799008..799090,799387..799476,
FT                   799636..799798,800665..800738,801453..801522,
FT                   802181..802284,811408..811523,813462..814007,
FT                   814732..814905,822203..822277,825879..825984))
FT                   /gene="Cul4b"
FT                   /locus_tag="mCG_10889"
FT                   /product="cullin 4B"
FT                   /note="gene_id=mCG10889.2 transcript_id=mCT172680.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(783432..783527,786921..787073,
FT                   788753..788925,789799..789904,790736..790849,
FT                   791850..791957,793131..793216,794548..794658,
FT                   795295..795399,796491..796683,797646..797764,
FT                   798228..798295,799008..799090,799387..799476,
FT                   799636..799798,800665..800738,801453..801522,
FT                   802181..802284,811408..811523,813462..814007,
FT                   814732..814905,822203..822263))
FT                   /codon_start=1
FT                   /gene="Cul4b"
FT                   /locus_tag="mCG_10889"
FT                   /product="cullin 4B"
FT                   /note="gene_id=mCG10889.2 transcript_id=mCT172680.0
FT                   protein_id=mCP95599.0"
FT                   /db_xref="GOA:A2A432"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016157"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="MGI:MGI:1919834"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2A432"
FT                   /protein_id="EDL29019.1"
FT                   /translation="MSRSTRSKERRENDTDSEDNSSETSNQERRRCRQGPPRPPYPPLL
FT                   PPVFPPPTPPPQVRRTRGLQDLGAMKSVCPGTSGFSSPNPSAASAAAQEVRSATDGNTS
FT                   TTPPTSAKKRKLNSSSSSSNSSNEREDFDSTSSSSTPPQPRDSASPSTSSFCLGVPVAT
FT                   SSHVPIQKKLRFEDTLEFVGIDTKMAEESSSSSSSSSPTAATSQQQQQQQLKTKSILIS
FT                   SVASVHHANGLAKSSTAVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAV
FT                   EAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDHIKAQIHQFREDSLDSV
FT                   LFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKV
FT                   QTKTIDGILLLIERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEQQFLQETNRLYAAEG
FT                   QKLMQEREVPEYLHHVNKRLEEEADRLITYLDQTTQKSLIASVEKQLLGEHLTAILQKG
FT                   LNSLLDENRIQDLSLLYQLFSRVRGGVQVLLQQWIEYIKAFGSTIVINPEKDKTMVQEL
FT                   LDFKDKVDHIIDTCFLKNEKFINAMKEAFETFINKRPNKPAELIAKYVDSKLRAGNKEA
FT                   TDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHEC
FT                   GAAFTSKLEGMFKDMELSKDIMIQFKQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVH
FT                   LPPEMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTMVLLM
FT                   FNEGEEFSLEEIKHATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDF
FT                   KHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEV
FT                   YNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIA"
FT   gene            850329..863256
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /note="gene_id=mCG1040960.1"
FT   mRNA            join(850329..850577,851151..851196,851728..851880,
FT                   852375..852472,855737..855870,861572..861639,
FT                   862954..863256)
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, transcript
FT                   variant mCT172669"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172669.0
FT                   created on 05-SEP-2002"
FT   mRNA            join(850329..850577,851728..851880,852375..852472,
FT                   855737..855870,861572..861639,862954..863255)
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, transcript
FT                   variant mCT158664"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT158664.1
FT                   created on 05-SEP-2002"
FT   mRNA            join(850329..850577,851728..851880,852375..852472,
FT                   855737..855870,861561..861639,862954..863133)
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, transcript
FT                   variant mCT172670"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172670.0
FT                   created on 05-SEP-2002"
FT   mRNA            join(850377..850577,852375..852472,855737..855870,
FT                   861572..861639,862954..863227)
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, transcript
FT                   variant mCT172668"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172668.0
FT                   created on 05-SEP-2002"
FT   mRNA            join(<850377..850577,855737..855870,861572..861639,
FT                   862954..863227)
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, transcript
FT                   variant mCT172667"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172667.0
FT                   created on 05-SEP-2002"
FT   CDS             join(<850403..850577,855737..855870,861572..861639,
FT                   862954..863035)
FT                   /codon_start=1
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172667.0
FT                   protein_id=mCP95586.0 isoform=CRA_e"
FT                   /protein_id="EDL29024.1"
FT                   /translation="SDFAKGRKADSVFAFRINDSSSDCQCRPSSCWTLPNSISFPFRAL
FT                   PYRRPFHLGSCSRNPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVA
FT                   IMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK"
FT   CDS             join(850567..850577,851728..851880,852375..852472,
FT                   855737..855870,861572..861639,862954..863035)
FT                   /codon_start=1
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT158664.1
FT                   protein_id=mCP87535.1 isoform=CRA_a"
FT                   /protein_id="EDL29020.1"
FT                   /translation="MFKKFDEKENVSNCIQLKTSVIKGIKNQLLEQFPGIEPWLNQIMP
FT                   KKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKF
FT                   VLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIG
FT                   IENIHYLNDGLWHMKTYK"
FT   CDS             join(850567..850577,852375..852472,855737..855870,
FT                   861572..861639,862954..863035)
FT                   /codon_start=1
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172668.0
FT                   protein_id=mCP95587.0 isoform=CRA_b"
FT                   /protein_id="EDL29021.1"
FT                   /translation="MFKNHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQ
FT                   VDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDI
FT                   EKVNKGIGIENIHYLNDGLWHMKTYK"
FT   CDS             join(850567..850577,851728..851880,852375..852472,
FT                   855737..855870,861561..861620)
FT                   /codon_start=1
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172670.0
FT                   protein_id=mCP95588.0 isoform=CRA_d"
FT                   /protein_id="EDL29023.1"
FT                   /translation="MFKKFDEKENVSNCIQLKTSVIKGIKNQLLEQFPGIEPWLNQIMP
FT                   KKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKF
FT                   VLSGANIMCPGLTSPGAKLYPAAVDTIVLVFRQSWQKENNMLYVWVS"
FT   CDS             join(851183..851196,851728..851880,852375..852472,
FT                   855737..855870,861572..861639,862954..863035)
FT                   /codon_start=1
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172669.0
FT                   protein_id=mCP95589.0 isoform=CRA_c"
FT                   /protein_id="EDL29022.1"
FT                   /translation="MGKGRFDEKENVSNCIQLKTSVIKGIKNQLLEQFPGIEPWLNQIM
FT                   PKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIK
FT                   FVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGI
FT                   GIENIHYLNDGLWHMKTYK"
FT   gene            complement(880341..884661)
FT                   /gene="C1galt1c1"
FT                   /locus_tag="mCG_10888"
FT                   /note="gene_id=mCG10888.2"
FT   mRNA            complement(join(880341..881679,884534..884661))
FT                   /gene="C1galt1c1"
FT                   /locus_tag="mCG_10888"
FT                   /product="C1GALT1-specific chaperone 1"
FT                   /note="gene_id=mCG10888.2 transcript_id=mCT10749.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(880723..881673)
FT                   /codon_start=1
FT                   /gene="C1galt1c1"
FT                   /locus_tag="mCG_10888"
FT                   /product="C1GALT1-specific chaperone 1"
FT                   /note="gene_id=mCG10888.2 transcript_id=mCT10749.2
FT                   protein_id=mCP17345.2"
FT                   /protein_id="EDL29025.1"
FT                   /translation="MLSESSSFLKGVMLGSIFCALITMLGHIRIGNRMHHHEHHHLQAP
FT                   NKDDISKISEAERMELSKSFRVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVK
FT                   VFESINMDTNDMWLMMRKAYKYAYDQYRDQYNWFFLARPTTFAVIENLKYFLLKKDQSQ
FT                   PFYLGHTVKSGDLEYVSVDGGIVLSIESMKRLNSLLSVPEKCPEQGGMIWKISEDKQLA
FT                   VCLKYAGVFAENAEDADGKDVFNTKSVGLFIKEAMTNQPNQVVEGCCSDMAVTFNGLTP
FT                   NQMHVMMYGVYRLRAFGHVFNDALVFLPPNGSEND"
FT   gene            complement(934060..935320)
FT                   /locus_tag="mCG_119348"
FT                   /note="gene_id=mCG119348.1"
FT   mRNA            complement(934060..935320)
FT                   /locus_tag="mCG_119348"
FT                   /product="mCG119348"
FT                   /note="gene_id=mCG119348.1 transcript_id=mCT120520.1
FT                   created on 05-SEP-2002"
FT   CDS             complement(934670..935251)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119348"
FT                   /product="mCG119348"
FT                   /note="gene_id=mCG119348.1 transcript_id=mCT120520.1
FT                   protein_id=mCP87570.1"
FT                   /protein_id="EDL29026.1"
FT                   /translation="MIKAILIFNNHRKPGLSKFYQPYSEDRQQQIIRETFHLVSKRDEN
FT                   VCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENV
FT                   CELDLIFHVEKVHNILTEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVS
FT                   AVKNMNLPEIPRNINIGDISIKVPNLPSFK"
FT   gene            <1021758..1212897
FT                   /gene="6030498E09Rik"
FT                   /locus_tag="mCG_141008"
FT                   /note="gene_id=mCG141008.0"
FT   mRNA            join(<1021758..1021956,1208274..1208684,1209647..1209794,
FT                   1212353..1212897)
FT                   /gene="6030498E09Rik"
FT                   /locus_tag="mCG_141008"
FT                   /product="RIKEN cDNA 6030498E09"
FT                   /note="gene_id=mCG141008.0 transcript_id=mCT172681.1
FT                   created on 26-FEB-2003"
FT   gene            complement(1151806..1153476)
FT                   /pseudo
FT                   /locus_tag="mCG_10959"
FT                   /note="gene_id=mCG10959.1"
FT   mRNA            complement(1151806..1153476)
FT                   /pseudo
FT                   /locus_tag="mCG_10959"
FT                   /note="gene_id=mCG10959.1 transcript_id=mCT10807.1 created
FT                   on 05-SEP-2002"
FT   CDS             join(<1208285..1208684,1209647..1209765)
FT                   /codon_start=1
FT                   /gene="6030498E09Rik"
FT                   /locus_tag="mCG_141008"
FT                   /product="RIKEN cDNA 6030498E09"
FT                   /note="gene_id=mCG141008.0 transcript_id=mCT172681.1
FT                   protein_id=mCP95600.1"
FT                   /protein_id="EDL29027.1"
FT                   /translation="YLIMRSRFYTSNGSGRFPQRRRVRAVSQKSNVPGLCLYTILCFGL
FT                   GLGLGLILGLGLGLGLGLGLNSGFGLSLGLGLGTGLSIRLGRNLDMPQMASLDAVHQVS
FT                   TDNVAIEDDSVGSIMKEMDENIGQISDIRAISKYECDNWEDIHEIAADEIVKEGAEEGG
FT                   QDNHQTKAT"
FT   gene            1219994..1220446
FT                   /locus_tag="mCG_1040972"
FT                   /note="gene_id=mCG1040972.0"
FT   mRNA            1219994..1220446
FT                   /locus_tag="mCG_1040972"
FT                   /product="mCG1040972"
FT                   /note="gene_id=mCG1040972.0 transcript_id=mCT158676.1
FT                   created on 05-SEP-2002"
FT   CDS             1220027..1220203
FT                   /codon_start=1
FT                   /locus_tag="mCG_1040972"
FT                   /product="mCG1040972"
FT                   /note="gene_id=mCG1040972.0 transcript_id=mCT158676.1
FT                   protein_id=mCP87637.1"
FT                   /db_xref="GOA:Q545V5"
FT                   /db_xref="InterPro:IPR006591"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="MGI:MGI:102725"
FT                   /db_xref="UniProtKB/TrEMBL:Q545V5"
FT                   /protein_id="EDL29028.1"
FT                   /translation="MDAQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMY
FT                   KKRTKRLVVFDAR"
FT   gene            1583033..1583726
FT                   /locus_tag="mCG_120069"
FT                   /note="gene_id=mCG120069.1"
FT   mRNA            join(1583033..1583200,1583379..1583726)
FT                   /locus_tag="mCG_120069"
FT                   /product="mCG120069"
FT                   /note="gene_id=mCG120069.1 transcript_id=mCT121250.1
FT                   created on 09-SEP-2002"
FT   CDS             join(1583054..1583200,1583379..1583495)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120069"
FT                   /product="mCG120069"
FT                   /note="gene_id=mCG120069.1 transcript_id=mCT121250.1
FT                   protein_id=mCP87665.1"
FT                   /db_xref="GOA:B1AXS0"
FT                   /db_xref="MGI:MGI:3616461"
FT                   /db_xref="UniProtKB/TrEMBL:B1AXS0"
FT                   /protein_id="EDL29029.1"
FT                   /translation="MAHVVKRTPKPTAYARATSQLKKCKVSCRLKCKYSIKNQHALCYK
FT                   CCDEITGKGKRVFRLASKVKGTIKLRIVKDTCHYAQELTAYQ"
FT   gene            complement(<2012731..2013116)
FT                   /locus_tag="mCG_141141"
FT                   /note="gene_id=mCG141141.0"
FT   mRNA            complement(join(<2012731..2012845,2012911..2013116))
FT                   /locus_tag="mCG_141141"
FT                   /product="mCG141141"
FT                   /note="gene_id=mCG141141.0 transcript_id=mCT173336.0
FT                   created on 09-SEP-2002"
FT   CDS             complement(join(<2012731..2012845,2012911..2012975))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141141"
FT                   /product="mCG141141"
FT                   /note="gene_id=mCG141141.0 transcript_id=mCT173336.0
FT                   protein_id=mCP96255.0"
FT                   /protein_id="EDL29030.1"
FT                   /translation="MMLIEDFKKGINNSYRRTLLNREEVLKEETQKTLKELQENTTKQK
FT                   MGLNKTIKDQKLDVE"
FT   gene            2014725..2016022
FT                   /pseudo
FT                   /locus_tag="mCG_50745"
FT                   /note="gene_id=mCG50745.2"
FT   mRNA            join(2014725..2014930,2015376..2016022)
FT                   /pseudo
FT                   /locus_tag="mCG_50745"
FT                   /note="gene_id=mCG50745.2 transcript_id=mCT50928.2 created
FT                   on 09-SEP-2002"
FT   gene            <2089942..>2682588
FT                   /locus_tag="mCG_145460"
FT                   /note="gene_id=mCG145460.0"
FT   mRNA            join(<2089942..2090032,2285447..2285590,2584016..2584107,
FT                   2585702..2585831,2586750..2586845,2588946..2589036,
FT                   2677176..2677269,2681478..>2682588)
FT                   /locus_tag="mCG_145460"
FT                   /product="mCG145460"
FT                   /note="gene_id=mCG145460.0 transcript_id=mCT184884.0
FT                   created on 05-JUN-2003"
FT   gene            complement(2218471..2219240)
FT                   /locus_tag="mCG_16956"
FT                   /note="gene_id=mCG16956.1"
FT   mRNA            complement(2218471..2219240)
FT                   /locus_tag="mCG_16956"
FT                   /product="mCG16956"
FT                   /note="gene_id=mCG16956.1 transcript_id=mCT14841.1 created
FT                   on 11-SEP-2002"
FT   CDS             complement(2218662..2218979)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16956"
FT                   /product="mCG16956"
FT                   /note="gene_id=mCG16956.1 transcript_id=mCT14841.1
FT                   protein_id=mCP3068.1"
FT                   /protein_id="EDL29032.1"
FT                   /translation="MAFHVPDPSVSIVDLTSCLEKPSKHDDIKKVVNQASEGPLKGILG
FT                   YTEDQIVSCNFNSNSHLPTLGAGTEIALNDNFVKPMFWYDSEYCYSNRVVDLMADMASN
FT                   E"
FT   gene            complement(2225054..2226432)
FT                   /pseudo
FT                   /locus_tag="mCG_49063"
FT                   /note="gene_id=mCG49063.1"
FT   mRNA            complement(2225054..2226432)
FT                   /pseudo
FT                   /locus_tag="mCG_49063"
FT                   /note="gene_id=mCG49063.1 transcript_id=mCT49246.1 created
FT                   on 11-SEP-2002"
FT   gene            complement(<2353756..>2354304)
FT                   /locus_tag="mCG_49953"
FT                   /note="gene_id=mCG49953.0"
FT   mRNA            complement(<2353756..>2354304)
FT                   /locus_tag="mCG_49953"
FT                   /product="mCG49953"
FT                   /note="gene_id=mCG49953.0 transcript_id=mCT50136.0 created
FT                   on 11-SEP-2002"
FT   CDS             complement(2353756..2354304)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49953"
FT                   /product="mCG49953"
FT                   /note="gene_id=mCG49953.0 transcript_id=mCT50136.0
FT                   protein_id=mCP36794.0"
FT                   /protein_id="EDL29033.1"
FT                   /translation="MVRYSLDPENPTKSCKSRGSNLRVHFKNTQETVQAIEGMHIPKAT
FT                   KYLKDVTLKKQCVPFRWYNGGVSRWAQAKWWGWTQSRWPKKSVEFLLLKNAESNARLKG
FT                   LEVESLVIEHIQVNKAPKMRRGTYRAHGRINPYMISPCHIEMILTEKEQIVPKPEEELA
FT                   QKKKISQKKLKKQKLMARE"
FT   gene            complement(<2512863..2513669)
FT                   /locus_tag="mCG_141142"
FT                   /note="gene_id=mCG141142.0"
FT   mRNA            complement(join(<2512863..2513545,2513588..2513669))
FT                   /locus_tag="mCG_141142"
FT                   /product="mCG141142"
FT                   /note="gene_id=mCG141142.0 transcript_id=mCT173337.0
FT                   created on 11-SEP-2002"
FT   CDS             complement(<2512863..2513193)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141142"
FT                   /product="mCG141142"
FT                   /note="gene_id=mCG141142.0 transcript_id=mCT173337.0
FT                   protein_id=mCP96256.0"
FT                   /protein_id="EDL29034.1"
FT                   /translation="MLFSPIDPLWVGLIVLVLFVLIYGLCYCLNRETVKTGQKILTEQQ
FT                   ESMSEKEKGLKRKRKKKGNTVLSGGQKGRNKRAEAVEEGELASVPPPYASSAATYRQTF
FT                   CPEIWR"
FT   CDS             <2682244..>2682588
FT                   /codon_start=1
FT                   /locus_tag="mCG_145460"
FT                   /product="mCG145460"
FT                   /note="gene_id=mCG145460.0 transcript_id=mCT184884.0
FT                   protein_id=mCP105981.0"
FT                   /protein_id="EDL29031.1"
FT                   /translation="ESSHRYWELTPDPPQDWQVLITAAPPLMSHELYFIKIKDVYSLRR
FT                   YVTGSETNTEHVIKVYKIKLKPNTKKAKLNFKLSSNLKISNASCNALLKLKCIVNIPFF
FT                   YKHFSKRIVES"
FT   gene            complement(3132980..3134039)
FT                   /pseudo
FT                   /locus_tag="mCG_1041008"
FT                   /note="gene_id=mCG1041008.1"
FT   mRNA            complement(3132980..3134039)
FT                   /pseudo
FT                   /locus_tag="mCG_1041008"
FT                   /note="gene_id=mCG1041008.1 transcript_id=mCT158712.1
FT                   created on 17-SEP-2002"
FT   gene            3439022..3440791
FT                   /pseudo
FT                   /locus_tag="mCG_116326"
FT                   /note="gene_id=mCG116326.1"
FT   mRNA            3439022..3440791
FT                   /pseudo
FT                   /locus_tag="mCG_116326"
FT                   /note="gene_id=mCG116326.1 transcript_id=mCT117446.1
FT                   created on 17-SEP-2002"
FT   gene            3592773..3868032
FT                   /gene="Gria3"
FT                   /locus_tag="mCG_51875"
FT                   /note="gene_id=mCG51875.2"
FT   mRNA            join(3592773..3592945,3594091..3594249,3670035..3670274,
FT                   3731020..3731207,3759810..3759863,3778386..3778547,
FT                   3781634..3781801,3785606..3785710,3786543..3786650,
FT                   3788378..3788584,3799838..3800214,3810710..3810908,
FT                   3843406..3843653,3858987..3859101,3861705..3861952,
FT                   3865778..3868032)
FT                   /gene="Gria3"
FT                   /locus_tag="mCG_51875"
FT                   /product="glutamate receptor, ionotropic, AMPA3 (alpha 3)"
FT                   /note="gene_id=mCG51875.2 transcript_id=mCT52058.2 created
FT                   on 17-SEP-2002"
FT   CDS             join(3592855..3592945,3594091..3594249,3670035..3670274,
FT                   3731020..3731207,3759810..3759863,3778386..3778547,
FT                   3781634..3781801,3785606..3785710,3786543..3786650,
FT                   3788378..3788584,3799838..3800214,3810710..3810908,
FT                   3843406..3843653,3858987..3859101,3861705..3861950)
FT                   /codon_start=1
FT                   /gene="Gria3"
FT                   /locus_tag="mCG_51875"
FT                   /product="glutamate receptor, ionotropic, AMPA3 (alpha 3)"
FT                   /note="gene_id=mCG51875.2 transcript_id=mCT52058.2
FT                   protein_id=mCP30282.2"
FT                   /db_xref="GOA:Q9Z2W9"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:95810"
FT                   /db_xref="PDB:3LSW"
FT                   /db_xref="PDB:3LSX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2W9"
FT                   /protein_id="EDL29035.1"
FT                   /translation="MGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAF
FT                   RFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSM
FT                   NTLTSFCGALHTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGYYKWEKFVYLYDTER
FT                   GFSILQAIMEAAVQNNWQVTARSVGNIKDIQEFRRIIEEMDRRQEKRYLIDCEVERINT
FT                   ILEQVVILGKHSRGYHYMLANLGFTDIVLERVMHGGANITGFQIVNNENPMVQQFIQRW
FT                   VRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAV
FT                   PWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERF
FT                   VPFSDQQISNDSSSSENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAK
FT                   HVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSK
FT                   PFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWH
FT                   LEDNNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFT
FT                   LIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYE
FT                   KMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNL
FT                   DSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSA
FT                   LSLSNVAGVFYILVGGLGLAMMVALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNY
FT                   ATYREGYNVYGTESVKI"
FT   gene            complement(3983355..4100229)
FT                   /locus_tag="mCG_116904"
FT                   /note="gene_id=mCG116904.1"
FT   mRNA            complement(join(3983355..3986145,3991281..3991326,
FT                   3991790..3991866,3994695..3994855,3994938..3995007,
FT                   3995327..3995464,4000796..4000912,4002287..4002345,
FT                   4002535..4002965,4010805..4010907,4011130..4011308,
FT                   4011799..4011983,4012071..4012202,4012527..4012655,
FT                   4013873..4014030,4014457..4014635,4015596..4015794,
FT                   4019027..4019191,4021642..4021821,4023431..4023548,
FT                   4026456..4026536,4026925..4027018,4027891..4027975,
FT                   4032266..4032367,4032464..4032594,4033003..4033044,
FT                   4045064..4045259,4046394..4046566,4047129..4047284,
FT                   4048455..4048547,4052359..4052525,4060620..4060753,
FT                   4060895..4061016,4062212..4062282,4068216..4068267,
FT                   4070239..4070330,4086120..4086178,4100129..4100229))
FT                   /locus_tag="mCG_116904"
FT                   /product="mCG116904, transcript variant mCT158715"
FT                   /note="gene_id=mCG116904.1 transcript_id=mCT158715.1
FT                   created on 13-AUG-2002"
FT   mRNA            complement(join(3983355..3986145,3991281..3991326,
FT                   3991790..3991866,3994695..3994855,3994938..3995007,
FT                   3995327..3995697))
FT                   /locus_tag="mCG_116904"
FT                   /product="mCG116904, transcript variant mCT117447"
FT                   /note="gene_id=mCG116904.1 transcript_id=mCT117447.1
FT                   created on 13-AUG-2002"
FT   CDS             complement(join(3991299..3991326,3991790..3991866,
FT                   3994695..3994855,3994938..3995007,3995327..3995413))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116904"
FT                   /product="mCG116904, isoform CRA_b"
FT                   /note="gene_id=mCG116904.1 transcript_id=mCT117447.1
FT                   protein_id=mCP87565.1 isoform=CRA_b"
FT                   /protein_id="EDL29037.1"
FT                   /translation="MDKKDLDKSRERSREREKKDEKDRKERKRDHSNNDREVPPDITKR
FT                   RKEENGTMGVSKHKSESPCESQYPNEKDKEKNKSKSSGKEKSSSDSFKSEKMDKISSGG
FT                   KKESRHDKEKIEKKEKRDSSGGKEEKKHHKSSDKHR"
FT   mRNA            complement(join(4000383..4000831,4002287..4002345,
FT                   4002535..4002965,4010805..4010907,4011130..4011308,
FT                   4011799..4011983,4012071..4012202,4012527..4012655,
FT                   4013873..4014030,4014457..4014635,4015596..4015794,
FT                   4019027..4019191,4021642..4021821,4023431..4023548,
FT                   4026456..4026536,4026925..4027018,4027891..4027975,
FT                   4032266..4032367,4032464..4032594,4033003..4033044,
FT                   4045064..4045259,4046394..4046566,4047129..4047284,
FT                   4048455..4048547,4052359..4052525,4060620..4060753,
FT                   4060895..4061016,4062212..4062282,4068216..4068267,
FT                   4070239..4070330,4086120..4086178,4100129..4100229))
FT                   /locus_tag="mCG_116904"
FT                   /product="mCG116904, transcript variant mCT118032"
FT                   /note="gene_id=mCG116904.1 transcript_id=mCT118032.1
FT                   created on 13-AUG-2002"
FT   CDS             complement(join(4023535..4023548,4026456..4026536,
FT                   4026925..4027018,4027891..4027975,4032266..4032367,
FT                   4032464..4032594,4033003..4033044,4045064..4045259,
FT                   4046394..4046566,4047129..4047284,4048455..4048547,
FT                   4052359..4052525,4060620..4060753,4060895..4061016,
FT                   4062212..4062282,4068216..4068267,4070239..4070330,
FT                   4086120..4086178,4100129..4100199))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116904"
FT                   /product="mCG116904, isoform CRA_a"
FT                   /note="gene_id=mCG116904.1 transcript_id=mCT158715.1
FT                   protein_id=mCP87692.1 isoform=CRA_a"
FT                   /protein_id="EDL29036.1"
FT                   /translation="MAAAAVVVPAEWIKNWEKSGRGEFLHLCRILSENKSHDSSTYRDF
FT                   QQALYELSYHVIKGNLKHEQASSVLNDISEFREDMPSILADVFCILDIETNCLEEKSKR
FT                   DYFTQLVLACLYLVSDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFN
FT                   LLREENEGYAKLIAELGQDLSGNITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRP
FT                   EHDDFFISLLESYMSMCEPQTLCHILGFKFKFYQEPSGETPSSLYRVAAVLLQFNLIDL
FT                   DDLYVHLLPADNCIMDEYKREIVEAKQIVRKLTMVVLSSEKLDERDKEKDKDDEKVEKP
FT                   PDNQKLGLLEALLKVGDWQHAQNIMDQMPPYYAASHKLIALAICKLIHITVEPLYRRVG
FT                   VPKGAKGSPVSALQNKRAPKQVESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKS
FT                   FMKEFQSDGSKQEDKEKTEVILSCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPY
FT                   QHRYRLYGQWKNETYNGHPLLVKVKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNP
FT                   TILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTI
FT                   SSWLQILTY"
FT   CDS             complement(join(4023535..4023548,4026456..4026536,
FT                   4026925..4027018,4027891..4027975,4032266..4032367,
FT                   4032464..4032594,4033003..4033044,4045064..4045259,
FT                   4046394..4046566,4047129..4047284,4048455..4048547,
FT                   4052359..4052525,4060620..4060753,4060895..4061016,
FT                   4062212..4062282,4068216..4068267,4070239..4070330,
FT                   4086120..4086178,4100129..4100199))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116904"
FT                   /product="mCG116904, isoform CRA_a"
FT                   /note="gene_id=mCG116904.1 transcript_id=mCT118032.1
FT                   protein_id=mCP87521.1 isoform=CRA_a"
FT                   /protein_id="EDL29038.1"
FT                   /translation="MAAAAVVVPAEWIKNWEKSGRGEFLHLCRILSENKSHDSSTYRDF
FT                   QQALYELSYHVIKGNLKHEQASSVLNDISEFREDMPSILADVFCILDIETNCLEEKSKR
FT                   DYFTQLVLACLYLVSDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFN
FT                   LLREENEGYAKLIAELGQDLSGNITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRP
FT                   EHDDFFISLLESYMSMCEPQTLCHILGFKFKFYQEPSGETPSSLYRVAAVLLQFNLIDL
FT                   DDLYVHLLPADNCIMDEYKREIVEAKQIVRKLTMVVLSSEKLDERDKEKDKDDEKVEKP
FT                   PDNQKLGLLEALLKVGDWQHAQNIMDQMPPYYAASHKLIALAICKLIHITVEPLYRRVG
FT                   VPKGAKGSPVSALQNKRAPKQVESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKS
FT                   FMKEFQSDGSKQEDKEKTEVILSCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPY
FT                   QHRYRLYGQWKNETYNGHPLLVKVKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNP
FT                   TILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTI
FT                   SSWLQILTY"
FT   gene            4250783..4289085
FT                   /gene="Birc4"
FT                   /locus_tag="mCG_116900"
FT                   /note="gene_id=mCG116900.1"
FT   mRNA            join(4250783..4250961,4273779..4274684,4276036..4276135,
FT                   4278227..4278305,4279266..4279308,4281425..4281625,
FT                   4284220..4289085)
FT                   /gene="Birc4"
FT                   /locus_tag="mCG_116900"
FT                   /product="baculoviral IAP repeat-containing 4, transcript
FT                   variant mCT175112"
FT                   /note="gene_id=mCG116900.1 transcript_id=mCT175112.0
FT                   created on 17-OCT-2002"
FT   mRNA            join(4273136..4274684,4276036..4276135,4278227..4278305,
FT                   4279266..4279308,4281425..4281625,4284220..4289085)
FT                   /gene="Birc4"
FT                   /locus_tag="mCG_116900"
FT                   /product="baculoviral IAP repeat-containing 4, transcript
FT                   variant mCT118028"
FT                   /note="gene_id=mCG116900.1 transcript_id=mCT118028.1
FT                   created on 17-OCT-2002"
FT   CDS             join(4273811..4274684,4276036..4276135,4278227..4278305,
FT                   4279266..4279308,4281425..4281625,4284220..4284413)
FT                   /codon_start=1
FT                   /gene="Birc4"
FT                   /locus_tag="mCG_116900"
FT                   /product="baculoviral IAP repeat-containing 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG116900.1 transcript_id=mCT118028.1
FT                   protein_id=mCP87629.1 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q60989"
FT                   /db_xref="InterPro:IPR001370"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="MGI:MGI:107572"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60989"
FT                   /protein_id="EDL29039.1"
FT                   /translation="MTFNSFEGTRTFVLADTNKDEEFVEEFNRLKTFANFPSSSPVSAS
FT                   TLARAGFLYTGEGDTVQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFINGFYFENGAAQ
FT                   STNPGIQNGQYKSENCVGNRNPFAPDRPPETHADYLLRTGQVVDISDTIYPRNPAMCSE
FT                   EARLKSFQNWPDYAHLTPRELASAGLYYTGADDQVQCFCCGGKLKNWEPCDRAWSEHRR
FT                   HFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYEARIVTFGTWTSSVNKE
FT                   QLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINN
FT                   IHLTHSLEESLGRTAEKTPSLTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTS
FT                   GSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIA
FT                   IVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS"
FT   CDS             join(4273811..4274684,4276036..4276135,4278227..4278305,
FT                   4279266..4279308,4281425..4281625,4284220..4284413)
FT                   /codon_start=1
FT                   /gene="Birc4"
FT                   /locus_tag="mCG_116900"
FT                   /product="baculoviral IAP repeat-containing 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG116900.1 transcript_id=mCT175112.0
FT                   protein_id=mCP98031.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q60989"
FT                   /db_xref="InterPro:IPR001370"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="MGI:MGI:107572"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60989"
FT                   /protein_id="EDL29040.1"
FT                   /translation="MTFNSFEGTRTFVLADTNKDEEFVEEFNRLKTFANFPSSSPVSAS
FT                   TLARAGFLYTGEGDTVQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFINGFYFENGAAQ
FT                   STNPGIQNGQYKSENCVGNRNPFAPDRPPETHADYLLRTGQVVDISDTIYPRNPAMCSE
FT                   EARLKSFQNWPDYAHLTPRELASAGLYYTGADDQVQCFCCGGKLKNWEPCDRAWSEHRR
FT                   HFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYEARIVTFGTWTSSVNKE
FT                   QLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINN
FT                   IHLTHSLEESLGRTAEKTPSLTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTS
FT                   GSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIA
FT                   IVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS"
FT   gene            4307289..4310318
FT                   /pseudo
FT                   /locus_tag="mCG_141397"
FT                   /note="gene_id=mCG141397.0"
FT   mRNA            join(4307289..4307487,4307507..4308278,4308324..4308434,
FT                   4308932..4309515,4309730..4309810,4310242..4310318)
FT                   /pseudo
FT                   /locus_tag="mCG_141397"
FT                   /note="gene_id=mCG141397.0 transcript_id=mCT175111.0
FT                   created on 18-OCT-2002"
FT   gene            <4329283..4455900
FT                   /gene="Stag2"
FT                   /locus_tag="mCG_116901"
FT                   /note="gene_id=mCG116901.1"
FT   mRNA            join(<4329283..4329361,4381920..4382059,4386097..4386175,
FT                   4391050..4391214,4397308..4397404,4400951..4401027,
FT                   4403219..4403423,4404901..4405052,4406762..4406835,
FT                   4408184..4408307,4409097..4409195,4409292..4409372,
FT                   4414367..4414478,4416012..4416129,4416674..4416777,
FT                   4425904..4425996,4426117..4426206,4426788..4426991,
FT                   4428943..4428978,4429283..4429370,4429472..4429552,
FT                   4432005..4432097,4432628..4432802,4435806..4435945,
FT                   4436977..4437078,4438306..4438454,4439555..4439683,
FT                   4441610..4441833,4445037..4445226,4448332..4448458,
FT                   4450196..4450273,4453988..4455900)
FT                   /gene="Stag2"
FT                   /locus_tag="mCG_116901"
FT                   /product="stromal antigen 2"
FT                   /note="gene_id=mCG116901.1 transcript_id=mCT118029.1
FT                   created on 18-OCT-2002"
FT   CDS             join(<4429284..4429370,4429472..4429552,4432005..4432097,
FT                   4432628..4432802,4435806..4435945,4436977..4437078,
FT                   4438306..4438454,4439555..4439683,4441610..4441833,
FT                   4445037..4445226,4448332..4448458,4450196..4450273,
FT                   4453988..4454011)
FT                   /codon_start=1
FT                   /gene="Stag2"
FT                   /locus_tag="mCG_116901"
FT                   /product="stromal antigen 2"
FT                   /note="gene_id=mCG116901.1 transcript_id=mCT118029.1
FT                   protein_id=mCP87633.1"
FT                   /protein_id="EDL29041.1"
FT                   /translation="AHDLSKWDLFACNYKLLKTGIENGDMPEQIVIHALQCAHYVILWQ
FT                   LAKITESTSTKEDLLRLKKQMRVFCQICQHYLTNVNTTVKEQAFTILCDILMIFSHQIM
FT                   SGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDDSNSADGQQEDEASKIEALHKRR
FT                   NLLAAFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDIIKETMSKTRQIDKIQCAKTLIL
FT                   SLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTFGLDQLKTREAIAMLHKDGIEF
FT                   AFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQMSLRREDVWL
FT                   PLMSYRNSLLAGGDDDTMSVISGMSSRGSTVRSKKSKPSTGKRKVVEGMQLALPEESSS
FT                   SDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMSVYPMQAEHHQTPLDYNR
FT                   RGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDLPPSKNRRERTELKPDFFD
FT                   PASIMDESVLGVSMF"
FT   gene            4581671..4583786
FT                   /locus_tag="mCG_147978"
FT                   /note="gene_id=mCG147978.0"
FT   mRNA            join(4581671..4582205,4583210..4583786)
FT                   /locus_tag="mCG_147978"
FT                   /product="mCG147978"
FT                   /note="gene_id=mCG147978.0 transcript_id=mCT188241.0
FT                   created on 13-JAN-2004"
FT   CDS             4581894..4582106
FT                   /codon_start=1
FT                   /locus_tag="mCG_147978"
FT                   /product="mCG147978"
FT                   /note="gene_id=mCG147978.0 transcript_id=mCT188241.0
FT                   protein_id=mCP109516.0"
FT                   /protein_id="EDL29042.1"
FT                   /translation="MKLKSFSKAKILVYRIVLTILFFFHMKLRFVLSRFIKNCVGSLMG
FT                   IALFIIARNWKQPRCPSTEEWIQKM"
FT   gene            <4680324..4699694
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /note="gene_id=mCG17269.2"
FT   mRNA            join(<4680324..4680447,4692884..4692947,4698240..4698381,
FT                   4699312..4699694)
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /product="SH2 domain protein 1A, transcript variant
FT                   mCT192572"
FT                   /note="gene_id=mCG17269.2 transcript_id=mCT192572.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<4680324..4680456,4692884..4692947,4698240..4698381,
FT                   4699312..4699678)
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /product="SH2 domain protein 1A, transcript variant
FT                   mCT17148"
FT                   /note="gene_id=mCG17269.2 transcript_id=mCT17148.1 created
FT                   on 18-OCT-2002"
FT   CDS             join(<4680326..4680456,4692884..4692947,4698240..4698381,
FT                   4699312..4699349)
FT                   /codon_start=1
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /product="SH2 domain protein 1A, isoform CRA_a"
FT                   /note="gene_id=mCG17269.2 transcript_id=mCT17148.1
FT                   protein_id=mCP10375.1 isoform=CRA_a"
FT                   /protein_id="EDL29043.1"
FT                   /translation="AVTVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLY
FT                   QGYIYTYRVSQTETGSWSAETAPGVHKRFFRKVKNLISAFQKPDQGIVTPLQYPVEKSS
FT                   GRGPQAPTGRRDSDICLNAP"
FT   CDS             join(<4680326..4680447,4692884..4692947,4698240..4698381,
FT                   4699312..4699349)
FT                   /codon_start=1
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /product="SH2 domain protein 1A, isoform CRA_c"
FT                   /note="gene_id=mCG17269.2 transcript_id=mCT192572.0
FT                   protein_id=mCP113538.0 isoform=CRA_c"
FT                   /protein_id="EDL29045.1"
FT                   /translation="AVTVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLYQGY
FT                   IYTYRVSQTETGSWSAETAPGVHKRFFRKVKNLISAFQKPDQGIVTPLQYPVEKSSGRG
FT                   PQAPTGRRDSDICLNAP"
FT   mRNA            join(<4680357..4680456,4698240..4698381,4699312..4699694)
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /product="SH2 domain protein 1A, transcript variant
FT                   mCT175114"
FT                   /note="gene_id=mCG17269.2 transcript_id=mCT175114.0 created
FT                   on 18-OCT-2002"
FT   CDS             join(<4680358..4680456,4698240..4698381,4699312..4699349)
FT                   /codon_start=1
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /product="SH2 domain protein 1A, isoform CRA_b"
FT                   /note="gene_id=mCG17269.2 transcript_id=mCT175114.0
FT                   protein_id=mCP98033.0 isoform=CRA_b"
FT                   /protein_id="EDL29044.1"
FT                   /translation="GDRGEALTRYRAGWKLSAARQRECPWRVLPVCFTAPGVHKRFFRK
FT                   VKNLISAFQKPDQGIVTPLQYPVEKSSGRGPQAPTGRRDSDICLNAP"
FT   gene            complement(4710013..5573461)
FT                   /gene="Odz1"
FT                   /locus_tag="mCG_141398"
FT                   /note="gene_id=mCG141398.1"
FT   mRNA            complement(join(4710013..4710816,4712577..4712719,
FT                   4713241..4714461,4715290..4715677,4721562..4721858,
FT                   4733241..4733476,4734510..4734682,4753381..4753891,
FT                   4755296..4755662,4785444..4785598,4819427..4819659,
FT                   4825245..4825265,4834314..4834563,4840992..4841135,
FT                   4860690..4860957,4865602..4865863,4871541..4871660,
FT                   4890871..4891087,4901249..4901395,4903239..4903262,
FT                   4905455..4905640,4979463..4979663,4982881..4983075,
FT                   4986283..4986384,4991473..4991683,4993143..4993342,
FT                   5015088..5015237,5065325..5065563,5103514..5103754,
FT                   5233559..5233615,5235138..5235398,5323680..5323959,
FT                   5419839..5419870,5555033..5555085,5572622..5573461))
FT                   /gene="Odz1"
FT                   /locus_tag="mCG_141398"
FT                   /product="odd Oz/ten-m homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG141398.1 transcript_id=mCT175113.1
FT                   created on 29-JAN-2003"
FT   CDS             complement(join(4710058..4710816,4712577..4712719,
FT                   4713241..4714461,4715290..4715677,4721562..4721858,
FT                   4733241..4733476,4734510..4734682,4753381..4753891,
FT                   4755296..4755662,4785444..4785598,4819427..4819659,
FT                   4825245..4825265,4834314..4834563,4840992..4841135,
FT                   4860690..4860957,4865602..4865863,4871541..4871660,
FT                   4890871..4891087,4901249..4901395,4903239..4903262,
FT                   4905455..4905640,4979463..4979663,4982881..4983075,
FT                   4986283..4986384,4991473..4991683,4993143..4993342,
FT                   5015088..5015237,5065325..5065563,5103514..5103754,
FT                   5233559..5233615,5235138..5235398,5323680..5323896))
FT                   /codon_start=1
FT                   /gene="Odz1"
FT                   /locus_tag="mCG_141398"
FT                   /product="odd Oz/ten-m homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG141398.1 transcript_id=mCT175113.1
FT                   protein_id=mCP98032.0"
FT                   /db_xref="GOA:A2ANM0"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR009471"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR027688"
FT                   /db_xref="InterPro:IPR028916"
FT                   /db_xref="MGI:MGI:1345185"
FT                   /db_xref="UniProtKB/TrEMBL:A2ANM0"
FT                   /protein_id="EDL29046.1"
FT                   /translation="MEQTDCKPYQPLSKVKHEMDLAYTSSSDESEDGRKPRQSFNSRET
FT                   LHEYNQELRRNYNSQSRKRKDVEKSTQEIEFCETPPTLCSGYHTDMHSVSRHGYQLEMG
FT                   SDVDTETEGAASPDHALRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKF
FT                   SPVCCDMEAPADSAQDMQSSPHNQFTFRPLPPPPPPPHACTCARKPPPTVDSLQRRSMT
FT                   TRSQPSPAAPAPPTSTQDSVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYP
FT                   LTSNTVYSPPPRPLPRSTFSRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAV
FT                   HLFGLTWQLQPVGQIYANGISNGNPGTESMDTTYSPIGGRVSDKSEKKVFQKGRAIDTG
FT                   EVDIGAQVMQTIPPGLFWRFQITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDF
FT                   VKLMDGKQLVKQDSKSSDDIQHSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQ
FT                   VFVLTTAIEIMDDCSTNCNGNGECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGH
FT                   CVCRNGWKGPECDVPEEQCIDPTCFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSSH
FT                   GICVKGECHCSTGWGGVNCETPLPICQEQCSGHGTFLLDTGVCSCDPKWTGSDCSTELC
FT                   TMECGSHGVCSRGICQCEEGWVGPTCEERSCHSHCAEHGQCKDGKCECSPGWEGDHCTI
FT                   AHYLDAVRDGCPGLCFGNGRCTLDQNGWHCVCQVGWSGTGCNIVMEMLCGDNLDNDGDG
FT                   LTDCVDPDCCQQSNCYVSPLCQGSPDPLDLIQQSQPLFSQHTSRLFYDRIKFLIGKDST
FT                   HVVPQDISFDSRRACVIRGQVVAVDGTPLVGVNVSFLHHSDYGFTISRQDGSFDLVAIG
FT                   GISVVLIFDRSPFLSEKRTLWLPWNQFIVVEKVIMQRIVADAPSCDISNFISPNPIVLP
FT                   SPLTSFGGSCPERGTIVPELQVVQEEIPIPSSFVRLSYLSSRTPGYKTLLRILLTHSTI
FT                   PVGMIKVHLTVSVEGRLTQKWFPAAINLVYTFAWNKTDIYGQKVWGLAEALVSVGYEYE
FT                   MCPEFILWEQRTVVLQGFEMDASNLGGWSLNKHHIFNPQSGIIHKGNGENMFISQQPPV
FT                   IATIMGNGHQRSVACTNCNGPAHNNKLFAPVALASGPDGSVYVGDFNFVRRIFPSGNSV
FT                   SILELRNRDTRHSTSPAHKYYLAMDPMSESLYLSDTNTRKVYKLKSLVETKDLSKNFEV
FT                   VAGTGDQCLPFDQSHCGDGGKASEASLNSPRGITVDRHGFIYFVDGTMIRRIDENAVIT
FT                   TVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSLYVLDNNIVLQISENRRV
FT                   RIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISVSHSGLLFIAETDERKVNRIQQV
FT                   TTNGEISIIAGAPTDCDCKIDPNCDCFSGDGGYAKDAKMKAPSSLAVSPDGTLYVADLG
FT                   NVRIRTISKNQAHLNDMNLYEIASPADQELYQFTVNGTHLHTMNLITRDYVYNFTYNAE
FT                   GDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKRVSAQGYNLALMT
FT                   YPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGEVSSFHSDLEKLTKVALDTSNR
FT                   ENVLMSTNLTATSTIYILKQENTQSTYRVSPDGSLRVTFASGMEINLSSEPHILAGAVN
FT                   PTLGKCNISLPGEHNANLIEWRQRKEQNKGNVSAFERRLRAHNRNLLSIDFDHMTRTGK
FT                   IYDDHRKFTLRILYDQTGRPILWSPVSRYNEVNITYSPSGLVTFIQRGTWNEKMEYDQS
FT                   GKIISRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQSDCLLSVTMPSMVRHSLQTM
FT                   LSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTLHLGTGRRVLYKYTKQARLSEILYDTT
FT                   QVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEGLVNARFDYSYNN
FT                   FRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHTKIFNA
FT                   NGQVIEVQYEILKAIAYWMTIQYDNMGRMVICDIRVGVDANITRYFYEYDADGQLQTVS
FT                   VNDKIQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQYKMDEDGFLRQRG
FT                   NDIFEYNSNGLLQKAYNKVSGWTVQYYYDGLGRRVASKSSLGQHLQFFYADLANPIRVT
FT                   HLYNHTSAEITSLYYDLQGHLIAMELSSGEEYYVACDNMGTPLAVFSSRGQVIKEILYT
FT                   PYGDIYHDTYPDFEVIIGFHGGLYDFLTKLVHLGQRDYDVVAGRWTTPNHHIWKQLNLL
FT                   PKPFNLYSFENNYPVGKIQDVAKYTTDIGTWLELFGFQLHNVLPGFPKPELENMELTYE
FT                   LLQLQTKTQEWDPGKMILGIQCELQKQLRNFISLDQLPMTPQYNEGRCLEGGKQPRFAA
FT                   VPSVFGKGIKFAIKEGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIEGRDTHYFI
FT                   KLGSLEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNIRY
FT                   GTTVEEEKNHVLEMARQRAVAQAWTQEQRRLQEGEEGTRVWTEGEKQQLLGTGRVQGYD
FT                   GYFVLSVEQYLELSDSANNIHFMRQSEIGRR"
FT   gene            complement(6503891..6506898)
FT                   /locus_tag="mCG_1050349"
FT                   /note="gene_id=mCG1050349.0"
FT   mRNA            complement(6503891..6506898)
FT                   /locus_tag="mCG_1050349"
FT                   /product="mCG1050349"
FT                   /note="gene_id=mCG1050349.0 transcript_id=mCT194355.0
FT                   created on 26-APR-2004"
FT   CDS             complement(6505155..6506564)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050349"
FT                   /product="mCG1050349"
FT                   /note="gene_id=mCG1050349.0 transcript_id=mCT194355.0
FT                   protein_id=mCP115384.0"
FT                   /protein_id="EDL29047.1"
FT                   /translation="MAPQQTGSRKRKASEVEQGAGTSSLPGRAAAAAGTGQADGPLLLA
FT                   KRPRRPVARRSLVHYLKGRALGADGHPGVAGFEGDLRSYGVLRLPELLRERQLTLGPLN
FT                   KVFASQWLNARQVVCGTKCNTLFVVDVQTGRITRIPLMRDRGPGQTRAQPTCGIHAIQL
FT                   NPSKTLLATGGENPNSLAVYQLPTLDPVCLGDRQGHRDWIFAIAWMSDTVAVSGSRDGT
FT                   VALWRVDSDMFNGSIPWHNNSGIPRYSHIRPRDMEAIPRATTNPGNRKVRALAFSGRNQ
FT                   ELGAVSLDGYFHLWKARSSLSRLLSLRLPYCRENVCLTYCDELSLYAVGSQSHVSFLDP
FT                   RQRQQNIKPLCSREGGTGVRSLSFYQHIITVGTGHGSLLFYDIRAQKFLEERASASPDS
FT                   FLGRTGRKLKLTCGRGWLNQDELWVNYFGGTEEFPNALYTHCYNWPEMKLFVGGGPLPS
FT                   GLHGNYAGLWS"
FT   gene            7232170..7234013
FT                   /locus_tag="mCG_55068"
FT                   /note="gene_id=mCG55068.2"
FT   mRNA            join(7232170..7232256,7233035..7234013)
FT                   /locus_tag="mCG_55068"
FT                   /product="mCG55068"
FT                   /note="gene_id=mCG55068.2 transcript_id=mCT55251.2 created
FT                   on 05-FEB-2003"
FT   CDS             join(7232237..7232256,7233035..7233869)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55068"
FT                   /product="mCG55068"
FT                   /note="gene_id=mCG55068.2 transcript_id=mCT55251.2
FT                   protein_id=mCP34974.2"
FT                   /protein_id="EDL29048.1"
FT                   /translation="MACTENGLAGHSHSPIIVPVDKNRSKETCHNVQLRSLSSMLKDDE
FT                   DDADVWTRPPVSLRPPFNVPRTGARIPQNPRAPRHPLTLTPAIEEESLATAEINSSEGL
FT                   ESQSQKGHDSINMSQEFSGSPMALMIGGPRVGSRVLERSGNNSKPYIPVPRSQGFFPPR
FT                   GSQSRGPPYIPTLRSGIMMEVTPGNARMANRGNMAHVSFPLGSPRHPMDNWQQSPSLPL
FT                   SPSITGLPCSSAHCFLPPQAPAFNPFPVMPTAFASPLRFGPPLLPYVFHYNTGAMYPPP
FT                   YLN"
FT   gene            complement(8397846..>8458838)
FT                   /locus_tag="mCG_145461"
FT                   /note="gene_id=mCG145461.0"
FT   mRNA            complement(join(8397846..8398397,8457571..8457686,
FT                   8458737..>8458838))
FT                   /locus_tag="mCG_145461"
FT                   /product="mCG145461"
FT                   /note="gene_id=mCG145461.0 transcript_id=mCT184885.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(8398370..8398397,8457571..8457686,
FT                   8458737..>8458799))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145461"
FT                   /product="mCG145461"
FT                   /note="gene_id=mCG145461.0 transcript_id=mCT184885.0
FT                   protein_id=mCP105979.0"
FT                   /protein_id="EDL29049.1"
FT                   /translation="ANTIHLEKDEKLHTSHLTSQLLLPTFLFLQNHPPPFLLQKTSGLS
FT                   EMTARLVKTIYSKTRNLVDGCDP"
FT   gene            8458932..8460273
FT                   /gene="Actrt1"
FT                   /locus_tag="mCG_10944"
FT                   /note="gene_id=mCG10944.1"
FT   mRNA            8458932..8460273
FT                   /gene="Actrt1"
FT                   /locus_tag="mCG_10944"
FT                   /product="actin-related protein T1"
FT                   /note="gene_id=mCG10944.1 transcript_id=mCT10805.1 created
FT                   on 16-DEC-2002"
FT   CDS             8459036..8460166
FT                   /codon_start=1
FT                   /gene="Actrt1"
FT                   /locus_tag="mCG_10944"
FT                   /product="actin-related protein T1"
FT                   /note="gene_id=mCG10944.1 transcript_id=mCT10805.1
FT                   protein_id=mCP18082.2"
FT                   /protein_id="EDL29050.1"
FT                   /translation="MLDPARLDNPAVIFDNGSGLCKVGISGEIEPRHVINSVVGHPKFN
FT                   IPSARSNRKRYFVGEEAQCMYDGLYLHYPIERGLVTRWDDMEKLWKDLFEWELGVKPNE
FT                   QPVFMTEPSLNPQETREKTTEIMFEKFNVPALYLCNHAVGALCASACITGLVLDSGDGV
FT                   TCTVPVYEGYSLPHAITKLYVAGRDITEHLTRLLLAKGYTFPCILNKAVVDDIKEKLCT
FT                   VSLGYKDTEKNCQQFLRKYTLPDGNTIQMSDHLCQVPEVLFTPDHLGIHDLGISKMVCN
FT                   SIMNCDTDIQENLFAEIVLSGGTTMFPGLQDRLLKELEDLAFEGTPIKITASSDRCYSA
FT                   WIGGSVMTSMTTFKQMWVTAEDFKEYGAFVVQRKCF"
FT   gene            complement(<8586454..>8586861)
FT                   /locus_tag="mCG_49690"
FT                   /note="gene_id=mCG49690.0"
FT   mRNA            complement(<8586454..>8586861)
FT                   /locus_tag="mCG_49690"
FT                   /product="mCG49690"
FT                   /note="gene_id=mCG49690.0 transcript_id=mCT49873.0 created
FT                   on 20-FEB-2003"
FT   CDS             complement(8586454..8586861)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49690"
FT                   /product="mCG49690"
FT                   /note="gene_id=mCG49690.0 transcript_id=mCT49873.0
FT                   protein_id=mCP38685.0"
FT                   /db_xref="GOA:A2AD25"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="MGI:MGI:3647751"
FT                   /db_xref="UniProtKB/TrEMBL:A2AD25"
FT                   /protein_id="EDL29051.1"
FT                   /translation="MAALRPLVKPKIVKKRTKKFIRHQSDRYVKIKQNWWKPRGIYNRV
FT                   RRRFKGEILMPNISYRSNKKTKHMLPSSFCKFLVHDVKELEVLLMCNKSYCAEIAHNVS
FT                   SKNREAIVERAAQLAIRVSNPNARLRSEENE"
FT   gene            complement(8666943..>8667584)
FT                   /locus_tag="mCG_50437"
FT                   /note="gene_id=mCG50437.2"
FT   mRNA            complement(8666943..>8667584)
FT                   /locus_tag="mCG_50437"
FT                   /product="mCG50437"
FT                   /note="gene_id=mCG50437.2 transcript_id=mCT50620.2 created
FT                   on 06-JAN-2003"
FT   CDS             complement(8666952..>8667299)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50437"
FT                   /product="mCG50437"
FT                   /note="gene_id=mCG50437.2 transcript_id=mCT50620.2
FT                   protein_id=mCP43008.2"
FT                   /protein_id="EDL29052.1"
FT                   /translation="DYSVGLVWWMLAREVLCMRGTISRGHPWEVIPDLYFYRDPEEIEK
FT                   VEQAAAEKAVTKEEFQGEWSAPASEFTAAQPEVADWSEGVQVPSVLIQQFPTEDWSAQP
FT                   ATEDWTAAPPV"
FT   gene            complement(9561737..9564443)
FT                   /locus_tag="mCG_147979"
FT                   /note="gene_id=mCG147979.0"
FT   mRNA            complement(9561737..9564443)
FT                   /locus_tag="mCG_147979"
FT                   /product="mCG147979"
FT                   /note="gene_id=mCG147979.0 transcript_id=mCT188242.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(9562578..9562799)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147979"
FT                   /product="mCG147979"
FT                   /note="gene_id=mCG147979.0 transcript_id=mCT188242.0
FT                   protein_id=mCP109517.0"
FT                   /protein_id="EDL29053.1"
FT                   /translation="MPVLTQSRRDRIVESGSLDSQPTILFIEVILLEMLSAFSATHLFS
FT                   LFWVTKSMVGWKVNVEAKLSWLVFFQSE"
FT   gene            9844283..9845717
FT                   /locus_tag="mCG_49158"
FT                   /note="gene_id=mCG49158.2"
FT   mRNA            join(9844283..9844551,9844821..9845035,9845302..9845717)
FT                   /locus_tag="mCG_49158"
FT                   /product="mCG49158"
FT                   /note="gene_id=mCG49158.2 transcript_id=mCT49341.2 created
FT                   on 11-MAR-2003"
FT   CDS             join(9844286..9844551,9844821..9845035,9845302..9845699)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49158"
FT                   /product="mCG49158"
FT                   /note="gene_id=mCG49158.2 transcript_id=mCT49341.2
FT                   protein_id=mCP28887.2"
FT                   /protein_id="EDL29054.1"
FT                   /translation="MEEVLAEELEEEEQLVRWHQKKKKELQAKIQGIKNAVPKNDKKRR
FT                   KQLKEDVAKLEREMEQKHREELEQLKLTFKDSKADSVVLTFQTWVLVSSHFFSTYRVAD
FT                   LFSSLDTFSSSSIGGPVIHPIADCEHSLLCLLGPSLVSQETAISGSFQQNLASVCNVLE
FT                   DQLREQDSALTVAALRRQAAEYMQSHSDDFMPFLTNLSTGDMYTPEEFGKYCDDIVNTV
FT                   AWGGQLELRAPSHILQTPTEILQADVPPTIVGEEYPRNPLVLVYMRHAYSLGEHYNSVT
FT                   QLVNSATENCN"
FT   gene            complement(9921972..9998744)
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /note="gene_id=mCG114900.2"
FT   mRNA            complement(join(9921972..9922722,9923729..9923870,
FT                   9935967..9936179,9936292..9936410,9939095..9939227,
FT                   9941435..9941557,9954115..9954228,9954487..9954597,
FT                   9962386..9962505,9964120..9964268,9965070..9965202,
FT                   9967041..9967193,9970723..9970844,9972889..9973115,
FT                   9973747..9973856,9979365..9979433,9980374..9980505,
FT                   9981595..9981750,9984656..9984835,9988951..9989051,
FT                   9989180..9989280,9989641..9989807,9992701..9992802,
FT                   9997818..>9998111))
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a, member 1,
FT                   transcript variant mCT192576"
FT                   /note="gene_id=mCG114900.2 transcript_id=mCT192576.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(9922302..9922722,9923760..9923870,
FT                   9935967..9936179,9936292..9936410,9939095..9939227,
FT                   9941435..9941557,9954115..9954228,9954487..9954597,
FT                   9962386..9962505,9964120..9964268,9965070..9965202,
FT                   9967041..9967193,9970723..9970844,9972889..9973115,
FT                   9973747..9973856,9979365..9979433,9980374..9980505,
FT                   9981595..9981750,9984656..9984835,9988951..9989051,
FT                   9989180..9989280,9989641..9989807,9992701..9992802,
FT                   9997818..9998041,9998635..9998744))
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a, member 1,
FT                   transcript variant mCT115994"
FT                   /note="gene_id=mCG114900.2 transcript_id=mCT115994.1
FT                   created on 16-DEC-2002"
FT   mRNA            complement(join(9922302..9922722,9923760..9923870,
FT                   9935967..9936179,9936292..9936410,9939095..9939227,
FT                   9941435..9941557,9954115..9954228,9954487..9954597,
FT                   9962386..9962505,9964120..9964268,9965070..9965202,
FT                   9967041..9967193,9970723..9970844,9972889..9973115,
FT                   9973747..9973856,9979365..9979433,9980374..9980505,
FT                   9981595..9981750,9984656..9984835,9988951..9989051,
FT                   9989180..9989280,9989641..9989807,9992701..9992802,
FT                   9997818..>9998134))
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a, member 1,
FT                   transcript variant mCT192575"
FT                   /note="gene_id=mCG114900.2 transcript_id=mCT192575.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(9922651..9922722,9923760..9923870,
FT                   9935967..9936179,9936292..9936410,9939095..9939227,
FT                   9941435..9941557,9954115..9954228,9954487..9954597,
FT                   9962386..9962505,9964120..9964268,9965070..9965202,
FT                   9967041..9967193,9970723..9970844,9972889..9973115,
FT                   9973747..9973856,9979365..9979433,9980374..9980505,
FT                   9981595..9981750,9984656..9984835,9988951..9989051,
FT                   9989180..9989280,9989641..9989807,9992701..9992802,
FT                   9997818..9998041,9998635..9998704))
FT                   /codon_start=1
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a, member 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG114900.2 transcript_id=mCT115994.1
FT                   protein_id=mCP87590.1 isoform=CRA_a"
FT                   /protein_id="EDL29055.1"
FT                   /translation="MQRKTNSTHKQRSSLCKKGRAPQGTSLLPFLVPPRLSRSNAMEPD
FT                   TATEAATVAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITSPF
FT                   QLKLAAKASKSEKEMDPEYEEKMVNMPLKADRAKRFEFLLKQTELFAHFIQPSAQKSPT
FT                   SPLNMKLARPRVKKDDKQSLISVGDYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSY
FT                   VKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHM
FT                   VLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVTSYEMVIK
FT                   EKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALL
FT                   NFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEI
FT                   KIYLGLSKMQREWYTKILMKDIDVLNSSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPG
FT                   PPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYSR
FT                   LDGQTPHEEREEAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDL
FT                   QAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLA
FT                   KEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKKTAEMNERMQKMGESSLRNFRM
FT                   DLEQSLYKFEGEDYREKQKLGTVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPR
FT                   PPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPEIPNPAIAQREEQKKIDGA
FT                   EPLTPQETEEKDKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVME
FT                   YSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGT
FT                   SKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRR
FT                   CNTLISLIEKENMEIEERERAEKKKRATKTPMSQKRKAESATESSGRKDVKKVKS"
FT   CDS             complement(join(9922651..9922722,9923760..9923870,
FT                   9935967..9936179,9936292..9936410,9939095..9939227,
FT                   9941435..9941557,9954115..9954228,9954487..9954597,
FT                   9962386..9962505,9964120..9964268,9965070..9965202,
FT                   9967041..9967193,9970723..9970844,9972889..9973115,
FT                   9973747..9973856,9979365..9979433,9980374..9980505,
FT                   9981595..9981750,9984656..9984835,9988951..9989051,
FT                   9989180..9989280,9989641..9989807,9992701..9992802,
FT                   9997818..>9998132))
FT                   /codon_start=1
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a, member 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG114900.2 transcript_id=mCT192575.0
FT                   protein_id=mCP113528.0 isoform=CRA_b"
FT                   /protein_id="EDL29056.1"
FT                   /translation="KVGGERRGWKLVFSTPALASSFQRSHRCRTGTSLLPFLVPPRLSR
FT                   SNAMEPDTATEAATVAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKK
FT                   EKITSPFQLKLAAKASKSEKEMDPEYEEKMVNMPLKADRAKRFEFLLKQTELFAHFIQP
FT                   SAQKSPTSPLNMKLARPRVKKDDKQSLISVGDYRHRRTEQEEDEELLSESRKTSNVCVR
FT                   FEVSPSYVKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYR
FT                   NIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVT
FT                   SYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNL
FT                   HELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKS
FT                   LPPKKEIKIYLGLSKMQREWYTKILMKDIDVLNSSGKMDKMRLLNILMQLRKCCNHPYL
FT                   FDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMW
FT                   RGYEYSRLDGQTPHEEREEAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSD
FT                   WNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLID
FT                   QQSNKLAKEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKKTAEMNERMQKMGES
FT                   SLRNFRMDLEQSLYKFEGEDYREKQKLGTVEWIEPPKRERKANYAVDAYFREALRVSEP
FT                   KIPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPEIPNPAIAQREE
FT                   QKKIDGAEPLTPQETEEKDKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGK
FT                   SPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQ
FT                   LRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRT
FT                   AMEFQRRCNTLISLIEKENMEIEERERAEKKKRATKTPMSQKRKAESATESSGRKDVKK
FT                   VKS"
FT   CDS             complement(join(9923736..9923870,9935967..9936179,
FT                   9936292..9936410,9939095..9939227,9941435..9941557,
FT                   9954115..9954228,9954487..9954597,9962386..9962505,
FT                   9964120..9964268,9965070..9965202,9967041..9967193,
FT                   9970723..9970844,9972889..9973115,9973747..9973856,
FT                   9979365..9979433,9980374..9980505,9981595..9981750,
FT                   9984656..9984835,9988951..9989051,9989180..9989280,
FT                   9989641..9989807,9992701..9992802,9997818..>9998111))
FT                   /codon_start=1
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a, member 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG114900.2 transcript_id=mCT192576.0
FT                   protein_id=mCP113529.0 isoform=CRA_c"
FT                   /protein_id="EDL29057.1"
FT                   /translation="GWKLVFSTPALASSFQRSHRCRTGTSLLPFLVPPRLSRSNAMEPD
FT                   TATEAATVAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITSPF
FT                   QLKLAAKASKSEKEMDPEYEEKMVNMPLKADRAKRFEFLLKQTELFAHFIQPSAQKSPT
FT                   SPLNMKLARPRVKKDDKQSLISVGDYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSY
FT                   VKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHM
FT                   VLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVTSYEMVIK
FT                   EKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALL
FT                   NFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEI
FT                   KIYLGLSKMQREWYTKILMKDIDVLNSSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPG
FT                   PPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYSR
FT                   LDGQTPHEEREEAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDL
FT                   QAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLA
FT                   KEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKKTAEMNERMQKMGESSLRNFRM
FT                   DLEQSLYKFEGEDYREKQKLGTVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPR
FT                   PPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPEIPNPAIAQREEQKKIDGA
FT                   EPLTPQETEEKDKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVME
FT                   YSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGT
FT                   SKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRR
FT                   CNTLISLIEKENMEIEERERAEKKKRATKTPMVKFSAFS"
FT   gene            10006086..10006646
FT                   /locus_tag="mCG_18971"
FT                   /note="gene_id=mCG18971.0"
FT   mRNA            10006086..10006646
FT                   /locus_tag="mCG_18971"
FT                   /product="mCG18971"
FT                   /note="gene_id=mCG18971.0 transcript_id=mCT16480.0 created
FT                   on 06-JAN-2003"
FT   CDS             10006117..10006599
FT                   /codon_start=1
FT                   /locus_tag="mCG_18971"
FT                   /product="mCG18971"
FT                   /note="gene_id=mCG18971.0 transcript_id=mCT16480.0
FT                   protein_id=mCP6377.1"
FT                   /db_xref="GOA:Q9CQM8"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="MGI:MGI:1278340"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CQM8"
FT                   /protein_id="EDL29058.1"
FT                   /translation="MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGM
FT                   GTVQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVRIEHIKHSKSRDS
FT                   FLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPELLEPIPYEFMA"
FT   gene            10017922..10071021
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /note="gene_id=mCG18974.3"
FT   mRNA            join(10017922..10018173,10021861..10021940,
FT                   10025571..10025609,10035805..10035915,10036332..10036418,
FT                   10037010..10037130,10037218..10037379,10038808..10038909,
FT                   10040279..10040393,10041524..10041640,10041735..10041922,
FT                   10043733..10043844,10046543..10046652,10048940..10049075,
FT                   10052437..10052547,10053141..10053306,10053559..10053794,
FT                   10061368..10062233)
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /product="oculocerebrorenal syndrome of Lowe, transcript
FT                   variant mCT181827"
FT                   /note="gene_id=mCG18974.3 transcript_id=mCT181827.0 created
FT                   on 07-APR-2003"
FT   mRNA            join(10017925..10018173,10021862..10021940,
FT                   10025571..10025609,10035805..10035915,10036332..10036418,
FT                   10037010..10037130,10037218..10037379,10038808..10038909,
FT                   10040279..10040393,10041524..10041640,10041735..10041922,
FT                   10043733..10043844,10046543..10046652,10048940..10049075,
FT                   10052437..10052547,10053141..10053306,10053559..10053794,
FT                   10065611..10065727,10066535..10066619,10067238..10067365,
FT                   10068299..10068410,10068618..10071021)
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /product="oculocerebrorenal syndrome of Lowe, transcript
FT                   variant mCT16483"
FT                   /note="gene_id=mCG18974.3 transcript_id=mCT16483.3 created
FT                   on 07-APR-2003"
FT   mRNA            join(10017939..10018173,10035805..10035915,
FT                   10036332..10036418,10037010..10037130,10037218..10037379,
FT                   10038808..10038909,10040279..10040393,10041524..10041640,
FT                   10041735..10041922,10043733..10043844,10046543..10046652,
FT                   10048940..10049075,10052437..10052547,10053559..10053794,
FT                   10061368..10062233)
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /product="oculocerebrorenal syndrome of Lowe, transcript
FT                   variant mCT181826"
FT                   /note="gene_id=mCG18974.3 transcript_id=mCT181826.0 created
FT                   on 07-APR-2003"
FT   CDS             join(10018138..10018173,10021862..10021940,
FT                   10025571..10025609,10035805..10035915,10036332..10036418,
FT                   10037010..10037130,10037218..10037379,10038808..10038909,
FT                   10040279..10040393,10041524..10041640,10041735..10041922,
FT                   10043733..10043844,10046543..10046652,10048940..10049075,
FT                   10052437..10052547,10053141..10053306,10053559..10053794,
FT                   10065611..10065727,10066535..10066619,10067238..10067365,
FT                   10068299..10068410,10068618..10068742)
FT                   /codon_start=1
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /product="oculocerebrorenal syndrome of Lowe, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18974.3 transcript_id=mCT16483.3
FT                   protein_id=mCP6380.3 isoform=CRA_a"
FT                   /protein_id="EDL29059.1"
FT                   /translation="MEPRLPIGAQPLLIIQLHGKEQHVQDIIPINSHFRCVQEAEETLL
FT                   IDIASNSGCKIRVQGDWTRERHFEIPDEERCLKFLSEVLEAQEAQSQLLVPEQKDSSSW
FT                   YQKLDTMDKPAYSGLLGFEDNFSSLDLDKKMNTQNPRSGSHREPPPPPSSSTRMLSREK
FT                   EASNKEQPKVTNTMRKLFVPNTQTGQREGLIKHILTKREKEYVNIQSFRFFVGTWNVNG
FT                   QSPDSSLEPWLDCDPNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSLAVERGLPSKAK
FT                   YRKVQLVRLVGMMLLIFARKDQCQYIRDVATETTGTGIMGKMGNKGGVAVRFVFHNTTF
FT                   CIVNSHLAAHVEEFERRNQDYKDICARMTFSVPNQTVPQVNIMKHDVVIWLGDLNYRLC
FT                   MPDASEVKSLINKNELHKLLKFDQLNIQRTQKKAFADFNEGEINFVPTYKYDSKTDRWD
FT                   SSGKCRVPAWCDRILWRGINVNQLHYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKV
FT                   FEDIVRIMDRMENDFLPSLELSRREFFFENVKFRQLQKEKFQISNNGQVPCHFSFIPKL
FT                   NDSQYCKPWLRAEPFEGYLEPNETLDISLDVYVSKDSVTILNSGEDKIEDILVLHLDRG
FT                   KDYFLTIGGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEKSLLQMVPLDEGTSERP
FT                   LQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGNNHSVAEA
FT                   LLIFLEALPEPVICYELYQRCLDSAHDPRICKQVISQLPRCHRNVFRYLMAFLRELLKF
FT                   SDYNNINTNMIATLFSSLLLRPPPNLMTRQTPNDRQHAIQFLLVFLLGNEED"
FT   CDS             join(10036397..10036418,10037010..10037130,
FT                   10037218..10037379,10038808..10038909,10040279..10040393,
FT                   10041524..10041640,10041735..10041922,10043733..10043844,
FT                   10046543..10046652,10048940..10049075,10052437..10052547,
FT                   10053141..10053306,10053559..10053794,10061368..10061439)
FT                   /codon_start=1
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /product="oculocerebrorenal syndrome of Lowe, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG18974.3 transcript_id=mCT181827.0
FT                   protein_id=mCP104749.0 isoform=CRA_c"
FT                   /protein_id="EDL29061.1"
FT                   /translation="MDKPAYSGLLGFEDNFSSLDLDKKMNTQNPRSGSHREPPPPPSSS
FT                   TRMLSREKEASNKEQPKVTNTMRKLFVPNTQTGQREGLIKHILTKREKEYVNIQSFRFF
FT                   VGTWNVNGQSPDSSLEPWLDCDPNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSLAVE
FT                   RGLPSKAKYRKVQLVRLVGMMLLIFARKDQCQYIRDVATETTGTGIMGKMGNKGGVAVR
FT                   FVFHNTTFCIVNSHLAAHVEEFERRNQDYKDICARMTFSVPNQTVPQVNIMKHDVVIWL
FT                   GDLNYRLCMPDASEVKSLINKNELHKLLKFDQLNIQRTQKKAFADFNEGEINFVPTYKY
FT                   DSKTDRWDSSGKCRVPAWCDRILWRGINVNQLHYRSHMELKTSDHKPVSALFHIGVKVV
FT                   DERRYRKVFEDIVRIMDRMENDFLPSLELSRREFFFENVKFRQLQKEKFQISNNGQVPC
FT                   HFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETLDISLDVYVSKDSVTILNSGEDKIEDI
FT                   LVLHLDRGKDYFLTIGGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSYLEKVI
FT                   QSIGGNEGFLVLD"
FT   CDS             join(10036397..10036418,10037010..10037130,
FT                   10037218..10037379,10038808..10038909,10040279..10040393,
FT                   10041524..10041640,10041735..10041922,10043733..10043844,
FT                   10046543..10046652,10048940..10049075,10052437..10052547,
FT                   10053559..10053570)
FT                   /codon_start=1
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /product="oculocerebrorenal syndrome of Lowe, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18974.3 transcript_id=mCT181826.0
FT                   protein_id=mCP104748.0 isoform=CRA_b"
FT                   /protein_id="EDL29060.1"
FT                   /translation="MDKPAYSGLLGFEDNFSSLDLDKKMNTQNPRSGSHREPPPPPSSS
FT                   TRMLSREKEASNKEQPKVTNTMRKLFVPNTQTGQREGLIKHILTKREKEYVNIQSFRFF
FT                   VGTWNVNGQSPDSSLEPWLDCDPNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSLAVE
FT                   RGLPSKAKYRKVQLVRLVGMMLLIFARKDQCQYIRDVATETTGTGIMGKMGNKGGVAVR
FT                   FVFHNTTFCIVNSHLAAHVEEFERRNQDYKDICARMTFSVPNQTVPQVNIMKHDVVIWL
FT                   GDLNYRLCMPDASEVKSLINKNELHKLLKFDQLNIQRTQKKAFADFNEGEINFVPTYKY
FT                   DSKTDRWDSSGKCRVPAWCDRILWRGINVNQLHYRSHMELKTSDHKPVSALFHIGVKVV
FT                   DERRYRKVFEDIVRIMDRMENDFLPSLELSRRETRP"
FT   gene            10116454..10117572
FT                   /locus_tag="mCG_142398"
FT                   /note="gene_id=mCG142398.0"
FT   mRNA            10116454..10117572
FT                   /locus_tag="mCG_142398"
FT                   /product="mCG142398"
FT                   /note="gene_id=mCG142398.0 transcript_id=mCT180381.0
FT                   created on 03-MAR-2003"
FT   CDS             10116523..10116768
FT                   /codon_start=1
FT                   /locus_tag="mCG_142398"
FT                   /product="mCG142398"
FT                   /note="gene_id=mCG142398.0 transcript_id=mCT180381.0
FT                   protein_id=mCP103303.0"
FT                   /protein_id="EDL29062.1"
FT                   /translation="MADQLTEEQIAEFKDAFSLFDKDGDGKITTKELGTVMRSLGQNPT
FT                   EAELQDMINEVDAASNGTIDFPEFMTMMARTMKDRQ"
FT   gene            complement(10131648..>10141338)
FT                   /gene="Apln"
FT                   /locus_tag="mCG_5047"
FT                   /note="gene_id=mCG5047.2"
FT   mRNA            complement(join(10131648..10134208,10134795..10134966,
FT                   10140944..>10141338))
FT                   /gene="Apln"
FT                   /locus_tag="mCG_5047"
FT                   /product="apelin"
FT                   /note="gene_id=mCG5047.2 transcript_id=mCT4321.2 created on
FT                   16-DEC-2002"
FT   CDS             complement(join(10134800..10134966,10140944..>10141316))
FT                   /codon_start=1
FT                   /gene="Apln"
FT                   /locus_tag="mCG_5047"
FT                   /product="apelin"
FT                   /note="gene_id=mCG5047.2 transcript_id=mCT4321.2
FT                   protein_id=mCP5258.2"
FT                   /protein_id="EDL29063.1"
FT                   /translation="ESRAEQRQPLREFLPPTRSHQGQLRGAAPRRQRRLHQSRGSEQEW
FT                   GRQPAVRLGRSPSRGPGATRAPCPHAPAPARAFLCVRVPCLSAHSPAPLGCRGPSCSMN
FT                   LRLCVQALLLLWLSLTAVCGVPLMLPPDGTGLEEGSMRYLVKPRTSRTGPGAWQGGRRK
FT                   FRRQRPRLSHKGPMPF"
FT   gene            10215142..10243147
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /note="gene_id=mCG5051.2"
FT   mRNA            join(10215142..10215462,10217992..10218065,
FT                   10219937..10220047,10222186..10222249,10223210..10223314,
FT                   10223536..10223622,10224593..10224739,10228059..10228160,
FT                   10228787..10228868,10229146..10229341,10230097..10230186,
FT                   10230874..10230983,10231603..10231680,10233127..10233198,
FT                   10234971..10235031,10236240..10236309,10236872..10236976,
FT                   10237341..10237400,10238091..10238167,10241278..10241367,
FT                   10241901..10243147)
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /product="X-prolyl aminopeptidase (aminopeptidase P) 2,
FT                   membrane-bound, transcript variant mCT4309"
FT                   /note="gene_id=mCG5051.2 transcript_id=mCT4309.2 created on
FT                   16-DEC-2002"
FT   mRNA            join(<10215186..10215462,10217992..10218065,
FT                   10219937..10220047,10222186..10222249,10223210..10223314,
FT                   10223536..10223622,10224593..10224739,10228059..10228160,
FT                   10228787..10228868,10229146..10229341,10230097..10230186,
FT                   10230874..10230983,10231603..10231680,10233127..10233198,
FT                   10234971..10235031,10236240..10236309,10236872..10236976,
FT                   10237341..10237400,10238091..10238167,10239169..10240218)
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /product="X-prolyl aminopeptidase (aminopeptidase P) 2,
FT                   membrane-bound, transcript variant mCT192583"
FT                   /note="gene_id=mCG5051.2 transcript_id=mCT192583.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<10215196..10215462,10217992..10218065,
FT                   10219937..10220047,10222186..10222249,10223210..10223314,
FT                   10223536..10223622,10224593..10224739,10228059..10228361,
FT                   10228787..10228868,10229146..10229341,10230097..10230186,
FT                   10230874..10230983,10231603..10231680,10233127..10233198,
FT                   10234971..10235031,10236240..10236309,10236872..10236976,
FT                   10237341..10237400,10238091..10238167,10241278..10241367,
FT                   10241901..10242836)
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /product="X-prolyl aminopeptidase (aminopeptidase P) 2,
FT                   membrane-bound, transcript variant mCT192584"
FT                   /note="gene_id=mCG5051.2 transcript_id=mCT192584.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<10215258..10215462,10217992..10218065,
FT                   10219937..10220047,10222186..10222249,10223210..10223314,
FT                   10223536..10223622,10224593..10224739,10228059..10228361,
FT                   10228787..10228868,10229146..10229341,10230097..10230186,
FT                   10230874..10230983,10231603..10231680,10233127..10233198,
FT                   10234971..10235031,10236240..10236309,10236872..10236976,
FT                   10237341..10237400,10238091..10238167,10241278..10241367,
FT                   10241901..10242095)
FT                   /codon_start=1
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /product="X-prolyl aminopeptidase (aminopeptidase P) 2,
FT                   membrane-bound, isoform CRA_b"
FT                   /note="gene_id=mCG5051.2 transcript_id=mCT192584.0
FT                   protein_id=mCP113540.0 isoform=CRA_b"
FT                   /protein_id="EDL29065.1"
FT                   /translation="NKRLQKDPHLTSRHSHQPYLLLPRKGLEEEATKQPNPLSSPLIYS
FT                   SPASGDPMAQAYWQCYPWLVLLCACAWSYPEPKYLGREDVRNCSTSPERLPVTAVNTTM
FT                   RLAALRQQMETWNLSAYIIPDTDAHMSEYIGKPDKRREWISGFTGSAGTAVVTMGKAAV
FT                   WTDSRYWTQAERQMDCNWELHKEVSISSIVAWILAEVPDGQNVGFDPFLFSVDSWKNYD
FT                   QGFQDSSRHLLSVTTNLVDVAWGSERPPVPSQPIYALPKEFTGSTWQEKVSAVRSYMEH
FT                   HAKTPTGVLLSALDETACEWGFLNMGQSGSPKLPGPCNIQLFLKQQHIHQLLRAPKIIV
FT                   CGNSEGKRAAVWGYRTRKPGSSKQVGLFNLRSSDIPYNPFFYSYALLTNSSIRLFVNKS
FT                   RFSLETLQYLNTNCTLPMCVQLEDYSQVRDSVKAYASGDVKILIGVSYTTYGVYEVIPK
FT                   EKLVTDTYSPVMLIKAVKNSKEQALLKSSHVRDAVAVIQYLVWLEKNVPKGTVDEFSGA
FT                   EYIDELRRNENFSSGPSFETISASGLNAALAHYSPTKELHRKLSSDEMYLVDSGGQYWD
FT                   GTTDITRTVHWGTPTAFQKEAYTRVLMGNIDLSRLVFPAATSGRVIEAFARRALWEVGL
FT                   NYGHGTGHGIGNFLCVHEWPVGFQYNNIAMAKGMFTSIEPGYYHDGEFGIRLEDVALVV
FT                   EAKTKYPGDYLTFELVSFVPYDRNLIDVRLLSPEQLQYLNRYYQTIRENVGPELQRRQL
FT                   LEEFAWLEQHTEPLSARAPHIISWTSLWVASALAILSWSS"
FT   CDS             join(<10215258..10215462,10217992..10218065,
FT                   10219937..10220047,10222186..10222249,10223210..10223314,
FT                   10223536..10223622,10224593..10224739,10228059..10228160,
FT                   10228787..10228868,10229146..10229341,10230097..10230186,
FT                   10230874..10230983,10231603..10231680,10233127..10233198,
FT                   10234971..10235031,10236240..10236309,10236872..10236976,
FT                   10237341..10237400,10238091..10238167,10239169..10239177)
FT                   /codon_start=1
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /product="X-prolyl aminopeptidase (aminopeptidase P) 2,
FT                   membrane-bound, isoform CRA_a"
FT                   /note="gene_id=mCG5051.2 transcript_id=mCT192583.0
FT                   protein_id=mCP113539.0 isoform=CRA_a"
FT                   /protein_id="EDL29064.1"
FT                   /translation="NKRLQKDPHLTSRHSHQPYLLLPRKGLEEEATKQPNPLSSPLIYS
FT                   SPASGDPMAQAYWQCYPWLVLLCACAWSYPEPKYLGREDVRNCSTSPERLPVTAVNTTM
FT                   RLAALRQQMETWNLSAYIIPDTDAHMSEYIGKPDKRREWISGFTGSAGTAVVTMGKAAV
FT                   WTDSRYWTQAERQMDCNWELHKEVSISSIVAWILAEVPDGQNVGFDPFLFSVDSWKNYD
FT                   QGFQDSSRHLLSVTTNLVDVAWGSERPPVPSQPIYALPKEFTGSTWQEKVSAVRSYMEH
FT                   HAKTPTGVLLSALDETAWLFNLRSSDIPYNPFFYSYALLTNSSIRLFVNKSRFSLETLQ
FT                   YLNTNCTLPMCVQLEDYSQVRDSVKAYASGDVKILIGVSYTTYGVYEVIPKEKLVTDTY
FT                   SPVMLIKAVKNSKEQALLKSSHVRDAVAVIQYLVWLEKNVPKGTVDEFSGAEYIDELRR
FT                   NENFSSGPSFETISASGLNAALAHYSPTKELHRKLSSDEMYLVDSGGQYWDGTTDITRT
FT                   VHWGTPTAFQKEAYTRVLMGNIDLSRLVFPAATSGRVIEAFARRALWEVGLNYGHGTGH
FT                   GIGNFLCVHEWPVGFQYNNIAMAKGMFTSIEPGYYHDGEFGIRLEDVALVVEAKTKMD"
FT   CDS             join(10215414..10215462,10217992..10218065,
FT                   10219937..10220047,10222186..10222249,10223210..10223314,
FT                   10223536..10223622,10224593..10224739,10228059..10228160,
FT                   10228787..10228868,10229146..10229341,10230097..10230186,
FT                   10230874..10230983,10231603..10231680,10233127..10233198,
FT                   10234971..10235031,10236240..10236309,10236872..10236976,
FT                   10237341..10237400,10238091..10238167,10241278..10241367,
FT                   10241901..10242095)
FT                   /codon_start=1
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /product="X-prolyl aminopeptidase (aminopeptidase P) 2,
FT                   membrane-bound, isoform CRA_c"
FT                   /note="gene_id=mCG5051.2 transcript_id=mCT4309.2
FT                   protein_id=mCP5262.2 isoform=CRA_c"
FT                   /db_xref="GOA:B1AVD1"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="MGI:MGI:2180001"
FT                   /db_xref="UniProtKB/TrEMBL:B1AVD1"
FT                   /protein_id="EDL29066.1"
FT                   /translation="MAQAYWQCYPWLVLLCACAWSYPEPKYLGREDVRNCSTSPERLPV
FT                   TAVNTTMRLAALRQQMETWNLSAYIIPDTDAHMSEYIGKPDKRREWISGFTGSAGTAVV
FT                   TMGKAAVWTDSRYWTQAERQMDCNWELHKEVSISSIVAWILAEVPDGQNVGFDPFLFSV
FT                   DSWKNYDQGFQDSSRHLLSVTTNLVDVAWGSERPPVPSQPIYALPKEFTGSTWQEKVSA
FT                   VRSYMEHHAKTPTGVLLSALDETAWLFNLRSSDIPYNPFFYSYALLTNSSIRLFVNKSR
FT                   FSLETLQYLNTNCTLPMCVQLEDYSQVRDSVKAYASGDVKILIGVSYTTYGVYEVIPKE
FT                   KLVTDTYSPVMLIKAVKNSKEQALLKSSHVRDAVAVIQYLVWLEKNVPKGTVDEFSGAE
FT                   YIDELRRNENFSSGPSFETISASGLNAALAHYSPTKELHRKLSSDEMYLVDSGGQYWDG
FT                   TTDITRTVHWGTPTAFQKEAYTRVLMGNIDLSRLVFPAATSGRVIEAFARRALWEVGLN
FT                   YGHGTGHGIGNFLCVHEWPVGFQYNNIAMAKGMFTSIEPGYYHDGEFGIRLEDVALVVE
FT                   AKTKYPGDYLTFELVSFVPYDRNLIDVRLLSPEQLQYLNRYYQTIRENVGPELQRRQLL
FT                   EEFAWLEQHTEPLSARAPHIISWTSLWVASALAILSWSS"
FT   gene            10252677..10267720
FT                   /gene="1200013B08Rik"
FT                   /locus_tag="mCG_5049"
FT                   /note="gene_id=mCG5049.1"
FT   mRNA            join(10252677..10252884,10260684..10260779,
FT                   10261134..10261280,10263577..10263718,10264891..10265039,
FT                   10265198..10265407,10265560..10265710,10266222..10267720)
FT                   /gene="1200013B08Rik"
FT                   /locus_tag="mCG_5049"
FT                   /product="RIKEN cDNA 1200013B08"
FT                   /note="gene_id=mCG5049.1 transcript_id=mCT4316.2 created on
FT                   16-DEC-2002"
FT   CDS             join(10252828..10252884,10260684..10260779,
FT                   10261134..10261280,10263577..10263718,10264891..10265039,
FT                   10265198..10265407,10265560..10265710,10266222..10266412)
FT                   /codon_start=1
FT                   /gene="1200013B08Rik"
FT                   /locus_tag="mCG_5049"
FT                   /product="RIKEN cDNA 1200013B08"
FT                   /note="gene_id=mCG5049.1 transcript_id=mCT4316.2
FT                   protein_id=mCP5260.1"
FT                   /protein_id="EDL29067.1"
FT                   /translation="MLRRKPSNASDKEPTQKKKLSLQRSSSFKDFAKSKPSSPVVSEKE
FT                   FNLDDNIPEDDSGVLTPEDSGKSGKKLGKKWRAVISRTMNRKMGKMMVKALSEEMGDTL
FT                   EEGSASPTSPDCSLDSPGPEKMALAFTEQEEREPPSLSRQTSTGSELCSPGPGSGSFLE
FT                   ESPAPQYTGPFCGRARVHTDFTPSPYDHDSLKLQKGDVIQIVEKPPVGTWLGLLNGKLG
FT                   SFKFIYVDVLPEEAVGPVRPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTL
FT                   EDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSE
FT                   PKVDIPRDSGCFEGSESGRDEAELAGTEEQLQGLSLSGAP"
FT   gene            complement(10278428..10314402)
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /note="gene_id=mCG5054.2"
FT   mRNA            complement(join(10278428..10279584,10283515..10283611,
FT                   10283984..10284087,10286666..10286768,10287518..10287566,
FT                   10288443..10288580,10296743..10296901,10300268..10300428,
FT                   10312386..10312675,10314198..10314402))
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, transcript
FT                   variant mCT4312"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT4312.2 created on
FT                   13-JUN-2003"
FT   CDS             complement(join(10279468..10279584,10283515..10283611,
FT                   10283984..10284087,10286666..10286768,10287518..10287566,
FT                   10288443..10288580,10296743..10296901,10300268..10300428,
FT                   10312386..10312552))
FT                   /codon_start=1
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT4312.2
FT                   protein_id=mCP5265.2 isoform=CRA_d"
FT                   /protein_id="EDL29071.1"
FT                   /translation="MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLI
FT                   LGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAF
FT                   IEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVE
FT                   RFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKET
FT                   PGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVK
FT                   NCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPASTEHMNSNEMAED
FT                   TSIPEEMPPPEPPEPPQEASEAEK"
FT   mRNA            complement(join(10287113..10287566,10288443..10288580,
FT                   10296743..10296901,10300268..10300428,10312386..10312675,
FT                   10314198..10314385))
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, transcript
FT                   variant mCT185585"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT185585.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(10287478..10287566,10288443..10288580,
FT                   10296743..10296901,10300268..10300428,10312386..10312552))
FT                   /codon_start=1
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT185585.0
FT                   protein_id=mCP106844.0 isoform=CRA_c"
FT                   /protein_id="EDL29070.1"
FT                   /translation="MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLI
FT                   LGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAF
FT                   IEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVE
FT                   RFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKET
FT                   PGTYPPLAVRPCEAV"
FT   mRNA            complement(join(10295566..10296901,10300268..10300428,
FT                   10312386..10314321))
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, transcript
FT                   variant mCT185584"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT185584.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(10296735..10296901,10300268..10300428,
FT                   10312386..10312552))
FT                   /codon_start=1
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT185584.0
FT                   protein_id=mCP106842.0 isoform=CRA_a"
FT                   /protein_id="EDL29068.1"
FT                   /translation="MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLI
FT                   LGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAF
FT                   IEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVG
FT                   E"
FT   mRNA            complement(join(10307438..10308043,10312386..10312675,
FT                   10313841..10313953))
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, transcript
FT                   variant mCT185586"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT185586.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(10307983..10308043,10312386..10312552))
FT                   /codon_start=1
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT185586.0
FT                   protein_id=mCP106843.0 isoform=CRA_b"
FT                   /protein_id="EDL29069.1"
FT                   /translation="MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLI
FT                   LGTCTLFFAFESTVPSLSLSEDFKCKMLQM"
FT   gene            10362881..10387828
FT                   /gene="Utp14a"
FT                   /locus_tag="mCG_5053"
FT                   /note="gene_id=mCG5053.1"
FT   mRNA            join(10362881..10362958,10364330..10364405,
FT                   10365712..10365784,10368702..10368785,10368834..10368891,
FT                   10369331..10369486,10378185..10378304,10378407..10378501,
FT                   10379114..10379237,10379323..10379400,10380225..10380612,
FT                   10382597..10382994,10383742..10383935,10384043..10384142,
FT                   10387438..10387828)
FT                   /gene="Utp14a"
FT                   /locus_tag="mCG_5053"
FT                   /product="UTP14, U3 small nucleolar ribonucleoprotein,
FT                   homolog A (yeast)"
FT                   /note="gene_id=mCG5053.1 transcript_id=mCT4311.2 created on
FT                   06-JAN-2003"
FT   CDS             join(10369460..10369486,10378185..10378304,
FT                   10378407..10378501,10379114..10379237,10379323..10379400,
FT                   10380225..10380612,10382597..10382994,10383742..10383935,
FT                   10384043..10384142,10387438..10387707)
FT                   /codon_start=1
FT                   /gene="Utp14a"
FT                   /locus_tag="mCG_5053"
FT                   /product="UTP14, U3 small nucleolar ribonucleoprotein,
FT                   homolog A (yeast)"
FT                   /note="gene_id=mCG5053.1 transcript_id=mCT4311.2
FT                   protein_id=mCP5264.2"
FT                   /protein_id="EDL29072.1"
FT                   /translation="MEHVFREWKARTPLEQEVFNLLHKNKQPVTDPLLTPVEKASLKAM
FT                   SLEEAKIRRAELQRARALQSYYEARARRMKKIKSKKYHKIVKKGKAKKALKDFEQLRKV
FT                   DPDAALEELEKMEKARMMERMSLKHQNSGKWAKSKAIMAKYDLEARQAMQEQLAKNKEL
FT                   TQKLQVVSESEEEGGADEEEALVPDIVNEVQKTADGPNPWMLRSCSRDAKENEIQADSE
FT                   QLPESAAHEFPENEENDKPVAEEDELLKELEKRRSLRKRSELNQAAEPLGNQETKDSTS
FT                   QEVLSELRALSKKLSKENHLSKKQKKSPAKAVDLVWEEEPAPEEDEPLLLQRPERMRTL
FT                   EELEELGKEDSLPNKERPRPSVEGEQVRRNPQNHSKGKNKKEQMISLQNLLTTRTPSVT
FT                   SLALPTTVEELEDEGARDQKQMIKEAFAGDDVIKEFLKEKREAIQANKPKAVDLTLPGW
FT                   GEWGGMNLKPSARKRRRFLIKAPEGPPRKDKNLPNVIISEKRNIHAAAHQVRVLPYPFT
FT                   HHQQFERTIQNPIGSTWNTQRAFQKLTAPKVVTKPGHIIKPITAEDVDCRSSPRSDVPV
FT                   MQSNPKQHSKHQKQRKKSSIG"
FT   gene            complement(10382167..>10389022)
FT                   /locus_tag="mCG_146275"
FT                   /note="gene_id=mCG146275.0"
FT   mRNA            complement(join(10382167..10383565,10383646..10383816,
FT                   10388940..>10389022))
FT                   /locus_tag="mCG_146275"
FT                   /product="mCG146275"
FT                   /note="gene_id=mCG146275.0 transcript_id=mCT186378.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(10382532..>10382882)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146275"
FT                   /product="mCG146275"
FT                   /note="gene_id=mCG146275.0 transcript_id=mCT186378.0
FT                   protein_id=mCP107650.0"
FT                   /protein_id="EDL29073.1"
FT                   /translation="FCGFLLTCSPSTEGLGRSLFGRLSSLPSSSSSSRVRILSGLCSKR
FT                   GSSSSGAGSSSQTRSTAFAGLFFCFLDRWFSLLSFLDNALNSDNTSWLVESEGRGQKKN
FT                   QAARDETWKFLS"
FT   gene            10447490..10511969
FT                   /locus_tag="mCG_5052"
FT                   /note="gene_id=mCG5052.2"
FT   mRNA            join(10447490..10447678,10448230..10448309,
FT                   10467039..10467069,10467096..10467168,10472923..10473013,
FT                   10473273..10473569,10474537..10476537,10480571..10480736,
FT                   10482293..10482373,10489217..10489440,10494405..10494626,
FT                   10497193..10497458,10498476..10498621,10505889..10505966,
FT                   10507087..10507237,10511182..10511969)
FT                   /locus_tag="mCG_5052"
FT                   /product="mCG5052"
FT                   /note="gene_id=mCG5052.2 transcript_id=mCT4310.2 created on
FT                   06-JAN-2003"
FT   CDS             join(10467146..10467168,10472923..10473013,
FT                   10473273..10473569,10474537..10476537,10480571..10480736,
FT                   10482293..10482373,10489217..10489440,10494405..10494626,
FT                   10497193..10497458,10498476..10498621,10505889..10505966,
FT                   10507087..10507237,10511182..10511464)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5052"
FT                   /product="mCG5052"
FT                   /note="gene_id=mCG5052.2 transcript_id=mCT4310.2
FT                   protein_id=mCP5263.2"
FT                   /protein_id="EDL29074.1"
FT                   /translation="MCGINEERRAPLSDEESTTGGCQHFGSQEFCVSSSFSKVELTAVG
FT                   SGSNARGTNPDGNTTEKLGHRSEDQSDDPQPKMDYVGNPAEAEGLLVPLSSPGDGLKLP
FT                   TPDSTEASHSRANCSWTPLSTQMSKQVDCSPAGDRCLPGVLASPDLRSYPCAFSVARPL
FT                   ASDSKLVSLEVNRLSCTSPSSSTNSQPAPDGVPGPLADTSLTTASAKVLPTSQLLLPAP
FT                   SGSSVPPHPSKMPGGTDQQTEGTSVTFSPLKSPPQLEREMASPPECSEMPLDLSAKSNR
FT                   QKLPLPNQRKTPPMPVLTPVHTSSKALLSTVLSRSQRTTQAAGSNVTSCLGSTSSPFVI
FT                   FPEMVRNGDPSTWVKNSTALISTIPGTYVGVANPVPASLLLNKDPNLGLNRDPRHLPKQ
FT                   EPISIIDQGEPKSTSATCGKKGSQAGAEGQPSTVKSRYTPARIAPGLPGCQTKELSLWK
FT                   PTGLTNMYPRCSINGKPTSTQVLPVGWSPYHQASLLSIGISSAGQLTPSQGVPIRPTSI
FT                   VSEFSGVSPLGSSETVHGLPEGQPRPGGPFAPEQDAVTKNKNCRIAAKPYEEQVNPVLL
FT                   TLSPQSGTLALSVQPSSGDMGVNQGSEESESHLCSDSTPKMEGPQAACGLKLAGDTKPK
FT                   NQVLATYMSHELVLANPQNLCKMPELPLLPHDSHSKELILDVVPSSERGPSTDLSQLGS
FT                   QVDLGRVKMEKADGDVVFNLANCFRADGLPAVPQRGQAEARANAGQARVKRESIGVFTC
FT                   KNSWQPDEETESLPPKKVKCNKEKEIEEEPRQQPPPQPHDKPMVRSSLGSKCRKLPGDP
FT                   QEPTKKSPRGALDSGKEHNGVRGKHKHRKPTKPESQPPGKRTDGHEEGSLEKKAKNSFR
FT                   DFIPVVLSTRTRSQSDSKARKQKTSSQSSEHCLRNRNLLLSSKAQGISDSPNGFLPDNL
FT                   EEPACLENPEKPSGKRKCKTKHMANASEEARSKGRWSQQKTRSSKSPTPVKPTEPCTPS
FT                   KYRSAGPEEASESPTARQIPPEARRLIVNKNAGETLLQRAARLGYKDVVLYCLQKHSED
FT                   VNHRDNAGYTALHEACSRGWTDILNILLQHGANVNCSSQDGTRQEGCSSAKSQTSVQSL
FT                   ASELYSDLDICRMSSCWPVHDAVVNDNLETIWLLLSYGADPTLATYSGQTAMKLASSDN
FT                   MKRFLSDHLSDLQGRAEGDPRASWDFYSSSVLEKKDGFACDLLHNPPGSAEQGDDSEQD
FT                   DFMFELSDKPLLPCYNLQVSVSRGPCNWFLFSDVLKRLKLSSRIFQARFPHLEITTLPK
FT                   AEFYRQVASSQLLSPAERPGSLEDRSPPGSSETVELVQYEPELLRLLGSEVEYQSWSS"
FT   gene            complement(10518492..10529701)
FT                   /gene="Elf4"
FT                   /locus_tag="mCG_5050"
FT                   /note="gene_id=mCG5050.1"
FT   mRNA            complement(join(10518492..10519888,10520094..10520653,
FT                   10521859..10522236,10523083..10523275,10523367..10523450,
FT                   10524220..10524411,10526052..10526223,10529423..10529701))
FT                   /gene="Elf4"
FT                   /locus_tag="mCG_5050"
FT                   /product="E74-like factor 4 (ets domain transcription
FT                   factor)"
FT                   /note="gene_id=mCG5050.1 transcript_id=mCT4324.2 created on
FT                   16-DEC-2002"
FT   CDS             complement(join(10519848..10519888,10520094..10520653,
FT                   10521859..10522236,10523083..10523275,10523367..10523450,
FT                   10524220..10524411,10526052..10526223,10529423..10529494))
FT                   /codon_start=1
FT                   /gene="Elf4"
FT                   /locus_tag="mCG_5050"
FT                   /product="E74-like factor 4 (ets domain transcription
FT                   factor)"
FT                   /note="gene_id=mCG5050.1 transcript_id=mCT4324.2
FT                   protein_id=mCP5261.2"
FT                   /protein_id="EDL29075.1"
FT                   /translation="MAIALQPSDLVFEFASNGMDDIHQLEDPSVFPAVIVEQVPYPELV
FT                   HLCSGLDLDEVHNGIIRDRTLCMTQDQILEGSILLTVSSPEVLSDSNSVQAINLPNFLL
FT                   STPEPDDLKKTSDAGDQKEHSEEEKVSREENLRKMGKARKRNRKTKNNRSTSPVTDPSM
FT                   PIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQ
FT                   KNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLVVIDDEEESPETPEDS
FT                   SQASTSSTPSTSTIRRASSRVGTRASPEDKDSPPWEKPKVQHTGLQPSASLELGLSVDE
FT                   EVPTTSTMLASPLQSQARLTKTVSSSPAPSNIHLGVAPVGPGSTVTLQTIPLTTVLTNG
FT                   PPASTTAPTQLVLQSVPQVSTFKDTFTLQTSFPLNTNLQENQVATQGAPLILSGLPQLL
FT                   AGANPQSNPAPSQVIGAGSAGPSSQPPGTVIAAFIRTSSGTSVPVVKEGPLRSSSYVQG
FT                   VVTGAPVEGLLVPEETLRELLRDQGHLQPLPSQAGQNCEAFSCGLK"
FT   gene            10541025..10543083
FT                   /locus_tag="mCG_147984"
FT                   /note="gene_id=mCG147984.0"
FT   mRNA            join(10541025..10541299,10542092..10543083)
FT                   /locus_tag="mCG_147984"
FT                   /product="mCG147984"
FT                   /note="gene_id=mCG147984.0 transcript_id=mCT188247.0
FT                   created on 13-JAN-2004"
FT   CDS             join(10541199..10541299,10542092..10542266)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147984"
FT                   /product="mCG147984"
FT                   /note="gene_id=mCG147984.0 transcript_id=mCT188247.0
FT                   protein_id=mCP109522.0"
FT                   /protein_id="EDL29076.1"
FT                   /translation="MWARFSSALSDSTSSCFPCFWGERPDGKDYRMTGSGPACPASSSL
FT                   HYPASSQTCGDPLRPLLPACWDYRPAPSTCLTDPLYKLQKSSEEIR"
FT   gene            complement(10580558..10618717)
FT                   /gene="Pdcd8"
FT                   /locus_tag="mCG_5046"
FT                   /note="gene_id=mCG5046.1"
FT   mRNA            complement(join(10580558..10580671,10581046..10581242,
FT                   10583185..10583309,10585612..10585754,10587452..10587592,
FT                   10588209..10588297,10588642..10588749,10590014..10590122,
FT                   10590945..10591021,10591633..10591717,10600122..10600212,
FT                   10602463..10602593,10602717..10602841,10605156..10605255,
FT                   10610178..10610320,10618564..10618717))
FT                   /gene="Pdcd8"
FT                   /locus_tag="mCG_5046"
FT                   /product="programmed cell death 8"
FT                   /note="gene_id=mCG5046.1 transcript_id=mCT4320.1 created on
FT                   16-DEC-2002"
FT   CDS             complement(join(10580600..10580671,10581046..10581242,
FT                   10583185..10583309,10585612..10585754,10587452..10587592,
FT                   10588209..10588297,10588642..10588749,10590014..10590122,
FT                   10590945..10591021,10591633..10591717,10600122..10600212,
FT                   10602463..10602593,10602717..10602841,10605156..10605255,
FT                   10610178..10610320,10618564..10618666))
FT                   /codon_start=1
FT                   /gene="Pdcd8"
FT                   /locus_tag="mCG_5046"
FT                   /product="programmed cell death 8"
FT                   /note="gene_id=mCG5046.1 transcript_id=mCT4320.1
FT                   protein_id=mCP5257.2"
FT                   /protein_id="EDL29077.1"
FT                   /translation="MFRCGGLAGAFKQKLVPLVRTVYVQRPKQRNRLPGNLFQQWRVPL
FT                   ELQMARQMASSGSSGGKMDNSVLVLIVGLSTIGAGAYAYKTIKEDQKRYNERVMGLGLS
FT                   PEEKQRRAIASATEGGSVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSE
FT                   DPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENG
FT                   GVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTT
FT                   LFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMG
FT                   KILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGL
FT                   EPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAV
FT                   VSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPK
FT                   SATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIV
FT                   LWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED"
FT   gene            10624805..10635444
FT                   /gene="Rab33a"
FT                   /locus_tag="mCG_124936"
FT                   /note="gene_id=mCG124936.0"
FT   mRNA            join(10624805..10625193,10634861..10635444)
FT                   /gene="Rab33a"
FT                   /locus_tag="mCG_124936"
FT                   /product="RAB33A, member of RAS oncogene family"
FT                   /note="gene_id=mCG124936.0 transcript_id=mCT126188.0
FT                   created on 16-DEC-2002"
FT   CDS             join(10624936..10625193,10634861..10635316)
FT                   /codon_start=1
FT                   /gene="Rab33a"
FT                   /locus_tag="mCG_124936"
FT                   /product="RAB33A, member of RAS oncogene family"
FT                   /note="gene_id=mCG124936.0 transcript_id=mCT126188.0
FT                   protein_id=mCP87695.1"
FT                   /db_xref="GOA:Q3SXA7"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:109493"
FT                   /db_xref="UniProtKB/TrEMBL:Q3SXA7"
FT                   /protein_id="EDL29078.1"
FT                   /translation="MAQPILGHGSLQPASAAGLASLELDSSMDQYVQIRIFKIIVIGDS
FT                   NVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVE
FT                   HYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPS
FT                   NLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQK
FT                   LEFSQEANGKASCPC"
FT   gene            complement(10646946..10698308)
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /note="gene_id=mCG124943.1"
FT   mRNA            complement(join(10646946..10648608,10648724..10648760,
FT                   10648904..10649022,10652563..10652625,10653834..10653971,
FT                   10655328..10655635,10659225..10659356,10663487..10663633,
FT                   10664261..10664361,10664885..10665042,10669495..10669715,
FT                   10672929..10673038,10673170..10673334,10675171..10675276,
FT                   10678456..10678589,10678920..10678985,10684555..10684704,
FT                   10694871..10694917,10697843..>10697935))
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /product="suppressor of hairy wing homolog 3 (Drosophila),
FT                   transcript variant mCT192578"
FT                   /note="gene_id=mCG124943.1 transcript_id=mCT192578.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(10646946..10648608,10648724..10648760,
FT                   10652563..10652625,10653834..10653971,10655328..10655635,
FT                   10659225..10659356,10663487..10663633,10664261..10664361,
FT                   10664885..10665042,10669495..10669715,10672929..10673038,
FT                   10673170..10673334,10675171..10675276,10678456..10678589,
FT                   10678920..10678985,10684555..10684731,10694871..10694917,
FT                   10697843..>10697935))
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /product="suppressor of hairy wing homolog 3 (Drosophila),
FT                   transcript variant mCT192577"
FT                   /note="gene_id=mCG124943.1 transcript_id=mCT192577.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(10647934..10648608,10648724..10648760,
FT                   10648904..10649022,10652563..10652625,10653834..10653971,
FT                   10655328..10655635,10659225..10659356,10663487..10663633,
FT                   10664261..10664361,10664885..10665042,10669495..10669715,
FT                   10672929..10673038,10673170..10673334,10675171..10675276,
FT                   10678456..10678589,10678920..10678985,10684555..10684731,
FT                   10694871..10694917,10697843..10698308))
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /product="suppressor of hairy wing homolog 3 (Drosophila),
FT                   transcript variant mCT126195"
FT                   /note="gene_id=mCG124943.1 transcript_id=mCT126195.1
FT                   created on 06-JAN-2003"
FT   CDS             complement(join(10648593..10648608,10648724..10648760,
FT                   10648904..10649022,10652563..10652625,10653834..10653971,
FT                   10655328..10655635,10659225..10659356,10663487..10663633,
FT                   10664261..10664361,10664885..10665042,10669495..10669715,
FT                   10672929..10673038,10673170..10673334,10675171..10675276,
FT                   10678456..10678589,10678920..10678985,10684555..10684704,
FT                   10694871..10694917,10697843..>10697865))
FT                   /codon_start=1
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /product="suppressor of hairy wing homolog 3 (Drosophila),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG124943.1 transcript_id=mCT192578.0
FT                   protein_id=mCP113534.0 isoform=CRA_c"
FT                   /protein_id="EDL29081.1"
FT                   /translation="AQSQGPICWFFNLMDKDNSVQEKDNSKMAELFMECEEEELEPWQQ
FT                   KVEESQSKDDDDELIFVGEISSSKPAISNILNRCSPGSSSKGLKNGSFNPAISNIFKPT
FT                   SQHYRNPSSNALVALPSFHPALKSSESSDGQTVSKLDFTKTSPQEDSGACSVSQSDSTQ
FT                   DIPSSNILQPRTGVDQTLGLKHPSTSKVNSVNPKKPKTSASISETRPCSSSSSQTAPSG
FT                   ASSQTVLSNVNTSSVQSAPGSSSLRSCPKCNVKFRLLDPLKCHMKRCCPDMINKFLETL
FT                   KSENSKAVSKATTDSDKEKLIMLVSDFYYGRHEGTIEESQKTHTTFKCFSCTKVLKNNI
FT                   RFMNHMKHHLELEKQNNETWESHTTCQHCYRQYPNPFQLQCHIESTHTPHDFSTICKIC
FT                   ELSFETEHMLLQHMKDTHKPGEMPYICQVCQFRSSIFSDVETHFRSSHENTKNLLCPFC
FT                   LKVSRMATPYMNHYMRHQKKGIYRCPKCRLQFLTSKEKTEHKLEHRTFIKPKELEGLPP
FT                   GTKVIIRASLGSSQSRASSPPSSTIPSTSLQLSVPKSKSTTTKNNSKVSANKATTTSPQ
FT                   TVATTTGKPSASKPGTGTTKSKAKPSYKQKRQRTRKNKFSIDLKNLRCHQGSHMCIECR
FT                   SKIKDFSSHFSTHINCDFCKYTTNCNKAFTNHMSSHNDHPSKQLYIFKKQSRARRGITL
FT                   VCLKCDFLADTSGLDRMAKHLNQRKTHTCQVVIENVTERAVTSESASDGLFK"
FT   CDS             complement(join(10648593..10648608,10648724..10648760,
FT                   10648904..10649022,10652563..10652625,10653834..10653971,
FT                   10655328..10655635,10659225..10659356,10663487..10663633,
FT                   10664261..10664361,10664885..10665042,10669495..10669715,
FT                   10672929..10673038,10673170..10673334,10675171..10675276,
FT                   10678456..10678589,10678920..10678985,10684555..10684731,
FT                   10694871..10694901))
FT                   /codon_start=1
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /product="suppressor of hairy wing homolog 3 (Drosophila),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG124943.1 transcript_id=mCT126195.1
FT                   protein_id=mCP87715.1 isoform=CRA_a"
FT                   /protein_id="EDL29079.1"
FT                   /translation="MDKDNSVQEKGLFLSSWKLDNSKMAELFMECEEEELEPWQQKVEE
FT                   SQSKDDDDELIFVGEISSSKPAISNILNRCSPGSSSKGLKNGSFNPAISNIFKPTSQHY
FT                   RNPSSNALVALPSFHPALKSSESSDGQTVSKLDFTKTSPQEDSGACSVSQSDSTQDIPS
FT                   SNILQPRTGVDQTLGLKHPSTSKVNSVNPKKPKTSASISETRPCSSSSSQTAPSGASSQ
FT                   TVLSNVNTSSVQSAPGSSSLRSCPKCNVKFRLLDPLKCHMKRCCPDMINKFLETLKSEN
FT                   SKAVSKATTDSDKEKLIMLVSDFYYGRHEGTIEESQKTHTTFKCFSCTKVLKNNIRFMN
FT                   HMKHHLELEKQNNETWESHTTCQHCYRQYPNPFQLQCHIESTHTPHDFSTICKICELSF
FT                   ETEHMLLQHMKDTHKPGEMPYICQVCQFRSSIFSDVETHFRSSHENTKNLLCPFCLKVS
FT                   RMATPYMNHYMRHQKKGIYRCPKCRLQFLTSKEKTEHKLEHRTFIKPKELEGLPPGTKV
FT                   IIRASLGSSQSRASSPPSSTIPSTSLQLSVPKSKSTTTKNNSKVSANKATTTSPQTVAT
FT                   TTGKPSASKPGTGTTKSKAKPSYKQKRQRTRKNKFSIDLKNLRCHQGSHMCIECRSKIK
FT                   DFSSHFSTHINCDFCKYTTNCNKAFTNHMSSHNDHPSKQLYIFKKQSRARRGITLVCLK
FT                   CDFLADTSGLDRMAKHLNQRKTHTCQVVIENVTERAVTSESASDGLFK"
FT   CDS             complement(join(10648736..10648760,10652563..10652625,
FT                   10653834..10653971,10655328..10655635,10659225..10659356,
FT                   10663487..10663633,10664261..10664361,10664885..10665042,
FT                   10669495..10669715,10672929..10673038,10673170..10673334,
FT                   10675171..10675276,10678456..10678589,10678920..10678985,
FT                   10684555..10684731,10694871..10694917,10697843..>10697865))
FT                   /codon_start=1
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /product="suppressor of hairy wing homolog 3 (Drosophila),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG124943.1 transcript_id=mCT192577.0
FT                   protein_id=mCP113533.0 isoform=CRA_b"
FT                   /protein_id="EDL29080.1"
FT                   /translation="AQSQGPICWFFNLMDKDNSVQEKGLFLSSWKLDNSKMAELFMECE
FT                   EEELEPWQQKVEESQSKDDDDELIFVGEISSSKPAISNILNRCSPGSSSKGLKNGSFNP
FT                   AISNIFKPTSQHYRNPSSNALVALPSFHPALKSSESSDGQTVSKLDFTKTSPQEDSGAC
FT                   SVSQSDSTQDIPSSNILQPRTGVDQTLGLKHPSTSKVNSVNPKKPKTSASISETRPCSS
FT                   SSSQTAPSGASSQTVLSNVNTSSVQSAPGSSSLRSCPKCNVKFRLLDPLKCHMKRCCPD
FT                   MINKFLETLKSENSKAVSKATTDSDKEKLIMLVSDFYYGRHEGTIEESQKTHTTFKCFS
FT                   CTKVLKNNIRFMNHMKHHLELEKQNNETWESHTTCQHCYRQYPNPFQLQCHIESTHTPH
FT                   DFSTICKICELSFETEHMLLQHMKDTHKPGEMPYICQVCQFRSSIFSDVETHFRSSHEN
FT                   TKNLLCPFCLKVSRMATPYMNHYMRHQKKGIYRCPKCRLQFLTSKEKTEHKLEHRTFIK
FT                   PKELEGLPPGTKVIIRASLGSSQSRASSPPSSTIPSTSLQLSVPKSKSTTTKNNSKVSA
FT                   NKATTTSPQTVATTTGKPSASKPGTGTTKSKAKPSYKQKRQRTRKNKFSIDLKNLRCHQ
FT                   GSHMCIECRSKIKDFSSHFSTHINCDFCKYTTNCNKAFTNHMSSHNDHPSKQLYIFKKQ
FT                   SRARSYRKSRNF"
FT   gene            <10731357..10769853
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /note="gene_id=mCG10759.1"
FT   mRNA            join(<10731357..10731607,10731741..10731985,
FT                   10733378..10733422,10735918..10735965,10737035..10737128,
FT                   10738455..10738602,10742256..10742350,10745042..10745127,
FT                   10747763..10747858,10759442..10759566,10760876..10761011,
FT                   10768250..10768330,10769444..10769853)
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   brain), member 14, transcript variant mCT192573"
FT                   /note="gene_id=mCG10759.1 transcript_id=mCT192573.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<10731357..10731607,10731741..10731976,
FT                   10733378..10733422,10735918..10735965,10737035..10737128,
FT                   10738455..10738602,10742256..10742350,10745042..10745127,
FT                   10747763..10747858,10759442..10759566,10760876..10761011,
FT                   10768250..10768330,10769444..10769853)
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   brain), member 14, transcript variant mCT192574"
FT                   /note="gene_id=mCG10759.1 transcript_id=mCT192574.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(10731357..10731607,10731741..10731976,
FT                   10737035..10737128,10738455..10738602,10742256..10742350,
FT                   10745042..10745127,10747763..10747858,10759442..10759566,
FT                   10760876..10761011,10768250..10768330,10769444..10769853)
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   brain), member 14, transcript variant mCT10594"
FT                   /note="gene_id=mCG10759.1 transcript_id=mCT10594.1 created
FT                   on 16-DEC-2002"
FT   CDS             join(10731911..10731976,10737035..10737128,
FT                   10738455..10738602,10742256..10742350,10745042..10745127,
FT                   10747763..10747858,10759442..10759566,10760876..10761011,
FT                   10768250..10768330,10769444..10769485)
FT                   /codon_start=1
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   brain), member 14, isoform CRA_a"
FT                   /note="gene_id=mCG10759.1 transcript_id=mCT10594.1
FT                   protein_id=mCP19898.1 isoform=CRA_a"
FT                   /protein_id="EDL29082.1"
FT                   /translation="MGIFPGIILIFLRVKFATAAVIHQKSSTLSHEMSGLNWKPFVYGG
FT                   LASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGI
FT                   APALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLK
FT                   IRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHL
FT                   IVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTLDGIL
FT                   KMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI"
FT   CDS             join(<10735942..10735965,10737035..10737128,
FT                   10738455..10738602,10742256..10742350,10745042..10745127,
FT                   10747763..10747858,10759442..10759566,10760876..10761011,
FT                   10768250..10768330,10769444..10769485)
FT                   /codon_start=1
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   brain), member 14, isoform CRA_b"
FT                   /note="gene_id=mCG10759.1 transcript_id=mCT192573.0
FT                   protein_id=mCP113526.0 isoform=CRA_b"
FT                   /protein_id="EDL29083.1"
FT                   /translation="ITFPEPRLHQKSSTLSHEMSGLNWKPFVYGGLASIVAEFGTFPVD
FT                   LTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIK
FT                   IGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSM
FT                   IGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHF
FT                   VSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTLDGILKMWKHEGFFALYKG
FT                   FWPNWLRLGPWNIIFFITYEQLKRLQI"
FT   CDS             join(<10735942..10735965,10737035..10737128,
FT                   10738455..10738602,10742256..10742350,10745042..10745127,
FT                   10747763..10747858,10759442..10759566,10760876..10761011,
FT                   10768250..10768330,10769444..10769485)
FT                   /codon_start=1
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   brain), member 14, isoform CRA_b"
FT                   /note="gene_id=mCG10759.1 transcript_id=mCT192574.0
FT                   protein_id=mCP113527.0 isoform=CRA_b"
FT                   /protein_id="EDL29084.1"
FT                   /translation="ITFPEPRLHQKSSTLSHEMSGLNWKPFVYGGLASIVAEFGTFPVD
FT                   LTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIK
FT                   IGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSM
FT                   IGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHF
FT                   VSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTLDGILKMWKHEGFFALYKG
FT                   FWPNWLRLGPWNIIFFITYEQLKRLQI"
FT   gene            10802520..10814966
FT                   /gene="Rbmx2"
FT                   /locus_tag="mCG_124947"
FT                   /note="gene_id=mCG124947.0"
FT   mRNA            join(10802520..10802638,10802838..10802862,
FT                   10804740..10804792,10810555..10810684,10813134..10813317,
FT                   10813820..10814966)
FT                   /gene="Rbmx2"
FT                   /locus_tag="mCG_124947"
FT                   /product="RNA binding motif protein, X-linked 2, transcript
FT                   variant mCT126199"
FT                   /note="gene_id=mCG124947.0 transcript_id=mCT126199.1
FT                   created on 06-JAN-2003"
FT   mRNA            join(<10802521..10802638,10810555..10810684,
FT                   10813134..10813317,10813820..10814963)
FT                   /gene="Rbmx2"
FT                   /locus_tag="mCG_124947"
FT                   /product="RNA binding motif protein, X-linked 2, transcript
FT                   variant mCT192582"
FT                   /note="gene_id=mCG124947.0 transcript_id=mCT192582.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<10802610..10802638,10810555..10810684,
FT                   10813134..10813317,10813820..10814313)
FT                   /codon_start=1
FT                   /gene="Rbmx2"
FT                   /locus_tag="mCG_124947"
FT                   /product="RNA binding motif protein, X-linked 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG124947.0 transcript_id=mCT192582.0
FT                   protein_id=mCP113535.0 isoform=CRA_b"
FT                   /protein_id="EDL29086.1"
FT                   /translation="SEPREDANMKYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTVLA
FT                   VDNFNGIKIKGRTIRVDHVSNYRAPQESEDVDDVTRELQEKGCGVKTPPSSPPEVSEDE
FT                   DAKLTKKHKKDKKEKKKRKKEKTEGQAQAEQPSCSRSATVKEKKDERASRKHSSKTSER
FT                   AQKSEHRESKKSHSGSPDGRSSYHARAEDPECKARKEKPKHEHKSASRREAEEKSRERE
FT                   RGRSSGTHSGRHRGHSDGRSHRSRSRSRSPDKSHRHKKYRHSRERDSYHGSDRRHH"
FT   CDS             join(10802634..10802638,10802838..10802862,
FT                   10804740..10804792,10810555..10810684,10813134..10813317,
FT                   10813820..10814313)
FT                   /codon_start=1
FT                   /gene="Rbmx2"
FT                   /locus_tag="mCG_124947"
FT                   /product="RNA binding motif protein, X-linked 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG124947.0 transcript_id=mCT126199.1
FT                   protein_id=mCP87587.1 isoform=CRA_a"
FT                   /protein_id="EDL29085.1"
FT                   /translation="MNPLTKVKLIGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGK
FT                   SKGFCFLCYEDQRSTVLAVDNFNGIKIKGRTIRVDHVSNYRAPQESEDVDDVTRELQEK
FT                   GCGVKTPPSSPPEVSEDEDAKLTKKHKKDKKEKKKRKKEKTEGQAQAEQPSCSRSATVK
FT                   EKKDERASRKHSSKTSERAQKSEHRESKKSHSGSPDGRSSYHARAEDPECKARKEKPKH
FT                   EHKSASRREAEEKSRERERGRSSGTHSGRHRGHSDGRSHRSRSRSRSPDKSHRHKKYRH
FT                   SRERDSYHGSDRRHH"
FT   gene            complement(11105112..>11384211)
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /note="gene_id=mCG115315.2"
FT   mRNA            complement(join(11105112..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117819..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175447,11264104..11264247,
FT                   11382813..11382872,11384125..>11384211))
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, transcript
FT                   variant mCT192585"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT192585.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(11105607..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117852..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175447,11264104..11264247,
FT                   11382824..11382872,11384069..>11384211))
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, transcript
FT                   variant mCT192586"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT192586.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(11106039..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117819..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175447,11382824..11382872,
FT                   11384069..11384184))
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, transcript
FT                   variant mCT177646"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT177646.0
FT                   created on 16-DEC-2002"
FT   mRNA            complement(join(11106039..11106224,11108087..11108172,
FT                   11113558..11113669,11117819..11117926,11119892..11120073,
FT                   11135155..11135269,11146529..11146635,11148506..11148718,
FT                   11151132..11151365,11156949..11157155,11164346..11164501,
FT                   11175313..11175447,11264104..11264247,11382824..11382872,
FT                   11384069..11384184))
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, transcript
FT                   variant mCT177647"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT177647.0
FT                   created on 16-DEC-2002"
FT   mRNA            complement(join(11106039..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117819..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175447,11264104..11264247,
FT                   11382824..11382872,11384069..11384184))
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, transcript
FT                   variant mCT116417"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT116417.1
FT                   created on 16-DEC-2002"
FT   CDS             complement(join(11106093..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117819..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175447,11264104..11264247,
FT                   11382813..11382872,11384125..>11384155))
FT                   /codon_start=1
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT192585.0
FT                   protein_id=mCP113531.0 isoform=CRA_c"
FT                   /protein_id="EDL29090.1"
FT                   /translation="GHSGSRNFRAGEPDLRSILGEHKEVWWYVPGLNQLPFDPANNNEP
FT                   LQFGSASGPLVPEGLIENGGESSKKRKRTNPPSADNTRTLNVDSAAMTLPVSDPAAWAT
FT                   AMNNLGMAPLGIAGQPILPDFDPALGMMTGIPPITPMMPGLGIVPPPIPPDMPVAKEII
FT                   HCKSCTLFPPNPNLPPPATRERPPGCKTVFVGGLPENGTEQIIVEVFEQCGEIIAIRKS
FT                   KKNFCHIRFAEEYMVDKALYLSGYRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQR
FT                   MLAREERHRRRMEEERMRPPSPPPVVHYSDHECSIVAEKLKDDSKFSEAVQTLLTWIER
FT                   GEVNRRSANHFYSMIQSANSHVRRLVNEKATHEKEMEEAKEKFKQALSGILIQFEQIVA
FT                   VYHSASKQKAWDHFTKAQRKNISVWCKQAEEIRNIHNDELMGIRREEEMEMSDDEIEET
FT                   TETKETEESALVSQAEALKEENDSLRWQLDAYRNEVELLKQEQGKAHREDDPNKEQQLK
FT                   LLQQALQGMQQHLLKVQEEYKKKEAELDRIKDDNLQVEQLLENFHEKQENCGSRLCASS
FT                   QEGEQPLEKTAVSNPVKSEREALLVGIISTFLHVHPFGASIEYICSYLNRLDNKASYQI
FT                   PSKLTTSPLLPISTSDVESLMSRLQHTFRQEMTGVGASLEKRWKFCGFEGLKLT"
FT   CDS             complement(join(11106093..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117852..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175447,11264104..11264247,
FT                   11382824..>11382857))
FT                   /codon_start=1
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT192586.0
FT                   protein_id=mCP113532.0 isoform=CRA_d"
FT                   /protein_id="EDL29091.1"
FT                   /translation="DQFLENTKKCGGLNQLPFDPANNNEPLQFGSASGPLVPEGLIENG
FT                   GESSKKRKRTNPPSADNTRTLNVDSAAMTLPVSDPAAWATAMNNLGMAPLGIAGQPILP
FT                   DFDPALGMMTGIPPITPMMPGLGIVPPPIPPDMPVAKEIIHCKSCTLFPPNPNLPPPAT
FT                   RERPPGCKTVFVGGLPENGTEQIIVEVFEQCGEIIAIRKSKKNFCHIRFAEEYMVDKAL
FT                   YLSGYRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEEERMRP
FT                   PSPPPVVHYSDHECSIVAEKLKDDSKFSEAVQTLLTWIERGEVNRRSANHFYSMIQSAN
FT                   SHVRRLVNEKATHEKEMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDHFTKAQR
FT                   KNISVWCKQAEEIRNIHNDELMGIRREEEMEMSDDEIEETTETKETEESALVSQAEALK
FT                   EENDSLRWQLDAYRNEVELLKQEQGKAHREDDPNKEQQLKLLQQALQGMQQHLLKVQEE
FT                   YKKKEAELDRIKDDNLQQENCGSRLCASSQEGEQPLEKTAVSNPVKSEREALLVGIIST
FT                   FLHVHPFGASIEYICSYLNRLDNKASYQIPSKLTTSPLLPISTSDVESLMSRLQHTFRQ
FT                   EMTGVGASLEKRWKFCGFEGLKLT"
FT   CDS             complement(join(11106093..11106224,11108087..11108172,
FT                   11113558..11113669,11117819..11117926,11119892..11120073,
FT                   11135155..11135269,11146529..11146635,11148506..11148718,
FT                   11151132..11151365,11156949..11157155,11164346..11164501,
FT                   11175313..11175409))
FT                   /codon_start=1
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT177647.0
FT                   protein_id=mCP100568.0 isoform=CRA_b"
FT                   /protein_id="EDL29089.1"
FT                   /translation="MTLPVSDPAAWATAMNNLGMAPLGIAGQPILPDFDPALGMMTGIP
FT                   PITPMMPGLGIVPPPIPPDMPVAKEIIHCKSCTLFPPNPNLPPPATRERPPGCKTVFVG
FT                   GLPENGTEQIIVEVFEQCGEIIAIRKSKKNFCHIRFAEEYMVDKALYLSGYRIRLGSST
FT                   DKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEEERMRPPSPPPVVHYSDHE
FT                   CSIVAEKLKDDSKFSEAVQTLLTWIERGEVNRRSANHFYSMIQSANSHVRRLVNEKATH
FT                   EKEMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDHFTKAQRKNISVWCKQAEEI
FT                   RNIHNDELMGIRREEEMEMSDDEIEETTETKETEESALVSQAEALKEENDSLRWQLDAY
FT                   RNEVELLKQEQGKAHREDDPNKEQQLKLLQQALQGMQQHLLKVQEEYKKKEAELDRIKD
FT                   DNLQVEQLLENFHEKQENCGSRLCASSQEGEQPLEKTAVSNPVKSEREALLVGIISTFL
FT                   HVHPFGASIEYICSYLNRLDNKISTSDVESLMSRLQHTFRQEMTGVGASLEKRWKFCGF
FT                   EGLKLT"
FT   CDS             complement(join(11106093..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117819..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175409))
FT                   /codon_start=1
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT116417.1
FT                   protein_id=mCP87588.1 isoform=CRA_a"
FT                   /protein_id="EDL29087.1"
FT                   /translation="MTLPVSDPAAWATAMNNLGMAPLGIAGQPILPDFDPALGMMTGIP
FT                   PITPMMPGLGIVPPPIPPDMPVAKEIIHCKSCTLFPPNPNLPPPATRERPPGCKTVFVG
FT                   GLPENGTEQIIVEVFEQCGEIIAIRKSKKNFCHIRFAEEYMVDKALYLSGYRIRLGSST
FT                   DKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEEERMRPPSPPPVVHYSDHE
FT                   CSIVAEKLKDDSKFSEAVQTLLTWIERGEVNRRSANHFYSMIQSANSHVRRLVNEKATH
FT                   EKEMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDHFTKAQRKNISVWCKQAEEI
FT                   RNIHNDELMGIRREEEMEMSDDEIEETTETKETEESALVSQAEALKEENDSLRWQLDAY
FT                   RNEVELLKQEQGKAHREDDPNKEQQLKLLQQALQGMQQHLLKVQEEYKKKEAELDRIKD
FT                   DNLQVEQLLENFHEKQENCGSRLCASSQEGEQPLEKTAVSNPVKSEREALLVGIISTFL
FT                   HVHPFGASIEYICSYLNRLDNKASYQIPSKLTTSPLLPISTSDVESLMSRLQHTFRQEM
FT                   TGVGASLEKRWKFCGFEGLKLT"
FT   CDS             complement(join(11106093..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117819..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175409))
FT                   /codon_start=1
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT177646.0
FT                   protein_id=mCP100569.0 isoform=CRA_a"
FT                   /protein_id="EDL29088.1"
FT                   /translation="MTLPVSDPAAWATAMNNLGMAPLGIAGQPILPDFDPALGMMTGIP
FT                   PITPMMPGLGIVPPPIPPDMPVAKEIIHCKSCTLFPPNPNLPPPATRERPPGCKTVFVG
FT                   GLPENGTEQIIVEVFEQCGEIIAIRKSKKNFCHIRFAEEYMVDKALYLSGYRIRLGSST
FT                   DKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEEERMRPPSPPPVVHYSDHE
FT                   CSIVAEKLKDDSKFSEAVQTLLTWIERGEVNRRSANHFYSMIQSANSHVRRLVNEKATH
FT                   EKEMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDHFTKAQRKNISVWCKQAEEI
FT                   RNIHNDELMGIRREEEMEMSDDEIEETTETKETEESALVSQAEALKEENDSLRWQLDAY
FT                   RNEVELLKQEQGKAHREDDPNKEQQLKLLQQALQGMQQHLLKVQEEYKKKEAELDRIKD
FT                   DNLQVEQLLENFHEKQENCGSRLCASSQEGEQPLEKTAVSNPVKSEREALLVGIISTFL
FT                   HVHPFGASIEYICSYLNRLDNKASYQIPSKLTTSPLLPISTSDVESLMSRLQHTFRQEM
FT                   TGVGASLEKRWKFCGFEGLKLT"
FT   gene            complement(11420644..>11516421)
FT                   /locus_tag="mCG_1041086"
FT                   /note="gene_id=mCG1041086.1"
FT   mRNA            complement(join(11420644..11421462,11429313..11429448,
FT                   11436712..11436850,11516262..>11516421))
FT                   /locus_tag="mCG_1041086"
FT                   /product="mCG1041086"
FT                   /note="gene_id=mCG1041086.1 transcript_id=mCT158790.1
FT                   created on 29-JAN-2003"
FT   CDS             complement(11420724..>11420942)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041086"
FT                   /product="mCG1041086"
FT                   /note="gene_id=mCG1041086.1 transcript_id=mCT158790.1
FT                   protein_id=mCP87644.0"
FT                   /protein_id="EDL29092.1"
FT                   /translation="TTNQRVHMEGPSGSSCICSRGLPSRSSMGGKALGPVKVLCLSIGE
FT                   CRGQEAGVGGLGNRGRGEMVGDFWRGN"
FT   gene            11539097..>11567696
FT                   /locus_tag="mCG_115314"
FT                   /note="gene_id=mCG115314.1"
FT   mRNA            join(11539097..11539201,11562123..11562281,
FT                   11563569..11563634,11564173..11564408,11564603..11564795,
FT                   11565036..11565091,11565379..11565529,11566023..11566181,
FT                   11566321..11566490,11566676..11566773,11566896..11567002,
FT                   11567305..>11567696)
FT                   /locus_tag="mCG_115314"
FT                   /product="mCG115314"
FT                   /note="gene_id=mCG115314.1 transcript_id=mCT116416.1
FT                   created on 07-JAN-2003"
FT   CDS             join(11539144..11539201,11562123..11562281,
FT                   11563569..11563634,11564173..11564408,11564603..11564795,
FT                   11565036..11565091,11565379..11565529,11566023..11566181,
FT                   11566321..11566490,11566676..11566773,11566896..11567002,
FT                   11567305..11567696)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115314"
FT                   /product="mCG115314"
FT                   /note="gene_id=mCG115314.1 transcript_id=mCT116416.1
FT                   protein_id=mCP87585.1"
FT                   /protein_id="EDL29093.1"
FT                   /translation="MAWMLDCLFASAFEPRPRRVSVLGGAPGQNSDRSMDMVSIHSLSE
FT                   LERLKLQETAYHELVARHFLSEFKPDRALPTDRPNTLEKWFLMLRGQDRAASLKTFGIR
FT                   LEEVLVNELTRRKQRELTPTMQVEDINGSTGRRRRGNVVQRMLGRMRRFFSRRRNEPTL
FT                   PREFTRRGRRGAVSADSADELENGALLLQILQLSQLSSPIGQRLLGSKRKMSLNPIAQQ
FT                   IPQIVETCCKFIEKHGLSSVGIFTIEYSLRRVLELRELFDKGLDIVLDDSVNVHDVAEL
FT                   LKEFFREMKDPLLPDDLYMSFLLTATLKPKDQVSALQLLVYLMPPCHSDTLERLLKALH
FT                   KITENCEDSIGIDGQLVKNCNRMTSTNLALVFGTALLKKGKLANKESRKTKLGIDHYVA
FT                   SVNVVRAMIDNWDILFQVPPHIQKEVAKRVWKSSPEALDFIRRRNLRKIQSARIKMEED
FT                   ALLSDPVENSAEAQAAILAQSQPFDEDDLPPLEDILELDEIPELMETPNFEELPYFHVI
FT                   SDPEGAPDVHEVLNDNLNYDFEDESDFEDQDHLDLAEVPYLDVIPNNEDTDSDADEIPG
FT                   NDEAPVIYGMPDNVNAPNNDEPQDSEVVPNLEEIPAAD"
FT   gene            complement(11822905..11838112)
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /note="gene_id=mCG8123.4"
FT   mRNA            complement(join(11822905..11823318,11823466..11823589,
FT                   11823978..11824256,11824388..11824675,11824872..11825159,
FT                   11825338..11825625,11826354..11826641,11827225..11827503,
FT                   11827724..11828014,11828399..11828431,11828514..11828584,
FT                   11830456..11830576,11830889..11831140,11831661..11831954,
FT                   11832189..11832473,11834278..11834565,11834866..11835147,
FT                   11835497..11835523,11835653..11835781,11838012..11838112))
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /product="immunoglobulin superfamily, member 1, transcript
FT                   variant mCT192581"
FT                   /note="gene_id=mCG8123.4 transcript_id=mCT192581.1 created
FT                   on 22-APR-2004"
FT   CDS             complement(join(11823183..11823318,11823466..11823589,
FT                   11823978..11824256,11824388..11824675,11824872..11825159,
FT                   11825338..11825625,11826354..11826641,11827225..11827503,
FT                   11827724..11828014,11828399..11828431,11828514..11828584,
FT                   11830456..11830576,11830889..11831140,11831661..11831954,
FT                   11832189..11832473,11834278..11834565,11834866..11835147,
FT                   11835497..11835523,11835653..11835692))
FT                   /codon_start=1
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /product="immunoglobulin superfamily, member 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG8123.4 transcript_id=mCT192581.1
FT                   protein_id=mCP113545.1 isoform=CRA_a"
FT                   /protein_id="EDL29094.1"
FT                   /translation="MMLRTFTLLLLCIWLNPGMTSLAVESQPELWIESNYPQAPWENIT
FT                   LWCKSPSRVSSKFLLLKDNSQMTWIRPPYKTFQVSFFIGALTESNTGLYRCCYWKEKGW
FT                   SKPSKILELEAPGQLPKPIFWIQAETPPLPGCNVNIFCHGWLQDLVFMLFKEGYTEPVD
FT                   YQVPTGTMAIFSIDNLAPENEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTA
FT                   HPGPILAPGESLSLRCQGPIYGMTFALMRLEDLKKSFYHKKPIKNEAYFYFQDLKIQDT
FT                   GHYLCFYYDGSYRGSLLSDILKIWVTDTFPKTWLLVQPSPVIQMGQNVSLRCGGLMDGV
FT                   GLALYKKGEEKPLQFLDASSNTGNNSFFLKNVTYRDAGIYSCHYYLTWKTSIKMATYNT
FT                   VELMVVAWPSSVFKVGKTITLQCRVSHPVLEFSLEWEERTTFQKFSVDGDFLITDIEGQ
FT                   GTGTYSCSYRIEAHPNTWSHRSKPLKLVGPAGFLTWNSILNEAVRVSLTMQLASLLLLV
FT                   VWIRWKCRRLRLREAWLLGTAQGVAMLFILMALLCCGLCNGALTEEIEIVMPTPKPELW
FT                   AETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTHSH
FT                   TGSYHCHSWEEMAVSEPSEALELVGTDILPKPVISASLPIRGQELQIRCKGWLEGLGFA
FT                   LYKKGEQEPVQQLGAVGREAFFTIQRMEDKDEGNYSCRTHTEMQPFKWSEPSEPLELVI
FT                   KEMYPKPFFKTWASPVVTPGSRVTFNCSTSHEHMSFILYKDGNEIASSDLAWGNPGGST
FT                   AHFLIISVGIGDGGNYSCRYYDFSIWSEPSNPVELVVTEFYPKPTLLAQPGPVVLPGKN
FT                   VTLRCQGIFQGMRFALLQEGTHTPLQFQSTSGTSADFLLHTVGAQDFGNYSCVYYETTM
FT                   SNRGSSLSTPLMIWVTDTFPRPWLSAEPSSVVTMGQNVTLWCQGPVRGVGYILHKEGEA
FT                   TSMQLWGSTSNEGAFPIINISGASIGRYSCCYHPDWMSPIKIQPSNTLELIVTGLLPKP
FT                   SLLVQPGPMVAPGENVTLQCQGELPDSTFVLLKEGTRQPLEQQRPSGYRADFWMPVVRD
FT                   QDSGVYSCVYYLDSAPLVASNHSNSLEIWVTDKPPKPSLSAWPSTIFKLGKDITLQCRG
FT                   PLPGVEFVLEHDGEEAPQQFSEDGDFVIDNLEGKGIGNYSCSYRLQAYPDIWSEPSDTL
FT                   ELVGAAGPVAQECTVGNIVRSTLIVVVVVALGIVLAVEWKKWPRLRTRGSETDGRDQTV
FT                   VLEECNQEGEPGTTTNSPSSASQEVSVELTVPI"
FT   mRNA            complement(join(11826715..11826918,11827225..11827503,
FT                   11827724..11828014,11828399..11828431,11828514..11828584,
FT                   11830456..11830576,11830889..11831140,11831661..11831954,
FT                   11832189..11832473,11834278..11834565,11834866..11835147,
FT                   11835497..11835523,11835653..11835781,11838012..11838112))
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /product="immunoglobulin superfamily, member 1, transcript
FT                   variant mCT7741"
FT                   /note="gene_id=mCG8123.4 transcript_id=mCT7741.3 created on
FT                   22-APR-2004"
FT   CDS             complement(join(11826893..11826918,11827225..11827503,
FT                   11827724..11828014,11828399..11828431,11828514..11828584,
FT                   11830456..11830576,11830889..11831140,11831661..11831954,
FT                   11832189..11832473,11834278..11834565,11834866..11835147,
FT                   11835497..11835523,11835653..11835692))
FT                   /codon_start=1
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /product="immunoglobulin superfamily, member 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG8123.4 transcript_id=mCT7741.3
FT                   protein_id=mCP23083.3 isoform=CRA_c"
FT                   /protein_id="EDL29096.1"
FT                   /translation="MMLRTFTLLLLCIWLNPGMTSLAVESQPELWIESNYPQAPWENIT
FT                   LWCKSPSRVSSKFLLLKDNSQMTWIRPPYKTFQVSFFIGALTESNTGLYRCCYWKEKGW
FT                   SKPSKILELEAPGQLPKPIFWIQAETPPLPGCNVNIFCHGWLQDLVFMLFKEGYTEPVD
FT                   YQVPTGTMAIFSIDNLAPENEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTA
FT                   HPGPILAPGESLSLRCQGPIYGMTFALMRLEDLKKSFYHKKPIKNEAYFYFQDLKIQDT
FT                   GHYLCFYYDGSYRGSLLSDILKIWVTDTFPKTWLLVQPSPVIQMGQNVSLRCGGLMDGV
FT                   GLALYKKGEEKPLQFLDASSNTGNNSFFLKNVTYRDAGIYSCHYYLTWKTSIKMATYNT
FT                   VELMVVAWPSSVFKVGKTITLQCRVSHPVLEFSLEWEERTTFQKFSVDGDFLITDIEGQ
FT                   GTGTYSCSYRIEAHPNTWSHRSKPLKLVGPAGFLTWNSILNEAVRVSLTMQLASLLLLV
FT                   VWIRWKCRRLRLREAWLLGTAQGVAMLFILMALLCCGLCNGALTEEIEIVMPTPKPELW
FT                   AETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTHSH
FT                   TGSYHCHSWEEMAVSEPSEALELVGTDILPKPVISASLPIRGQELQIRCKGWLEGLGFA
FT                   LYKKGEQEPVQQLGAVGREAFFTIQRMEDKDEGNYSCRTHTEMQPFKWSEPSEPLELVI
FT                   KDGRTKAQN"
FT   mRNA            complement(join(11833341..11834565,11834866..11835147,
FT                   11835497..11835523,11835653..11835781,11838012..11838112))
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /product="immunoglobulin superfamily, member 1, transcript
FT                   variant mCT194324"
FT                   /note="gene_id=mCG8123.4 transcript_id=mCT194324.0 created
FT                   on 22-APR-2004"
FT   CDS             complement(join(11834216..11834565,11834866..11835147,
FT                   11835497..11835523,11835653..11835692))
FT                   /codon_start=1
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /product="immunoglobulin superfamily, member 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG8123.4 transcript_id=mCT194324.0
FT                   protein_id=mCP115353.0 isoform=CRA_b"
FT                   /protein_id="EDL29095.1"
FT                   /translation="MMLRTFTLLLLCIWLNPGMTSLAVESQPELWIESNYPQAPWENIT
FT                   LWCKSPSRVSSKFLLLKDNSQMTWIRPPYKTFQVSFFIGALTESNTGLYRCCYWKEKGW
FT                   SKPSKILELEAPGQLPKPIFWIQAETPPLPGCNVNIFCHGWLQDLVFMLFKEGYTEPVD
FT                   YQVPTGTMAIFSIDNLAPENEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGHGCWHL
FT                   TIVIPGIMAG"
FT   gene            complement(12582147..>12610093)
FT                   /locus_tag="mCG_66666"
FT                   /note="gene_id=mCG66666.2"
FT   mRNA            complement(join(12582147..12582325,12584631..12584784,
FT                   12589077..12589351,12590783..12590937,12593510..12593663,
FT                   12595247..12595534,12610064..>12610093))
FT                   /locus_tag="mCG_66666"
FT                   /product="mCG66666"
FT                   /note="gene_id=mCG66666.2 transcript_id=mCT66849.2 created
FT                   on 29-JAN-2003"
FT   CDS             complement(join(12590788..12590937,12593510..>12593620))
FT                   /codon_start=1
FT                   /locus_tag="mCG_66666"
FT                   /product="mCG66666"
FT                   /note="gene_id=mCG66666.2 transcript_id=mCT66849.2
FT                   protein_id=mCP33906.1"
FT                   /protein_id="EDL29097.1"
FT                   /translation="DIRSKYWRPVLLDPDGSHAGLDHGLHTLLPRRRGVRKNRPLGFAA
FT                   QDPSSLRHQEQALEAGCCWTQMGAMQDLTMACTHFFPGEGE"
FT   gene            12862718..12914720
FT                   /gene="2610018G03Rik"
FT                   /locus_tag="mCG_8120"
FT                   /note="gene_id=mCG8120.2"
FT   mRNA            join(12862718..12862843,12862976..12863132,
FT                   12891543..12891763,12901004..12901070,12907114..12907222,
FT                   12907312..12907427,12908270..12908455,12909480..12909628,
FT                   12910635..12910728,12911308..12911370,12911452..12911588,
FT                   12912919..12914720)
FT                   /gene="2610018G03Rik"
FT                   /locus_tag="mCG_8120"
FT                   /product="RIKEN cDNA 2610018G03, transcript variant
FT                   mCT7738"
FT                   /note="gene_id=mCG8120.2 transcript_id=mCT7738.2 created on
FT                   16-DEC-2002"
FT   mRNA            join(12862734..12862844,12862976..12863132,
FT                   12901014..12901070,12907114..12907222,12907312..12907427,
FT                   12908270..12908455,12909480..12909628,12910635..12910728,
FT                   12911308..12911370,12911452..12911588,12912919..12913467)
FT                   /gene="2610018G03Rik"
FT                   /locus_tag="mCG_8120"
FT                   /product="RIKEN cDNA 2610018G03, transcript variant
FT                   mCT177734"
FT                   /note="gene_id=mCG8120.2 transcript_id=mCT177734.0 created
FT                   on 16-DEC-2002"
FT   CDS             join(12863091..12863132,12891543..12891763,
FT                   12901004..12901070,12907114..12907222,12907312..12907427,
FT                   12908270..12908455,12909480..12909628,12910635..12910728,
FT                   12911308..12911370,12911452..12911588,12912919..12912943)
FT                   /codon_start=1
FT                   /gene="2610018G03Rik"
FT                   /locus_tag="mCG_8120"
FT                   /product="RIKEN cDNA 2610018G03, isoform CRA_b"
FT                   /note="gene_id=mCG8120.2 transcript_id=mCT7738.2
FT                   protein_id=mCP20516.2 isoform=CRA_b"
FT                   /protein_id="EDL29099.1"
FT                   /translation="MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNR
FT                   TQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSCLQGSKLWIIMEYLGG
FT                   GSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADF
FT                   GVAGQLTDTQIKRNTFVGTPFWADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNP
FT                   PTLIGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWK
FT                   AEGHSDEESDSEGSDSESSSRESNPHPEWSFTTVRKKPDPKKLQNGEEQDLVQTLSCLS
FT                   MIITPAFAELKQQDENNASRNQAIEELEKSIAVAETACPGITDKMVKKLIEKFQKCSAD
FT                   ESP"
FT   CDS             join(12863091..12863132,12901014..12901070,
FT                   12907114..12907222,12907312..12907427,12908270..12908455,
FT                   12909480..12909628,12910635..12910728,12911308..12911370,
FT                   12911452..12911588,12912919..12912943)
FT                   /codon_start=1
FT                   /gene="2610018G03Rik"
FT                   /locus_tag="mCG_8120"
FT                   /product="RIKEN cDNA 2610018G03, isoform CRA_a"
FT                   /note="gene_id=mCG8120.2 transcript_id=mCT177734.0
FT                   protein_id=mCP100656.0 isoform=CRA_a"
FT                   /protein_id="EDL29098.1"
FT                   /translation="MAHSPVAVQVPGMQGSKLWIIMEYLGGGSALDLLRAGPFDEFQIA
FT                   TMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVG
FT                   TPFWADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLIGDFTKSFKEFIDAC
FT                   LNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDEESDSEGSDSES
FT                   SSRESNPHPEWSFTTVRKKPDPKKLQNGEEQDLVQTLSCLSMIITPAFAELKQQDENNA
FT                   SRNQAIEELEKSIAVAETACPGITDKMVKKLIEKFQKCSADESP"
FT   gene            complement(12916592..>12931388)
FT                   /locus_tag="mCG_63011"
FT                   /note="gene_id=mCG63011.2"
FT   mRNA            complement(join(12916592..12917863,12919065..12919140,
FT                   12919259..12919327,12920563..12920726,12923243..12923390,
FT                   12923559..12923673,12931367..>12931388))
FT                   /locus_tag="mCG_63011"
FT                   /product="mCG63011"
FT                   /note="gene_id=mCG63011.2 transcript_id=mCT63194.2 created
FT                   on 07-JAN-2003"
FT   CDS             complement(join(12916802..12917863,12919065..12919140,
FT                   12919259..12919327,12920563..12920726,12923243..12923390,
FT                   12923559..12923673,12931367..12931388))
FT                   /codon_start=1
FT                   /locus_tag="mCG_63011"
FT                   /product="mCG63011"
FT                   /note="gene_id=mCG63011.2 transcript_id=mCT63194.2
FT                   protein_id=mCP40681.2"
FT                   /protein_id="EDL29100.1"
FT                   /translation="MVSHILQSELGDFHEETVRKHLVQTQYLPSQASLESKIMQFHQQH
FT                   IGRSPAESDILLLDIARKLDMYGIRPQPASDGEGMQIHLAVAHMGVLVLRVLCKDTLEF
FT                   TMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFRYSGRTQRQLLEYGKK
FT                   GRLKSLPFERKQYPSQYHERQCRSSPDILSDVSKQVEDLRLTYGSSYYRNVNGVHASES
FT                   MLDSRRRNSAVEVTFAAELEHSKPEAEATSLHPSQSSSSFTFIYADPVFNTDPEPIEFF
FT                   EERSPLSSFQTTSKFADSHTSKASPARQLTYTDVPYIPCTSQKVDIMPPQVFFYVDKPP
FT                   QVPRRSLIMAEENMRPDSYVDHSAIKPAKRSPRNMRIKSLQQDLQELQEAMARTSGRSN
FT                   INVEPEEEDPHLDDAFAYNLQEQTPKRSQSQSDMKTIRFPFGSEFRPLGPCPALTRKTD
FT                   LFACTFAEQEFPTVLIDQSSAERYVASESSDSESEIIKPDYYFLYGKGTKSPRARIRLS
FT                   SGSLQLEEEDETISFATPGAEDRTLLKPCNYFLA"
FT   gene            complement(13027348..13040333)
FT                   /gene="Rap2c"
FT                   /locus_tag="mCG_115837"
FT                   /note="gene_id=mCG115837.1"
FT   mRNA            complement(join(13027348..13028965,13037170..13037482,
FT                   13039824..13040333))
FT                   /gene="Rap2c"
FT                   /locus_tag="mCG_115837"
FT                   /product="RAP2C, member of RAS oncogene family, transcript
FT                   variant mCT116945"
FT                   /note="gene_id=mCG115837.1 transcript_id=mCT116945.1
FT                   created on 16-JUN-2003"
FT   mRNA            complement(join(13027348..13028965,13030501..13030694,
FT                   13037170..13037482,13039824..13040215))
FT                   /gene="Rap2c"
FT                   /locus_tag="mCG_115837"
FT                   /product="RAP2C, member of RAS oncogene family, transcript
FT                   variant mCT185832"
FT                   /note="gene_id=mCG115837.1 transcript_id=mCT185832.0
FT                   created on 16-JUN-2003"
FT   CDS             complement(join(13037204..13037482,13039824..13040096))
FT                   /codon_start=1
FT                   /gene="Rap2c"
FT                   /locus_tag="mCG_115837"
FT                   /product="RAP2C, member of RAS oncogene family, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG115837.1 transcript_id=mCT116945.1
FT                   protein_id=mCP87557.1 isoform=CRA_a"
FT                   /protein_id="EDL29101.1"
FT                   /translation="MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIE
FT                   VDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVK
FT                   RYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQ
FT                   MNYSSLPEKQDQCCTTCVVQ"
FT   CDS             complement(join(13037204..13037482,13039824..13040096))
FT                   /codon_start=1
FT                   /gene="Rap2c"
FT                   /locus_tag="mCG_115837"
FT                   /product="RAP2C, member of RAS oncogene family, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG115837.1 transcript_id=mCT185832.0
FT                   protein_id=mCP107090.0 isoform=CRA_a"
FT                   /protein_id="EDL29102.1"
FT                   /translation="MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIE
FT                   VDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVK
FT                   RYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQ
FT                   MNYSSLPEKQDQCCTTCVVQ"
FT   gene            complement(13136800..13231485)
FT                   /gene="Mbnl3"
FT                   /locus_tag="mCG_17293"
FT                   /note="gene_id=mCG17293.3"
FT   mRNA            complement(join(13136800..13139054,13139106..13143020,
FT                   13143045..13144337,13147136..13147230,13154243..13154393,
FT                   13155427..13155663,13156751..13156942,13164507..13164671,
FT                   13189708..13189954,13231264..13231485))
FT                   /gene="Mbnl3"
FT                   /locus_tag="mCG_17293"
FT                   /product="muscleblind-like 3 (Drosophila), transcript
FT                   variant mCT17185"
FT                   /note="gene_id=mCG17293.3 transcript_id=mCT17185.3 created
FT                   on 14-JUL-2003"
FT   mRNA            complement(join(13136800..13139054,13139106..13143020,
FT                   13143045..13144337,13147136..13150703))
FT                   /gene="Mbnl3"
FT                   /locus_tag="mCG_17293"
FT                   /product="muscleblind-like 3 (Drosophila), transcript
FT                   variant mCT186583"
FT                   /note="gene_id=mCG17293.3 transcript_id=mCT186583.0 created
FT                   on 14-JUL-2003"
FT   CDS             complement(join(13144326..13144337,13147136..13147230,
FT                   13154243..13154393,13155427..13155663,13156751..13156942,
FT                   13164507..13164671,13189708..13189884))
FT                   /codon_start=1
FT                   /gene="Mbnl3"
FT                   /locus_tag="mCG_17293"
FT                   /product="muscleblind-like 3 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG17293.3 transcript_id=mCT17185.3
FT                   protein_id=mCP10622.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q542D8"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="MGI:MGI:2444912"
FT                   /db_xref="UniProtKB/TrEMBL:Q542D8"
FT                   /protein_id="EDL29104.1"
FT                   /translation="MTPVNVALIRDTKWLTLEVCREFQRGTCSRADAECRFAHPPRVCH
FT                   VENGRVVACFDSLKGRCTRENCKYLHPPPHLKSQLEVNGRNNLIQQKTAAAMFAQHMQL
FT                   MLQNAQMSSLASFPMNPSLAANPAMAFNPYMTHPGMGLVPAELLPNGPVLISGNPPLAL
FT                   PGVPGPKPIRTDRLEVCREFQRGNCTRGESECRYAHPTDVSMIEVTDNSVTICMDYIKG
FT                   RCSREKCKYFHPPPHLQAKLRAAHHQMNHSAANAMALPHGALQLIPKRSALDKANGATP
FT                   VFNPSVFHCQQALANMQIPQQAFIPTVPMMHGATPSTVSTATPPASNVPYVPTTTGNQL
FT                   KY"
FT   CDS             complement(join(13144326..13144337,13147136..13147276))
FT                   /codon_start=1
FT                   /gene="Mbnl3"
FT                   /locus_tag="mCG_17293"
FT                   /product="muscleblind-like 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG17293.3 transcript_id=mCT186583.0
FT                   protein_id=mCP107818.0 isoform=CRA_a"
FT                   /protein_id="EDL29103.1"
FT                   /translation="MLHPSMCRFHDFLLQVPMMHGATPSTVSTATPPASNVPYVPTTTG
FT                   NQLKY"
FT   gene            complement(13237951..13238443)
FT                   /pseudo
FT                   /locus_tag="mCG_1040997"
FT                   /note="gene_id=mCG1040997.0"
FT   mRNA            complement(13237951..13238443)
FT                   /pseudo
FT                   /locus_tag="mCG_1040997"
FT                   /note="gene_id=mCG1040997.0 transcript_id=mCT158701.0
FT                   created on 14-JUL-2003"
FT   gene            13240325..13242095
FT                   /locus_tag="mCG_1041092"
FT                   /note="gene_id=mCG1041092.0"
FT   mRNA            join(13240325..13240875,13242020..13242095)
FT                   /locus_tag="mCG_1041092"
FT                   /product="mCG1041092"
FT                   /note="gene_id=mCG1041092.0 transcript_id=mCT158796.0
FT                   created on 14-JUL-2003"
FT   CDS             13240672..13240809
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041092"
FT                   /product="mCG1041092"
FT                   /note="gene_id=mCG1041092.0 transcript_id=mCT158796.0
FT                   protein_id=mCP87511.0"
FT                   /protein_id="EDL29105.1"
FT                   /translation="MYMSCRSHRARGHNTLACDLCYIRLWLSLFLLDFFLQIIISSFTS
FT                   "
FT   gene            complement(13244333..13245504)
FT                   /pseudo
FT                   /locus_tag="mCG_146386"
FT                   /note="gene_id=mCG146386.0"
FT   mRNA            complement(13244333..13245504)
FT                   /pseudo
FT                   /locus_tag="mCG_146386"
FT                   /note="gene_id=mCG146386.0 transcript_id=mCT186593.0
FT                   created on 14-JUL-2003"
FT   gene            complement(13411976..13707302)
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /note="gene_id=mCG5423.3"
FT   mRNA            complement(join(13411976..13415124,13453526..13453612,
FT                   13496447..13496479,13705489..13706007,13706774..13707302))
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /product="heparan sulfate 6-O-sulfotransferase 2,
FT                   transcript variant mCT4867"
FT                   /note="gene_id=mCG5423.3 transcript_id=mCT4867.3 created on
FT                   14-JUL-2003"
FT   mRNA            complement(join(13412453..13415124,13453526..13453612,
FT                   13496447..13496479,13705489..>13706063))
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /product="heparan sulfate 6-O-sulfotransferase 2,
FT                   transcript variant mCT192580"
FT                   /note="gene_id=mCG5423.3 transcript_id=mCT192580.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(13414233..13415124,13453526..13453612,
FT                   13496447..13496479,13705489..13706007,13706774..13706910))
FT                   /codon_start=1
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /product="heparan sulfate 6-O-sulfotransferase 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG5423.3 transcript_id=mCT4867.3
FT                   protein_id=mCP2802.3 isoform=CRA_c"
FT                   /protein_id="EDL29108.1"
FT                   /translation="MHDLRRRWDLGSLCRALLTRGLAAVGHSLKHVLSAIFSKIFGPLA
FT                   SVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVPDPYRSEDESS
FT                   ARFVPRYNFSRGDLLRKVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRV
FT                   GQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSCVPAVVDGKRDARLRPSRWRI
FT                   FQILDGTSKDRWGSSNFNSGANSPSSTKPRSTSKSGKNFHYITILRDPVSRYLSEWRHV
FT                   QRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPLKEFMDCPYNLANNRQVRMLSDL
FT                   TLVGCYNLSVMPEKQRNKVLLESAKSNLKHMAFFGLTEFQRKTQYLFEKTFNMNFISPF
FT                   TQYNTTRASSVEINEEIQKRIEGLNFLDMELYSYAKDLFLQRYQFMRQKEHQDARRKRQ
FT                   EQRKFLKGRFLQTHFQSQSQGQSQSQSPGQNLSQNPNPNPNQNLTQNLSHNLTPSSNPN
FT                   STQRENRGSQKQGSGQGQGDSGTSNGTNDYIGSVETWR"
FT   CDS             complement(join(13414233..13415124,13453526..13453612,
FT                   13496447..13496479,13705489..>13706027))
FT                   /codon_start=1
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /product="heparan sulfate 6-O-sulfotransferase 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5423.3 transcript_id=mCT192580.0
FT                   protein_id=mCP113543.0 isoform=CRA_b"
FT                   /protein_id="EDL29107.1"
FT                   /translation="RAWVSPSVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLL
FT                   RLQAFSSPVPDPYRSEDESSARFVPRYNFSRGDLLRKVDFDIKGDDLIVFLHIQKTGGT
FT                   TFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSC
FT                   VPAVVDGKRDARLRPSRWRIFQILDGTSKDRWGSSNFNSGANSPSSTKPRSTSKSGKNF
FT                   HYITILRDPVSRYLSEWRHVQRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPLKE
FT                   FMDCPYNLANNRQVRMLSDLTLVGCYNLSVMPEKQRNKVLLESAKSNLKHMAFFGLTEF
FT                   QRKTQYLFEKTFNMNFISPFTQYNTTRASSVEINEEIQKRIEGLNFLDMELYSYAKDLF
FT                   LQRYQFMRQKEHQDARRKRQEQRKFLKGRFLQTHFQSQSQGQSQSQSPGQNLSQNPNPN
FT                   PNQNLTQNLSHNLTPSSNPNSTQRENRGSQKQGSGQGQGDSGTSNGTNDYIGSVETWR"
FT   mRNA            complement(join(13702382..13706007,13706774..13707302))
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /product="heparan sulfate 6-O-sulfotransferase 2,
FT                   transcript variant mCT177733"
FT                   /note="gene_id=mCG5423.3 transcript_id=mCT177733.1 created
FT                   on 14-JUL-2003"
FT   CDS             complement(join(13705485..13706007,13706774..13706910))
FT                   /codon_start=1
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /product="heparan sulfate 6-O-sulfotransferase 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5423.3 transcript_id=mCT177733.1
FT                   protein_id=mCP100655.1 isoform=CRA_a"
FT                   /protein_id="EDL29106.1"
FT                   /translation="MHDLRRRWDLGSLCRALLTRGLAAVGHSLKHVLSAIFSKIFGPLA
FT                   SVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVPDPYRSEDESS
FT                   ARFVPRYNFSRGDLLRKVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRV
FT                   GQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSCVPAVVDGKRDARLRPSR"
FT   gene            complement(13779603..>13826480)
FT                   /gene="Usp26"
FT                   /locus_tag="mCG_65683"
FT                   /note="gene_id=mCG65683.2"
FT   mRNA            complement(join(13779603..13783117,13790791..13790871,
FT                   13818685..13818740,13822264..13822309,13823060..13823162,
FT                   13823831..13823889,13826149..13826264,13826338..>13826480))
FT                   /gene="Usp26"
FT                   /locus_tag="mCG_65683"
FT                   /product="ubiquitin specific peptidase 26"
FT                   /note="gene_id=mCG65683.2 transcript_id=mCT65866.2 created
FT                   on 16-DEC-2002"
FT   CDS             complement(join(13780533..13783117,13790791..>13790809))
FT                   /codon_start=1
FT                   /gene="Usp26"
FT                   /locus_tag="mCG_65683"
FT                   /product="ubiquitin specific peptidase 26"
FT                   /note="gene_id=mCG65683.2 transcript_id=mCT65866.2
FT                   protein_id=mCP25889.1"
FT                   /protein_id="EDL29109.1"
FT                   /translation="HPVPVSGKLGKQIETPRLLISIREFTCKEKRSMEPILINAQVQMW
FT                   SAKAGMSKSRNALIETCVGKREVKLILYFSTGKIKTLQLHDNIKSVVLQTYGEDQNYLH
FT                   LTFKNNDFLFVEKLTTTDARRLKRFLDKTSQGSIRPARSDERCGEPSTSAQELNGSGSS
FT                   CETNSECFESPKESEMCMFRELSLLPSSSTFLHNVGLLENQFIKRKRFFSDLAKNEKQS
FT                   NLKDSIRDFEANLVVCISNEKGKERNVREVDISKPGFGFPFETNYPEDSGVDVRDLNDL
FT                   ITKLFSPVLLETHCIENGLEWHEYMKTYLLYPEKLWQGLPNVGNTCYINVVLQSLCSIP
FT                   LFINDLFNQGFPWIKAPKDDFNMLLMQLLVLKDIYNARFRQKLLIGITKALPIFGEIFA
FT                   VDRQNDAHEFLSLCLVQLKETFQRVTMMWQSENDSGDFYLLKDIFADYATINKMPVCPV
FT                   TNNFEFELLSSIFCKACGLTLFKGEPSRYLSINIPQGGKDMSIQSTLDLFFSAEELEHR
FT                   CEKCLYNKSVSFHRFGRLPRVIIVHLKRYHFNESWVMKKDERPILVSKYLRLSCHCSKS
FT                   TKPPPPLRPGEHVKNLDLLKPLEVLGSEILKLPFNSVRTSRSKGFETINITSNRESEAQ
FT                   SGKRVSEVLSGKVQQENSGKGDTAHIVGSELTKETEKLKKHEEEHRPSDLDSGSIREAQ
FT                   KYQQAEKCNEGRSDKQISLEALTQSRPKPISQEQTENLGKTTLSHTQDSSQSSQSSSDS
FT                   SKSSRCSDDLDKKAKPTRKVDPTKLNKKEDNVYRLVNIINHIGNSPNGGHYINDAFDFK
FT                   RQSWFTYSDLHVTRTQEDFVYRGRSSTGYVFFYMHNDIFEELLAKETQSTSTSKG"
FT   gene            complement(13990953..>13994908)
FT                   /locus_tag="mCG_145459"
FT                   /note="gene_id=mCG145459.0"
FT   mRNA            complement(join(13990953..13992127,13992473..13992543,
FT                   13993169..13993334,13994865..>13994908))
FT                   /locus_tag="mCG_145459"
FT                   /product="mCG145459"
FT                   /note="gene_id=mCG145459.0 transcript_id=mCT184883.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(13991211..>13992119)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145459"
FT                   /product="mCG145459"
FT                   /note="gene_id=mCG145459.0 transcript_id=mCT184883.0
FT                   protein_id=mCP105980.0"
FT                   /protein_id="EDL29110.1"
FT                   /translation="VHPCQLHIFLHLFPKKPSMDPPDNSRNVNQDSTHSERETRDLEAG
FT                   EEEASTSGDVLGSSQGAQRASFPSTAGVPSVEASGSQIEFYPDILRQQILNSKTIDLIL
FT                   FLILKYRRKQQTCKAEILYMVIRGYEDHFPAIFTKASECLRLTFGLEIIERNPRVHSYS
FT                   LVNALGLTYDGMLHGFRGVPKIGLLIIVLCIIFIQDNCASEQELWRILNNMGLYAGRDH
FT                   FIYGDPGVLITEHFVQEGYLECRQVPGSDPPTREYLWGPRAHAETTKMKVLKHFASIVK
FT                   QDPRSYPTRYADALKDEIDRT"
FT   gene            complement(14069470..14181878)
FT                   /gene="Gpc4"
FT                   /locus_tag="mCG_51834"
FT                   /note="gene_id=mCG51834.1"
FT   mRNA            complement(join(14069470..14069762,14069955..14070433,
FT                   14070524..14070699,14071153..14071237,14073506..14073654,
FT                   14073749..14073879,14079763..14079928,14090726..14091119,
FT                   14108074..14108232,14181242..14181878))
FT                   /gene="Gpc4"
FT                   /locus_tag="mCG_51834"
FT                   /product="glypican 4"
FT                   /note="gene_id=mCG51834.1 transcript_id=mCT52017.1 created
FT                   on 16-DEC-2002"
FT   CDS             complement(join(14090866..14091119,14108074..14108232,
FT                   14181242..14181401))
FT                   /codon_start=1
FT                   /gene="Gpc4"
FT                   /locus_tag="mCG_51834"
FT                   /product="glypican 4"
FT                   /note="gene_id=mCG51834.1 transcript_id=mCT52017.1
FT                   protein_id=mCP25882.2"
FT                   /protein_id="EDL29111.1"
FT                   /translation="MARLGLLALLCTLAALSASLLAAELKSKSCSEVRRLYVSKGFNKN
FT                   DAPLYEINGDHLKICPQDYTCCSQEMEEKYSLQSKDDFKTVVSEQCNHLQAIFASRYKK
FT                   FDEFFKELLENAEKSLNDMFVKTYGHLYMQNSELFKDLFVELKRYYVAGNVNLEEMLND
FT                   FWARLLERMFRLVNSPSTILQMSTWNV"
FT   gene            complement(14288153..14632515)
FT                   /gene="Gpc3"
FT                   /locus_tag="mCG_114967"
FT                   /note="gene_id=mCG114967.1"
FT   mRNA            complement(join(14288153..14288678,14330887..14331046,
FT                   14384496..14384616,14406920..14407045,14415921..14416054,
FT                   14447273..14447967,14601106..14601267,14632234..14632515))
FT                   /gene="Gpc3"
FT                   /locus_tag="mCG_114967"
FT                   /product="glypican 3"
FT                   /note="gene_id=mCG114967.1 transcript_id=mCT116065.1
FT                   created on 17-DEC-2002"
FT   CDS             complement(join(14288509..14288678,14330887..14331046,
FT                   14384496..14384616,14406920..14407045,14415921..14416054,
FT                   14447273..14447967,14601106..14601267,14632234..14632405))
FT                   /codon_start=1
FT                   /gene="Gpc3"
FT                   /locus_tag="mCG_114967"
FT                   /product="glypican 3"
FT                   /note="gene_id=mCG114967.1 transcript_id=mCT116065.1
FT                   protein_id=mCP87668.1"
FT                   /db_xref="GOA:Q3TWB2"
FT                   /db_xref="InterPro:IPR001863"
FT                   /db_xref="InterPro:IPR015501"
FT                   /db_xref="InterPro:IPR019803"
FT                   /db_xref="MGI:MGI:104903"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TWB2"
FT                   /protein_id="EDL29112.1"
FT                   /translation="MAGTVRTACLLVAMLLGLGCLGQAQPPPPPDATCHQVRSFFQRLQ
FT                   PGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLII
FT                   QNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVD
FT                   DMVNELFDSLFPVIYTQMMNPGLPESVLDINECLRGARRDLKVFGSFPKLIMTQVSKSL
FT                   QVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVM
FT                   QGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNGGKL
FT                   TTTIGKLCAHSQQRQYRSAYYPEDLFIDKKILKVAHVEHEETLSSRRRELIQKLKSFIN
FT                   FYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVV
FT                   SQIIDKLKHINQLLRTMSVPKGKVLDKSLDEEGLESGDCGDDEDECIGSSGDGMVKVKN
FT                   QLRFLAELAYDLDVDDAPGNKQHGNQKDNEITTSHSVGNMPSPLKILISVAIYVACFFF
FT                   LVH"
FT   gene            14594152..14637110
FT                   /locus_tag="mCG_147983"
FT                   /note="gene_id=mCG147983.0"
FT   mRNA            join(14594152..14594440,14602459..14602525,
FT                   14603984..14604065,14612574..14612699,14636232..14637110)
FT                   /locus_tag="mCG_147983"
FT                   /product="mCG147983"
FT                   /note="gene_id=mCG147983.0 transcript_id=mCT188246.0
FT                   created on 13-JAN-2004"
FT   CDS             14636436..14637086
FT                   /codon_start=1
FT                   /locus_tag="mCG_147983"
FT                   /product="mCG147983"
FT                   /note="gene_id=mCG147983.0 transcript_id=mCT188246.0
FT                   protein_id=mCP109521.0"
FT                   /db_xref="MGI:MGI:2442968"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C9S7"
FT                   /protein_id="EDL29113.1"
FT                   /translation="MAGPPFLLWTPGEGYLAQHAQKNFSSPFAPGLQFERIREFPAVAS
FT                   SYYLAVAGRRVWFHGSKSSINQDFWERVKKGCSTAAAMGGAHTQPCTWPHTHTLFVLGP
FT                   VPLPPRCCSPFSIPLRYTVSSALNLTLELAVREEADKLILSQCIWLIGCNGGCPPRGIS
FT                   ISTGIKALNQRNRALKTLEFQASASGKGVFKLRGNEAFFGAPEITSCRQLLIC"
FT   gene            complement(14762480..14764877)
FT                   /locus_tag="mCG_147982"
FT                   /note="gene_id=mCG147982.0"
FT   mRNA            complement(join(14762480..14763835,14764772..14764877))
FT                   /locus_tag="mCG_147982"
FT                   /product="mCG147982"
FT                   /note="gene_id=mCG147982.0 transcript_id=mCT188245.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(14763730..14763835,14764772..14764806))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147982"
FT                   /product="mCG147982"
FT                   /note="gene_id=mCG147982.0 transcript_id=mCT188245.0
FT                   protein_id=mCP109520.0"
FT                   /protein_id="EDL29114.1"
FT                   /translation="MGQALQEPDRTRCLEDLSAWHDWLEHTLRSQEVHRSLLEPLLKMR
FT                   E"
FT   gene            complement(14791425..14791881)
FT                   /locus_tag="mCG_142393"
FT                   /note="gene_id=mCG142393.0"
FT   mRNA            complement(14791425..14791881)
FT                   /locus_tag="mCG_142393"
FT                   /product="mCG142393"
FT                   /note="gene_id=mCG142393.0 transcript_id=mCT180376.0
FT                   created on 10-FEB-2003"
FT   CDS             complement(14791577..14791870)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142393"
FT                   /product="mCG142393"
FT                   /note="gene_id=mCG142393.0 transcript_id=mCT180376.0
FT                   protein_id=mCP103298.0"
FT                   /protein_id="EDL29115.1"
FT                   /translation="MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKK
FT                   LRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEGDH"
FT   gene            14810423..14818711
FT                   /locus_tag="mCG_61513"
FT                   /note="gene_id=mCG61513.1"
FT   mRNA            join(14810423..14810539,14817274..14818711)
FT                   /locus_tag="mCG_61513"
FT                   /product="mCG61513"
FT                   /note="gene_id=mCG61513.1 transcript_id=mCT61696.1 created
FT                   on 07-JAN-2003"
FT   CDS             14817298..14818269
FT                   /codon_start=1
FT                   /locus_tag="mCG_61513"
FT                   /product="mCG61513"
FT                   /note="gene_id=mCG61513.1 transcript_id=mCT61696.1
FT                   protein_id=mCP42633.2"
FT                   /db_xref="GOA:Q3UYG1"
FT                   /db_xref="InterPro:IPR026789"
FT                   /db_xref="MGI:MGI:3588225"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3UYG1"
FT                   /protein_id="EDL29116.1"
FT                   /translation="MDARRKHWKDNTFTPFLNEHDFQEAAAPPQPLSEQSSADNHKRMG
FT                   RVSNFSVRNTQEGNKFKRKDYSSQIAEGEQDSNLRERRMNVSKNDANTNSAFWDSLHLD
FT                   DATKESSHRRESASAWNKKKLPAATQVTRKKWTEAMPPKLRLHLLNEELGELSLKCREI
FT                   ERDFENAEKELLNFRKEASVKAVNFQEPGTGASKKDRELQALKNDLSEKATNVKNLTEE
FT                   LQQAKEVMYRLSLENRNLKDAVRKLKHQTELNTALLREEMKLFYELEMEKIRLELGAIK
FT                   NELRVEKTLRVKNSRALEVLGRHVASVVRSSNPADHFTGNIF"
FT   gene            14927798..14928747
FT                   /locus_tag="mCG_142391"
FT                   /note="gene_id=mCG142391.0"
FT   mRNA            14927798..14928747
FT                   /locus_tag="mCG_142391"
FT                   /product="mCG142391"
FT                   /note="gene_id=mCG142391.0 transcript_id=mCT180373.0
FT                   created on 10-FEB-2003"
FT   CDS             14927826..14928707
FT                   /codon_start=1
FT                   /locus_tag="mCG_142391"
FT                   /product="mCG142391"
FT                   /note="gene_id=mCG142391.0 transcript_id=mCT180373.0
FT                   protein_id=mCP103295.0"
FT                   /db_xref="GOA:Q58EU3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q58EU3"
FT                   /protein_id="EDL29117.1"
FT                   /translation="MADDAGAAGGPGGPGGPGLGGRGGFRGGFGSGLRGRGRGRGRGRG
FT                   RGRGARGGKAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKD
FT                   EVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIV
FT                   PVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDC
FT                   YTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVS
FT                   VQRTQAPAVATT"
FT   gene            14941685..14983601
FT                   /gene="Phf6"
FT                   /locus_tag="mCG_68204"
FT                   /note="gene_id=mCG68204.1"
FT   mRNA            join(14941685..14941909,14946013..14946196,
FT                   14946626..14946727,14961136..14961269,14961544..14961587,
FT                   14969783..14969949,14970095..14970238,14972090..14972194,
FT                   14975257..14975390,14983049..14983175,14983503..14983601)
FT                   /gene="Phf6"
FT                   /locus_tag="mCG_68204"
FT                   /product="PHD finger protein 6, transcript variant
FT                   mCT68391"
FT                   /note="gene_id=mCG68204.1 transcript_id=mCT68391.1 created
FT                   on 07-JAN-2003"
FT   mRNA            join(<14941766..14941909,14946013..14946196,
FT                   14946626..14946727,14961136..14961269,14961544..14961587,
FT                   14969783..14969949,14970095..14970238,14972090..14972194,
FT                   14975257..14977892)
FT                   /gene="Phf6"
FT                   /locus_tag="mCG_68204"
FT                   /product="PHD finger protein 6, transcript variant
FT                   mCT192588"
FT                   /note="gene_id=mCG68204.1 transcript_id=mCT192588.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<14946023..14946196,14946626..14946727,
FT                   14961136..14961269,14961544..14961587,14969783..14969949,
FT                   14970095..14970238,14972090..14972194,14975257..14975394)
FT                   /codon_start=1
FT                   /gene="Phf6"
FT                   /locus_tag="mCG_68204"
FT                   /product="PHD finger protein 6, isoform CRA_a"
FT                   /note="gene_id=mCG68204.1 transcript_id=mCT192588.0
FT                   protein_id=mCP113544.0 isoform=CRA_a partial"
FT                   /protein_id="EDL29118.1"
FT                   /translation="GLKWQSLNTLKIMSSSIEQKKGSTRQRKCGFCKSNRDKECGQLLI
FT                   SENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATI
FT                   GCDVKTCHRTYHYHCALHDKAQIREKPSQGIYMVYCRKHKKTAHNSEADLEESFNEHEL
FT                   EPSSPKTKKKSRKGRPRKTNLKGLPEDSRSTSSHGTDEMESSSYRDRSPHRSSPNDTRP
FT                   KCGFCHVGEEENEARGKLHIFNAKKAAAHYKCMLFSSGTVQLTTTSRAEFGDFDIKTVL
FT                   QEIKRGKRMKCTLCSQPGATIGCEIKACVKTYHYHCGVQDKAKYIENMSRGIYK"
FT   CDS             join(14946059..14946196,14946626..14946727,
FT                   14961136..14961269,14961544..14961587,14969783..14969949,
FT                   14970095..14970238,14972090..14972194,14975257..14975390,
FT                   14983049..14983175)
FT                   /codon_start=1
FT                   /gene="Phf6"
FT                   /locus_tag="mCG_68204"
FT                   /product="PHD finger protein 6, isoform CRA_b"
FT                   /note="gene_id=mCG68204.1 transcript_id=mCT68391.1
FT                   protein_id=mCP43421.2 isoform=CRA_b"
FT                   /protein_id="EDL29119.1"
FT                   /translation="MSSSIEQKKGSTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKC
FT                   MLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYH
FT                   YHCALHDKAQIREKPSQGIYMVYCRKHKKTAHNSEADLEESFNEHELEPSSPKTKKKSR
FT                   KGRPRKTNLKGLPEDSRSTSSHGTDEMESSSYRDRSPHRSSPNDTRPKCGFCHVGEEEN
FT                   EARGKLHIFNAKKAAAHYKCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCT
FT                   LCSQPGATIGCEIKACVKTYHYHCGVQDKAKYIENMSRGIYKLYCKNHSGNDERDEEDE
FT                   ERESKSRGRVAIDQQLTQQQLNGN"
FT   gene            15017802..15051324
FT                   /gene="Hprt1"
FT                   /locus_tag="mCG_9991"
FT                   /note="gene_id=mCG9991.3"
FT   mRNA            join(15017802..15017962,15026728..15026845,
FT                   15028827..15028933,15031594..15031777,15038048..15038113,
FT                   15041672..15041689,15046012..15046094,15049770..15049816,
FT                   15049988..15050064,15050732..15051324)
FT                   /gene="Hprt1"
FT                   /locus_tag="mCG_9991"
FT                   /product="hypoxanthine guanine phosphoribosyl transferase
FT                   1, transcript variant mCT177735"
FT                   /note="gene_id=mCG9991.3 transcript_id=mCT177735.1 created
FT                   on 16-JUL-2003"
FT   mRNA            join(15017802..15017962,15028827..15028933,
FT                   15031594..15031777,15038048..15038113,15041672..15041689,
FT                   15046012..15046094,15049770..15049816,15049988..15050064,
FT                   15050732..15051324)
FT                   /gene="Hprt1"
FT                   /locus_tag="mCG_9991"
FT                   /product="hypoxanthine guanine phosphoribosyl transferase
FT                   1, transcript variant mCT9786"
FT                   /note="gene_id=mCG9991.3 transcript_id=mCT9786.2 created on
FT                   16-JUL-2003"
FT   CDS             join(15017936..15017962,15028827..15028933,
FT                   15031594..15031777,15038048..15038113,15041672..15041689,
FT                   15046012..15046094,15049770..15049816,15049988..15050064,
FT                   15050732..15050779)
FT                   /codon_start=1
FT                   /gene="Hprt1"
FT                   /locus_tag="mCG_9991"
FT                   /product="hypoxanthine guanine phosphoribosyl transferase
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG9991.3 transcript_id=mCT9786.2
FT                   protein_id=mCP4144.2 isoform=CRA_b"
FT                   /protein_id="EDL29121.1"
FT                   /translation="MPTRSPSVVISDDEPGYDLDLFCIPNHYAEDLEKVFIPHGLIMDR
FT                   TERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKS
FT                   YCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQYSPKMVKVASL
FT                   LVKRTSRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA"
FT   CDS             join(15028926..15028933,15031594..15031777,
FT                   15038048..15038113,15041672..15041689,15046012..15046094,
FT                   15049770..15049816,15049988..15050064,15050732..15050779)
FT                   /codon_start=1
FT                   /gene="Hprt1"
FT                   /locus_tag="mCG_9991"
FT                   /product="hypoxanthine guanine phosphoribosyl transferase
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG9991.3 transcript_id=mCT177735.1
FT                   protein_id=mCP100657.1 isoform=CRA_a"
FT                   /protein_id="EDL29120.1"
FT                   /translation="MDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNR
FT                   NSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTL
FT                   LSLVKQYSPKMVKVASLLVKRTSRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHV
FT                   CVISETGKAKYKA"
FT   gene            complement(15084295..>15086867)
FT                   /locus_tag="mCG_9993"
FT                   /note="gene_id=mCG9993.2"
FT   mRNA            complement(join(15084295..15085186,15085838..15085860,
FT                   15086354..15086465,15086694..>15086867))
FT                   /locus_tag="mCG_9993"
FT                   /product="mCG9993"
FT                   /note="gene_id=mCG9993.2 transcript_id=mCT9788.2 created on
FT                   07-JAN-2003"
FT   CDS             complement(join(15084984..15085186,15085838..15085860,
FT                   15086354..>15086454))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9993"
FT                   /product="mCG9993"
FT                   /note="gene_id=mCG9993.2 transcript_id=mCT9788.2
FT                   protein_id=mCP4143.0"
FT                   /protein_id="EDL29122.1"
FT                   /translation="GAASQENPRNLCKKLTMKFKKFYDFGAIFEWSESIGKVWLEGDHR
FT                   WFFPPQFRVHVKMTCNIAKKRRNFHSNLRSGAVIINGFIYHDLSNAYVSTGSLSVMLGI
FT                   LYLV"
FT   gene            complement(15099686..15143690)
FT                   /gene="Plac1"
FT                   /locus_tag="mCG_9992"
FT                   /note="gene_id=mCG9992.1"
FT   mRNA            complement(join(15099686..15100575,15127980..15128051,
FT                   15143583..15143690))
FT                   /gene="Plac1"
FT                   /locus_tag="mCG_9992"
FT                   /product="placental specific protein 1"
FT                   /note="gene_id=mCG9992.1 transcript_id=mCT9787.1 created on
FT                   17-DEC-2002"
FT   CDS             complement(15099997..15100518)
FT                   /codon_start=1
FT                   /gene="Plac1"
FT                   /locus_tag="mCG_9992"
FT                   /product="placental specific protein 1"
FT                   /note="gene_id=mCG9992.1 transcript_id=mCT9787.1
FT                   protein_id=mCP4145.1"
FT                   /protein_id="EDL29123.1"
FT                   /translation="MNLRKFLGGTVLVAFMLFSYSEQNQVNVLCSTDWFMVTVHPFLLN
FT                   NDVYVHFYEVHLGLGCPPNHVHPHFYQFHYRVTECGIRIKAVSPDVVIYSSEIHYASKG
FT                   SSTKYVIPVSCAAPRRSPWLTKPYSAKAPSNNMGATPKNDTSYHVFTLPEPSEQPNCSC
FT                   PPYVYNQKSM"
FT   gene            complement(15272162..>15298884)
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /note="gene_id=mCG51547.2"
FT   mRNA            complement(join(15272162..15275019,15283122..15283218,
FT                   15288045..15288109,15288929..15289014,15289283..15289384,
FT                   15289634..15289688,15289778..15289821,15295114..15295192,
FT                   15297952..15298134))
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /product="RIKEN cDNA 4632404H22, transcript variant
FT                   mCT51730"
FT                   /note="gene_id=mCG51547.2 transcript_id=mCT51730.2 created
FT                   on 17-DEC-2002"
FT   mRNA            complement(join(15272475..15274100,15283122..15283218,
FT                   15288045..15288106,15288929..15289014,15289283..15289384,
FT                   15289634..15289688,15289778..15289821,15295114..15295192,
FT                   15297952..>15298875))
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /product="RIKEN cDNA 4632404H22, transcript variant
FT                   mCT192571"
FT                   /note="gene_id=mCG51547.2 transcript_id=mCT192571.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(15273593..15274100,15282942..15283014,
FT                   15283122..15283218,15288045..15288106,15288929..15289014,
FT                   15289283..15289384,15289634..15289688,15289778..15289821,
FT                   15295114..15295192,15297952..>15298884))
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /product="RIKEN cDNA 4632404H22, transcript variant
FT                   mCT192570"
FT                   /note="gene_id=mCG51547.2 transcript_id=mCT192570.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(15274031..15274100,15283122..15283218,
FT                   15288045..15288106,15288929..15289014,15289283..15289384,
FT                   15289634..15289688,15289778..15289821,15295114..15295192,
FT                   15297952..>15298103))
FT                   /codon_start=1
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /product="RIKEN cDNA 4632404H22, isoform CRA_b"
FT                   /note="gene_id=mCG51547.2 transcript_id=mCT192571.0
FT                   protein_id=mCP113542.0 isoform=CRA_b"
FT                   /protein_id="EDL29125.1"
FT                   /translation="QSTRSREHCRLCCLASLRMAQEKMDLDFEADTSEGATLRRSNSAP
FT                   LIHVLSDLSQVFEPYPLRTGRTSTAIMSHHSLEEGLDMMNRETTNEREAQAGMQISQSW
FT                   DESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGKQCLSPSLQMFVSSSGMPPS
FT                   PVLNPRHFSRRSQSPVKCIRPSVLGPLKRKGEMEMESQPKRPFQGTTSMLSTNPAQLSD
FT                   FSSWWCYQGEEIPALTRCVEHLQMNE"
FT   CDS             complement(join(15274875..15275019,15283122..15283218,
FT                   15288045..15288109,15288929..15289014,15289283..15289384,
FT                   15289634..15289688,15289778..15289821,15295114..15295192,
FT                   15297952..15298049))
FT                   /codon_start=1
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /product="RIKEN cDNA 4632404H22, isoform CRA_c"
FT                   /note="gene_id=mCG51547.2 transcript_id=mCT51730.2
FT                   protein_id=mCP24045.2 isoform=CRA_c"
FT                   /protein_id="EDL29126.1"
FT                   /translation="MAQEKMDLDFEADTSEGATLRRSNSAPLIHVLSDLSQVFEPYPLR
FT                   TGRTSTAIMSHHSLEEGLDMMNRETTNEREAQAGMQISQSWDESLSLSDSDFDKPEKLY
FT                   SPKRIDFTPVSPAPSPTRGFGKQCLSPSLQMFVSSSGMPPSPVLNPRHFSSRRSQSPVK
FT                   CIRPSVLGPLKRKGEMEMESQPKRPFQGTTSMLSTNPAQLSDFSSCSDILDGSSISSGL
FT                   SSDSLATGSAPAESPVACSNSCSPFILMDDLSPK"
FT   CDS             complement(join(15282978..15283014,15283122..15283218,
FT                   15288045..15288106,15288929..15289014,15289283..15289384,
FT                   15289634..15289688,15289778..15289821,15295114..15295192,
FT                   15297952..>15298103))
FT                   /codon_start=1
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /product="RIKEN cDNA 4632404H22, isoform CRA_a"
FT                   /note="gene_id=mCG51547.2 transcript_id=mCT192570.0
FT                   protein_id=mCP113541.0 isoform=CRA_a"
FT                   /protein_id="EDL29124.1"
FT                   /translation="QSTRSREHCRLCCLASLRMAQEKMDLDFEADTSEGATLRRSNSAP
FT                   LIHVLSDLSQVFEPYPLRTGRTSTAIMSHHSLEEGLDMMNRETTNEREAQAGMQISQSW
FT                   DESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGKQCLSPSLQMFVSSSGMPPS
FT                   PVLNPRHFSRRSQSPVKCIRPSVLGPLKRKGEMEMESQPKRPFQGTTSMLSTNPAQLSD
FT                   FSSWGSLHGGVSDFE"
FT   gene            15302438..15360402
FT                   /gene="4930432H15Rik"
FT                   /locus_tag="mCG_3693"
FT                   /note="gene_id=mCG3693.2"
FT   mRNA            join(15302438..15302510,15306627..15306828,
FT                   15311447..15311525,15322722..15322778,15325430..15325474,
FT                   15327688..15327780,15330461..15330516,15357197..15357329,
FT                   15360286..15360402)
FT                   /gene="4930432H15Rik"
FT                   /locus_tag="mCG_3693"
FT                   /product="RIKEN cDNA 4930432H15"
FT                   /note="gene_id=mCG3693.2 transcript_id=mCT3158.2 created on
FT                   17-DEC-2002"
FT   CDS             join(15306644..15306828,15311447..15311525,
FT                   15322722..15322778,15325430..15325474,15327688..15327780,
FT                   15330461..15330490)
FT                   /codon_start=1
FT                   /gene="4930432H15Rik"
FT                   /locus_tag="mCG_3693"
FT                   /product="RIKEN cDNA 4930432H15"
FT                   /note="gene_id=mCG3693.2 transcript_id=mCT3158.2
FT                   protein_id=mCP1155.2"
FT                   /protein_id="EDL29127.1"
FT                   /translation="MSLNEEEPDTLQNFQLGRGFILNTDVIQETMEVDLGLVPASSSVD
FT                   ISYVRRSNSIPSVNGFGDNSQGFQVGPTRMRRNGSPFLNQHGLLFLPSRSRTSANRIFQ
FT                   IKQEEGMDMAIREAMHERNDNNTVKSSTMRNINPNPFSPVASLPKRPRKNPHHDHLTF"
FT   gene            complement(15377839..15403811)
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /note="gene_id=mCG3692.1"
FT   mRNA            complement(join(15377839..15379231,15380946..15381107,
FT                   15388898..15389115,15390652..15390727,15390816..15391069,
FT                   15403702..15403811))
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /product="motile sperm domain containing 1, transcript
FT                   variant mCT3157"
FT                   /note="gene_id=mCG3692.1 transcript_id=mCT3157.2 created on
FT                   17-DEC-2002"
FT   mRNA            complement(join(15378263..15379231,15380946..15381107,
FT                   15388895..15389115,15390652..15390727,15390816..15391069,
FT                   15403702..15403774))
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /product="motile sperm domain containing 1, transcript
FT                   variant mCT177731"
FT                   /note="gene_id=mCG3692.1 transcript_id=mCT177731.0 created
FT                   on 17-DEC-2002"
FT   mRNA            complement(join(15378263..15379231,15380946..15381107,
FT                   15388895..15389115,15390652..15390727,15390816..15391069,
FT                   15393637..15393711,15403702..15403774))
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /product="motile sperm domain containing 1, transcript
FT                   variant mCT177732"
FT                   /note="gene_id=mCG3692.1 transcript_id=mCT177732.0 created
FT                   on 17-DEC-2002"
FT   CDS             complement(join(15379200..15379231,15380946..15381107,
FT                   15388898..15389115,15390652..15390727,15390816..15390969))
FT                   /codon_start=1
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /product="motile sperm domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG3692.1 transcript_id=mCT3157.2
FT                   protein_id=mCP1154.2 isoform=CRA_b"
FT                   /protein_id="EDL29130.1"
FT                   /translation="MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYE
FT                   FALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQ
FT                   RKALGRKEVIATLLPSAKEQQKEEEEKRIKEHLTESVFFEQSCQPENRAVSSGPSLLTV
FT                   FLGVVCIAALMLPTLGDMESLVPLYLHLSVNQKLVAAYILGLITMAILRT"
FT   CDS             complement(join(15379200..15379231,15380946..15381107,
FT                   15388895..15389115,15390652..15390727,15390816..15390969))
FT                   /codon_start=1
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /product="motile sperm domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG3692.1 transcript_id=mCT177731.0
FT                   protein_id=mCP100654.0 isoform=CRA_a"
FT                   /protein_id="EDL29128.1"
FT                   /translation="MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYE
FT                   FALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQ
FT                   RKALGRKEVIATLLPSAKEQQKEEEEKRIKEHLTESVFFEQSCQPGKNRAVSSGPSLLT
FT                   VFLGVVCIAALMLPTLGDMESLVPLYLHLSVNQKLVAAYILGLITMAILRT"
FT   CDS             complement(join(15379200..15379231,15380946..15381107,
FT                   15388895..15389115,15390652..15390727,15390816..15390969))
FT                   /codon_start=1
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /product="motile sperm domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG3692.1 transcript_id=mCT177732.0
FT                   protein_id=mCP100653.0 isoform=CRA_a"
FT                   /protein_id="EDL29129.1"
FT                   /translation="MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYE
FT                   FALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQ
FT                   RKALGRKEVIATLLPSAKEQQKEEEEKRIKEHLTESVFFEQSCQPGKNRAVSSGPSLLT
FT                   VFLGVVCIAALMLPTLGDMESLVPLYLHLSVNQKLVAAYILGLITMAILRT"
FT   gene            complement(15513016..15518946)
FT                   /locus_tag="mCG_56763"
FT                   /note="gene_id=mCG56763.1"
FT   mRNA            complement(join(15513016..15513532,15516058..15516179,
FT                   15517079..15517220,15517620..15517804,15518683..15518946))
FT                   /locus_tag="mCG_56763"
FT                   /product="mCG56763"
FT                   /note="gene_id=mCG56763.1 transcript_id=mCT56946.1 created
FT                   on 07-JAN-2003"
FT   CDS             complement(join(15513290..15513532,15516058..15516179,
FT                   15517079..15517220,15517620..15517804,15518683..15518833))
FT                   /codon_start=1
FT                   /locus_tag="mCG_56763"
FT                   /product="mCG56763"
FT                   /note="gene_id=mCG56763.1 transcript_id=mCT56946.1
FT                   protein_id=mCP28172.2"
FT                   /db_xref="InterPro:IPR025223"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D434"
FT                   /protein_id="EDL29131.1"
FT                   /translation="MGVTTSRPSCSCCCCFFNCVGRCLLRLILGVVYYFQWDVPSVERG
FT                   QIHQEGELNTKIVMGTVTSFGNDYGWIEDCIFFSSDAIIGSIPLRTGDKVLAFVEEDPL
FT                   SHELKATEVCVSSEEGVSKDADSKVKDLSVCVSQVKKNFIYIGDEYYFYLDSISKAILG
FT                   FTPREGDWLDIEYSVEQGSPKITVHSVKATQRRQLEEVCVTSIHKRKGMLNHTIFFTLD
FT                   SLNLPLGYTPILGHMVNVVIIQSTQQNYKWRAISMTPISPTVVGIGPRNSSSLLFLYQ"
FT   gene            complement(15581338..15582537)
FT                   /locus_tag="mCG_142390"
FT                   /note="gene_id=mCG142390.0"
FT   mRNA            complement(join(15581338..15581986,15582317..15582537))
FT                   /locus_tag="mCG_142390"
FT                   /product="mCG142390"
FT                   /note="gene_id=mCG142390.0 transcript_id=mCT180372.0
FT                   created on 10-FEB-2003"
FT   CDS             complement(join(15581838..15581986,15582317..15582476))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142390"
FT                   /product="mCG142390"
FT                   /note="gene_id=mCG142390.0 transcript_id=mCT180372.0
FT                   protein_id=mCP103294.0"
FT                   /protein_id="EDL29132.1"
FT                   /translation="MEGQGKVKRPKAYMLRHNRRRRRRNPIPFPELFDGEMDKLPEFIV
FT                   QTGSYMLVVPRPPCLEISHARAPVSSCVLAFVPGIAPQAPAAVPAGPGSGEHKASHC"
FT   gene            complement(15643221..>15646695)
FT                   /locus_tag="mCG_115122"
FT                   /note="gene_id=mCG115122.0"
FT   mRNA            complement(join(15643221..15643331,15643600..15643764,
FT                   15645174..15645310,15646343..>15646695))
FT                   /locus_tag="mCG_115122"
FT                   /product="mCG115122"
FT                   /note="gene_id=mCG115122.0 transcript_id=mCT116222.1
FT                   created on 07-JAN-2003"
FT   CDS             complement(join(15645273..15645310,15646343..>15646694))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115122"
FT                   /product="mCG115122"
FT                   /note="gene_id=mCG115122.0 transcript_id=mCT116222.1
FT                   protein_id=mCP87620.1"
FT                   /protein_id="EDL29133.1"
FT                   /translation="VAAAAALSGLAVRLSRGAETRSSYGAFCKGLTRTLLTFFDLAWRL
FT                   RVNFPYFYMVASVMLNVRLQCGSSEQTPSATAERAIRAFRAILAAAGRTAGRTVPPDCG
FT                   GESKRHSQGPSILGIGLLGDGSALH"
FT   gene            15654618..15668447
FT                   /locus_tag="mCG_8350"
FT                   /note="gene_id=mCG8350.1"
FT   mRNA            join(15654618..15654843,15657163..15657344,
FT                   15663734..15663866,15666282..15666394,15667673..15668447)
FT                   /locus_tag="mCG_8350"
FT                   /product="mCG8350"
FT                   /note="gene_id=mCG8350.1 transcript_id=mCT7695.1 created on
FT                   07-JAN-2003"
FT   CDS             join(15654753..15654843,15657163..15657344,
FT                   15663734..15663866,15666282..15666394,15667673..15667864)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8350"
FT                   /product="mCG8350"
FT                   /note="gene_id=mCG8350.1 transcript_id=mCT7695.1
FT                   protein_id=mCP8544.2"
FT                   /db_xref="GOA:Q14BQ3"
FT                   /db_xref="MGI:MGI:1922263"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BQ3"
FT                   /protein_id="EDL29134.1"
FT                   /translation="MHRLISRLRAFFQRKADPKEAKEERQKLLEDATSLQNKQGVVAGS
FT                   CSNYDCMTKHTRSSADVETGDNPLKAEPNLPAAVEEQSPRGLNAVTVDNDHDEEPSESH
FT                   MRILLASITSLVGDADYNGHGFSFSLDIACKDFKPYNGDLVEIEFSDEQDTQSRRAILV
FT                   KPLKHCHLNEVRVTRTDGSTGVLEDTIFFTLDSLKLPSGYVPQPDDVVNVVAVQSMQSN
FT                   YFWRAVAMTPVQVL"
FT   gene            complement(15672907..15687658)
FT                   /locus_tag="mCG_8351"
FT                   /note="gene_id=mCG8351.1"
FT   mRNA            complement(join(15672907..15673193,15673338..15673442,
FT                   15675639..15675737,15676928..15677027,15677809..15677926,
FT                   15680000..15680034,15681009..15681072,15681474..15681820,
FT                   15687606..15687658))
FT                   /locus_tag="mCG_8351"
FT                   /product="mCG8351"
FT                   /note="gene_id=mCG8351.1 transcript_id=mCT7696.2 created on
FT                   07-JAN-2003"
FT   CDS             complement(join(15673173..15673193,15673338..15673442,
FT                   15675639..15675737,15676928..15677027,15677809..15677926,
FT                   15680000..15680034,15681009..15681072,15681474..15681807))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8351"
FT                   /product="mCG8351"
FT                   /note="gene_id=mCG8351.1 transcript_id=mCT7696.2
FT                   protein_id=mCP8545.2"
FT                   /db_xref="GOA:Q9DAC5"
FT                   /db_xref="InterPro:IPR006888"
FT                   /db_xref="MGI:MGI:1922764"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DAC5"
FT                   /protein_id="EDL29135.1"
FT                   /translation="MFPRGRRDPEEFKSTPEDPEEPESTTRDPGGLESTPGDPEGFEST
FT                   PGDPEGFESTPGDPKGFESTPGDPEGFESTPGDPVGFESTPTEEEHLAVYSFDDDFQHP
FT                   RVLQRSEELRSTSDSCRERSPVELFTDPGEKVEVMLGRIGVDINRALSAKRQRMETTAR
FT                   QSFEGVEQKMKEVWNSHEDAMAQLNEESAQAFANLFEQWNEDFKKFREQHEKLVNDFKQ
FT                   QEKIFQRTRFVQNQRIRTIKEIHEQFLQKLEDLESKNDDLLTRTQNELKDEINDLQKKI
FT                   LRESEESTLF"
FT   gene            complement(15702528..>15704154)
FT                   /locus_tag="mCG_142536"
FT                   /note="gene_id=mCG142536.0"
FT   mRNA            complement(join(15702528..15702795,15703892..>15704154))
FT                   /locus_tag="mCG_142536"
FT                   /product="mCG142536"
FT                   /note="gene_id=mCG142536.0 transcript_id=mCT180661.0
FT                   created on 20-FEB-2003"
FT   CDS             complement(15703910..>15704152)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142536"
FT                   /product="mCG142536"
FT                   /note="gene_id=mCG142536.0 transcript_id=mCT180661.0
FT                   protein_id=mCP103583.0"
FT                   /protein_id="EDL29136.1"
FT                   /translation="GAAPHFTFQLPDVESESESESLEFDVVTSTLDSLLVSDDEDEDDF
FT                   LRRSSSSSSLNESEFDNTNSSRRLPIFSRFSDSEK"
FT   gene            complement(15706961..15727559)
FT                   /locus_tag="mCG_115120"
FT                   /note="gene_id=mCG115120.2"
FT   mRNA            complement(join(15706961..15708243,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15725982..15726059,15727463..15727547))
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, transcript variant mCT177644"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT177644.1
FT                   created on 10-JUN-2004"
FT   CDS             complement(join(15708166..15708243,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15725982..15726051))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, isoform CRA_b"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT177644.1
FT                   protein_id=mCP100567.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q8BS74"
FT                   /db_xref="InterPro:IPR006888"
FT                   /db_xref="MGI:MGI:98976"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BS74"
FT                   /protein_id="EDL29138.1"
FT                   /translation="MENWDLSSDEMQDGNAPELDVIEEHNPVTRDDENANPEEVVGDTR
FT                   SPVQNILGKFEGDINKRLHIKRKRMETYIKDSFKDSNVKLEQLWKTNKQERKKINNKFC
FT                   EQYITTFQKFDMDVQKFNEEQEKSVNNYQKEQQALKLSKCSQSQTLEAIKDMHENYMEM
FT                   QKAELQLRSRGEDETSCPKEAETS"
FT   mRNA            complement(join(15713587..15714011,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15727471..15727559))
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, transcript variant mCT177645"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT177645.1
FT                   created on 10-JUN-2004"
FT   mRNA            complement(join(15713587..15714011,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15725982..15726059,15727471..15727559))
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, transcript variant mCT192579"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT192579.1
FT                   created on 10-JUN-2004"
FT   mRNA            complement(join(15713587..15714011,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15725982..15726107,15727471..15727559))
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, transcript variant mCT116220"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT116220.1
FT                   created on 10-JUN-2004"
FT   CDS             complement(join(15713871..15714011,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15725982..15726051))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, isoform CRA_a"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT116220.1
FT                   protein_id=mCP87614.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q544L6"
FT                   /db_xref="InterPro:IPR006888"
FT                   /db_xref="MGI:MGI:98976"
FT                   /db_xref="UniProtKB/TrEMBL:Q544L6"
FT                   /protein_id="EDL29137.1"
FT                   /translation="MENWDLSSDEMQDGNAPELDVIEEHNPVTRDDENANPEEVVGDTR
FT                   SPVQNILGKFEGDINKRLHIKRKRMETYIKDSFKDSNVKLEQLWKTNKQERKKINNKFC
FT                   EQYITTFQKFDMDVQKFNEEQEKSVNNYQKEQQALKLSKCSQSQTLEAIKDMHENYMEG
FT                   LMNLETNNYNMLFDVDGELRKEMSVFKKDLMKHTLKYSSSFPSSD"
FT   CDS             complement(join(15713871..15714011,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15725982..15726051))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, isoform CRA_a"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT192579.1
FT                   protein_id=mCP113530.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q544L6"
FT                   /db_xref="InterPro:IPR006888"
FT                   /db_xref="MGI:MGI:98976"
FT                   /db_xref="UniProtKB/TrEMBL:Q544L6"
FT                   /protein_id="EDL29140.1"
FT                   /translation="MENWDLSSDEMQDGNAPELDVIEEHNPVTRDDENANPEEVVGDTR
FT                   SPVQNILGKFEGDINKRLHIKRKRMETYIKDSFKDSNVKLEQLWKTNKQERKKINNKFC
FT                   EQYITTFQKFDMDVQKFNEEQEKSVNNYQKEQQALKLSKCSQSQTLEAIKDMHENYMEG
FT                   LMNLETNNYNMLFDVDGELRKEMSVFKKDLMKHTLKYSSSFPSSD"
FT   CDS             complement(join(15713871..15714011,15714331..15714429,
FT                   15716929..15717028,15717722..15717801))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, isoform CRA_c"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT177645.1
FT                   protein_id=mCP100566.1 isoform=CRA_c"
FT                   /protein_id="EDL29139.1"
FT                   /translation="METYIKDSFKDSNVKLEQLWKTNKQERKKINNKFCEQYITTFQKF
FT                   DMDVQKFNEEQEKSVNNYQKEQQALKLSKCSQSQTLEAIKDMHENYMEGLMNLETNNYN
FT                   MLFDVDGELRKEMSVFKKDLMKHTLKYSSSFPSSD"
FT   gene            complement(15746930..15751086)
FT                   /locus_tag="mCG_115115"
FT                   /note="gene_id=mCG115115.0"
FT   mRNA            complement(join(15746930..15747320,15747640..15747738,
FT                   15750172..15750271,15750962..15751086))
FT                   /locus_tag="mCG_115115"
FT                   /product="mCG115115"
FT                   /note="gene_id=mCG115115.0 transcript_id=mCT116215.0
FT                   created on 07-JAN-2003"
FT   CDS             complement(join(15747180..15747320,15747640..15747738,
FT                   15750172..15750271,15750962..15751041))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115115"
FT                   /product="mCG115115"
FT                   /note="gene_id=mCG115115.0 transcript_id=mCT116215.0
FT                   protein_id=mCP87598.1"
FT                   /protein_id="EDL29141.1"
FT                   /translation="METYIKDSFKDSNQKLEQLWKTNKQERRKINNKFCELYMTTFQKF
FT                   DMDVQKFNEEQEKSVNNYQKEQQALKLSKCSQSQTLEAIKDMHENYMEGLMNLETNNYN
FT                   MLFDVDGELRKEMSVFKKDLMKHTLKYSSSFPSSD"
FT   assembly_gap    3690..4534
FT                   /estimated_length=845
FT                   /gap_type="unknown"
FT   assembly_gap    6035..6577
FT                   /estimated_length=543
FT                   /gap_type="unknown"
FT   assembly_gap    7492..9118
FT                   /estimated_length=1627
FT                   /gap_type="unknown"
FT   assembly_gap    27278..28043
FT                   /estimated_length=766
FT                   /gap_type="unknown"
FT   assembly_gap    32349..32697
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    42718..43274
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    48053..57451
FT                   /estimated_length=9399
FT                   /gap_type="unknown"
FT   assembly_gap    58734..58753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    62063..63035
FT                   /estimated_length=973
FT                   /gap_type="unknown"
FT   assembly_gap    69800..70079
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    97130..97248
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    139019..150120
FT                   /estimated_length=11102
FT                   /gap_type="unknown"
FT   assembly_gap    165265..168430
FT                   /estimated_length=3166
FT                   /gap_type="unknown"
FT   assembly_gap    178125..178255
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    180572..181612
FT                   /estimated_length=1041
FT                   /gap_type="unknown"
FT   assembly_gap    182695..183140
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    188033..188052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    210171..216679
FT                   /estimated_length=6509
FT                   /gap_type="unknown"
FT   assembly_gap    219287..219455
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    222889..222929
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    240261..242508
FT                   /estimated_length=2248
FT                   /gap_type="unknown"
FT   assembly_gap    262622..262641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    279332..279351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    281379..281398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    283345..285749
FT                   /estimated_length=2405
FT                   /gap_type="unknown"
FT   assembly_gap    290961..291200
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    296922..296941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    300151..300170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    302371..302390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    322936..322955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    325337..326312
FT                   /estimated_length=976
FT                   /gap_type="unknown"
FT   assembly_gap    337592..337711
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    355039..355064
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    356130..356355
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    357437..358193
FT                   /estimated_length=757
FT                   /gap_type="unknown"
FT   assembly_gap    375616..375759
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    532641..535497
FT                   /estimated_length=2857
FT                   /gap_type="unknown"
FT   assembly_gap    538310..538911
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   assembly_gap    555950..556467
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   assembly_gap    664346..664688
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    748710..748769
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    862100..862119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    865561..865861
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    871129..871219
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    872837..872856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    874873..874892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    876183..876252
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    884736..884755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    898090..901026
FT                   /estimated_length=2937
FT                   /gap_type="unknown"
FT   assembly_gap    912413..915387
FT                   /estimated_length=2975
FT                   /gap_type="unknown"
FT   assembly_gap    926194..926338
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    963575..967392
FT                   /estimated_length=3818
FT                   /gap_type="unknown"
FT   assembly_gap    1007528..1007547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1009210..1009880
FT                   /estimated_length=671
FT                   /gap_type="unknown"
FT   assembly_gap    1017050..1020154
FT                   /estimated_length=3105
FT                   /gap_type="unknown"
FT   assembly_gap    1034660..1039821
FT                   /estimated_length=5162
FT                   /gap_type="unknown"
FT   assembly_gap    1052708..1053486
FT                   /estimated_length=779
FT                   /gap_type="unknown"
FT   assembly_gap    1058687..1058706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1060226..1060347
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    1071895..1072061
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    1073953..1074159
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    1081962..1084518
FT                   /estimated_length=2557
FT                   /gap_type="unknown"
FT   assembly_gap    1086925..1087544
FT                   /estimated_length=620
FT                   /gap_type="unknown"
FT   assembly_gap    1090006..1090025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1093198..1093476
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    1095793..1096123
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    1098801..1100773
FT                   /estimated_length=1973
FT                   /gap_type="unknown"
FT   assembly_gap    1112877..1113000
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    1138943..1138962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1164403..1164438
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    1165857..1166022
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    1169211..1169281
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    1171369..1171748
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    1175666..1175685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1180393..1180412
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1186244..1186263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1195821..1196369
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   assembly_gap    1202246..1202349
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    1220912..1220931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1226205..1227426
FT                   /estimated_length=1222
FT                   /gap_type="unknown"
FT   assembly_gap    1228961..1231221
FT                   /estimated_length=2261
FT                   /gap_type="unknown"
FT   assembly_gap    1238162..1240817
FT                   /estimated_length=2656
FT                   /gap_type="unknown"
FT   assembly_gap    1243815..1246054
FT                   /estimated_length=2240
FT                   /gap_type="unknown"
FT   assembly_gap    1269335..1269354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1273533..1273552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1278742..1278820
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    1297969..1297988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1303637..1303656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1311313..1311332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1315901..1318201
FT                   /estimated_length=2301
FT                   /gap_type="unknown"
FT   assembly_gap    1319694..1320556
FT                   /estimated_length=863
FT                   /gap_type="unknown"
FT   assembly_gap    1355675..1355694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1366504..1366714
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    1372215..1373171
FT                   /estimated_length=957
FT                   /gap_type="unknown"
FT   assembly_gap    1375184..1387471
FT                   /estimated_length=12288
FT                   /gap_type="unknown"
FT   assembly_gap    1397516..1402825
FT                   /estimated_length=5310
FT                   /gap_type="unknown"
FT   assembly_gap    1406252..1406783
FT                   /estimated_length=532
FT                   /gap_type="unknown"
FT   assembly_gap    1407855..1408210
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    1409354..1409373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1446592..1452796
FT                   /estimated_length=6205
FT                   /gap_type="unknown"
FT   assembly_gap    1454694..1455231
FT                   /estimated_length=538
FT                   /gap_type="unknown"
FT   assembly_gap    1457842..1458520
FT                   /estimated_length=679
FT                   /gap_type="unknown"
FT   assembly_gap    1463069..1463788
FT                   /estimated_length=720
FT                   /gap_type="unknown"
FT   assembly_gap    1472647..1473121
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   assembly_gap    1485102..1485121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1487340..1487707
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    1488873..1489025
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    1499182..1499201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1501068..1501341
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    1504013..1504240
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    1572718..1573856
FT                   /estimated_length=1139
FT                   /gap_type="unknown"
FT   assembly_gap    1576117..1576683
FT                   /estimated_length=567
FT                   /gap_type="unknown"
FT   assembly_gap    1584724..1584743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1587945..1587964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1591895..1602861
FT                   /estimated_length=10967
FT                   /gap_type="unknown"
FT   assembly_gap    1613883..1614078
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    1617503..1617522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1621429..1621476
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    1622715..1622787
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    1655691..1656391
FT                   /estimated_length=701
FT                   /gap_type="unknown"
FT   assembly_gap    1672125..1672804
FT                   /estimated_length=680
FT                   /gap_type="unknown"
FT   assembly_gap    1674178..1676655
FT                   /estimated_length=2478
FT                   /gap_type="unknown"
FT   assembly_gap    1680280..1680299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1689017..1689036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1699777..1699796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1725812..1726377
FT                   /estimated_length=566
FT                   /gap_type="unknown"
FT   assembly_gap    1731116..1732026
FT                   /estimated_length=911
FT                   /gap_type="unknown"
FT   assembly_gap    1733268..1735398
FT                   /estimated_length=2131
FT                   /gap_type="unknown"
FT   assembly_gap    1745860..1745879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1759554..1760827
FT                   /estimated_length=1274
FT                   /gap_type="unknown"
FT   assembly_gap    1769201..1769220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1775120..1775303
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    1788508..1789525
FT                   /estimated_length=1018
FT                   /gap_type="unknown"
FT   assembly_gap    1795515..1795639
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    1796028..1796313
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    1810783..1810950
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    1813611..1813879
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    1817431..1817450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1818829..1818988
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    1822078..1822303
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    1824285..1824447
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    1826197..1831121
FT                   /estimated_length=4925
FT                   /gap_type="unknown"
FT   assembly_gap    1833879..1834280
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    1848208..1848651
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    1872003..1872022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1883277..1883296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1890778..1899660
FT                   /estimated_length=8883
FT                   /gap_type="unknown"
FT   assembly_gap    1901652..1902133
FT                   /estimated_length=482
FT                   /gap_type="unknown"
FT   assembly_gap    1903259..1904114
FT                   /estimated_length=856
FT                   /gap_type="unknown"
FT   assembly_gap    1911330..1911349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1914069..1914088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1925215..1925234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1930056..1930075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1957351..1957370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1959352..1960002
FT                   /estimated_length=651
FT                   /gap_type="unknown"
FT   assembly_gap    1969713..1969732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1976462..1976865
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    1994415..1994434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2005503..2005577
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    2011257..2011276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2019923..2020342
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    2025323..2026816
FT                   /estimated_length=1494
FT                   /gap_type="unknown"
FT   assembly_gap    2028252..2029047
FT                   /estimated_length=796
FT                   /gap_type="unknown"
FT   assembly_gap    2032268..2032804
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    2034344..2035835
FT                   /estimated_length=1492
FT                   /gap_type="unknown"
FT   assembly_gap    2039365..2039384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2060098..2060454
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   assembly_gap    2061570..2061780
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    2080817..2080836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2108944..2108963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2116120..2116139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2150619..2150638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2154249..2159034
FT                   /estimated_length=4786
FT                   /gap_type="unknown"
FT   assembly_gap    2160309..2160341
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    2163225..2163687
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   assembly_gap    2166527..2166657
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    2176788..2176807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2184618..2184688
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    2185676..2185917
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    2188646..2188728
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    2194316..2194463
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    2208381..2208487
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    2229413..2229432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2236019..2236038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2239128..2239147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2242137..2244345
FT                   /estimated_length=2209
FT                   /gap_type="unknown"
FT   assembly_gap    2245165..2245345
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    2253746..2253765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2259183..2260511
FT                   /estimated_length=1329
FT                   /gap_type="unknown"
FT   assembly_gap    2262242..2263486
FT                   /estimated_length=1245
FT                   /gap_type="unknown"
FT   assembly_gap    2270429..2270448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2278262..2278785
FT                   /estimated_length=524
FT                   /gap_type="unknown"
FT   assembly_gap    2283776..2283988
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    2287123..2287172
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    2297660..2297679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2299350..2299369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2300490..2300509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2303817..2304451
FT                   /estimated_length=635
FT                   /gap_type="unknown"
FT   assembly_gap    2308562..2309047
FT                   /estimated_length=486
FT                   /gap_type="unknown"
FT   assembly_gap    2324836..2324988
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    2328588..2328783
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    2332042..2336738
FT                   /estimated_length=4697
FT                   /gap_type="unknown"
FT   assembly_gap    2339138..2339419
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    2341515..2341534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2345829..2345848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2360861..2362123
FT                   /estimated_length=1263
FT                   /gap_type="unknown"
FT   assembly_gap    2368139..2368158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2381302..2381370
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    2388900..2388919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2400327..2401706
FT                   /estimated_length=1380
FT                   /gap_type="unknown"
FT   assembly_gap    2421579..2421598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2425692..2425711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2427765..2428200
FT                   /estimated_length=436
FT                   /gap_type="unknown"
FT   assembly_gap    2431743..2431840
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    2432790..2432993
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    2455070..2456940
FT                   /estimated_length=1871
FT                   /gap_type="unknown"
FT   assembly_gap    2463425..2463444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2470138..2470157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2482200..2482311
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    2489662..2489681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2496982..2497313
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    2503615..2504146
FT                   /estimated_length=532
FT                   /gap_type="unknown"
FT   assembly_gap    2508252..2508271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2509957..2509993
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    2514337..2525123
FT                   /estimated_length=10787
FT                   /gap_type="unknown"
FT   assembly_gap    2537323..2537568
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    2556056..2556369
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    2561404..2561469
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    2574407..2574896
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    2578856..2579752
FT                   /estimated_length=897
FT                   /gap_type="unknown"
FT   assembly_gap    2587577..2587635
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    2617855..2618212
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    2648247..2648325
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    2652556..2652575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2654233..2654345
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    2662321..2662376
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    2664407..2664426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2686753..2689251
FT                   /estimated_length=2499
FT                   /gap_type="unknown"
FT   assembly_gap    2718895..2719261
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    2733937..2733956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2737000..2738875
FT                   /estimated_length=1876
FT                   /gap_type="unknown"
FT   assembly_gap    2745805..2746953
FT                   /estimated_length=1149
FT                   /gap_type="unknown"
FT   assembly_gap    2757971..2758180
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    2759019..2759359
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    2768846..2769541
FT                   /estimated_length=696
FT                   /gap_type="unknown"
FT   assembly_gap    2790015..2790134
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    2796084..2796216
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    2801595..2801614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2808406..2808425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2817070..2817168
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    2820767..2820786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2832556..2832575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2834723..2835187
FT                   /estimated_length=465
FT                   /gap_type="unknown"
FT   assembly_gap    2836007..2836578
FT                   /estimated_length=572
FT                   /gap_type="unknown"
FT   assembly_gap    2838629..2845102
FT                   /estimated_length=6474
FT                   /gap_type="unknown"
FT   assembly_gap    2871796..2871837
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    2893582..2893601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2923477..2923496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2926183..2926202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2933874..2933893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2966223..2966861
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   assembly_gap    2967752..2968173
FT                   /estimated_length=422
FT                   /gap_type="unknown"
FT   assembly_gap    2970802..2970868
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    2981009..2981033
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    2990742..2990927
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    2994159..2994178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3023022..3023157
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    3040582..3046599
FT                   /estimated_length=6018
FT                   /gap_type="unknown"
FT   assembly_gap    3058439..3058458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3065169..3065284
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    3070123..3070194
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    3074376..3077591
FT                   /estimated_length=3216
FT                   /gap_type="unknown"
FT   assembly_gap    3079673..3080036
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    3086545..3086564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3099290..3099309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3113877..3113943
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    3124782..3125031
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    3130704..3130723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3146620..3146639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3147906..3148067
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    3154092..3154111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3160304..3160323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3164924..3166212
FT                   /estimated_length=1289
FT                   /gap_type="unknown"
FT   assembly_gap    3169629..3169759
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    3174547..3174621
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    3182130..3182149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3183716..3183749
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    3185156..3185175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3191525..3197618
FT                   /estimated_length=6094
FT                   /gap_type="unknown"
FT   assembly_gap    3202533..3202932
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   assembly_gap    3210467..3210558
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    3224562..3224581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3228004..3228143
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    3228931..3229112
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    3242484..3242503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3243276..3243475
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    3245095..3245117
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    3287123..3287142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3290934..3291176
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    3295364..3297329
FT                   /estimated_length=1966
FT                   /gap_type="unknown"
FT   assembly_gap    3306575..3306768
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    3328871..3330119
FT                   /estimated_length=1249
FT                   /gap_type="unknown"
FT   assembly_gap    3336088..3336107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3337689..3337866
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    3350993..3351012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3355748..3355916
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    3364057..3364076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3368739..3369342
FT                   /estimated_length=604
FT                   /gap_type="unknown"
FT   assembly_gap    3374812..3378113
FT                   /estimated_length=3302
FT                   /gap_type="unknown"
FT   assembly_gap    3381447..3384022
FT                   /estimated_length=2576
FT                   /gap_type="unknown"
FT   assembly_gap    3389487..3389506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3391521..3392073
FT                   /estimated_length=553
FT                   /gap_type="unknown"
FT   assembly_gap    3394386..3394405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3406221..3406240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3421666..3421685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3427449..3428882
FT                   /estimated_length=1434
FT                   /gap_type="unknown"
FT   assembly_gap    3440792..3440895
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    3459526..3459616
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    3479145..3479164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3480398..3480417
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3494393..3501814
FT                   /estimated_length=7422
FT                   /gap_type="unknown"
FT   assembly_gap    3565366..3565385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3588432..3588538
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    3615157..3615176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3616644..3616663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3650996..3651310
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    3653096..3653167
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    3662223..3662397
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    3663628..3664117
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    3666500..3667394
FT                   /estimated_length=895
FT                   /gap_type="unknown"
FT   assembly_gap    3669982..3670001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3674944..3679757
FT                   /estimated_length=4814
FT                   /gap_type="unknown"
FT   assembly_gap    3681803..3682928
FT                   /estimated_length=1126
FT                   /gap_type="unknown"
FT   assembly_gap    3688426..3688523
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    3692507..3692648
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    3713931..3714026
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    3733413..3733783
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    3740849..3741498
FT                   /estimated_length=650
FT                   /gap_type="unknown"
FT   assembly_gap    3809444..3809463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3814996..3815015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3816934..3816953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3819002..3819422
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   assembly_gap    3820164..3820296
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    3822311..3822656
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    3825207..3825494
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    3828196..3832553
FT                   /estimated_length=4358
FT                   /gap_type="unknown"
FT   assembly_gap    3836424..3837300
FT                   /estimated_length=877
FT                   /gap_type="unknown"
FT   assembly_gap    3842080..3842348
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    3852186..3852315
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    3864140..3864748
FT                   /estimated_length=609
FT                   /gap_type="unknown"
FT   assembly_gap    3875659..3875727
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    3888384..3894029
FT                   /estimated_length=5646
FT                   /gap_type="unknown"
FT   assembly_gap    3898751..3898967
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    3900886..3900905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3913884..3913903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3926359..3926378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3930582..3937939
FT                   /estimated_length=7358
FT                   /gap_type="unknown"
FT   assembly_gap    3943144..3944195
FT                   /estimated_length=1052
FT                   /gap_type="unknown"
FT   assembly_gap    3945280..3945608
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    3952715..3952734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3957291..3957373
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    3960531..3963919
FT                   /estimated_length=3389
FT                   /gap_type="unknown"
FT   assembly_gap    3970444..3970463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3977297..3977334
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    3986425..3986639
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    3992145..3992358
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    3993859..3994010
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    3996821..3996938
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    3998820..3999856
FT                   /estimated_length=1037
FT                   /gap_type="unknown"
FT   assembly_gap    4003896..4003935
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    4008143..4008272
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    4010727..4010765
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    4015262..4015575
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    4024219..4025001
FT                   /estimated_length=783
FT                   /gap_type="unknown"
FT   assembly_gap    4028711..4028742
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    4039613..4039632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4127826..4127845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4193632..4193671
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    4204987..4205321
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    4206680..4206699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4208600..4208619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4211707..4212274
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   assembly_gap    4213570..4213934
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    4218938..4218992
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    4222650..4222979
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    4230136..4230288
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    4238562..4239193
FT                   /estimated_length=632
FT                   /gap_type="unknown"
FT   assembly_gap    4244650..4244669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4247437..4247621
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    4248012..4248084
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    4264652..4264893
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    4273284..4273303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4275459..4275501
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    4299672..4299691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4301753..4301772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4305006..4305109
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    4326175..4326194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4328704..4328939
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    4329450..4330520
FT                   /estimated_length=1071
FT                   /gap_type="unknown"
FT   assembly_gap    4335243..4335627
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    4340831..4341620
FT                   /estimated_length=790
FT                   /gap_type="unknown"
FT   assembly_gap    4360585..4360604
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4363681..4363700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4384954..4384973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4386880..4386912
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    4411402..4411647
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    4413361..4414266
FT                   /estimated_length=906
FT                   /gap_type="unknown"
FT   assembly_gap    4418248..4418586
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    4428979..4429144
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    4451049..4451068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4453174..4453754
FT                   /estimated_length=581
FT                   /gap_type="unknown"
FT   assembly_gap    4464160..4464179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4475874..4476014
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    4478923..4483184
FT                   /estimated_length=4262
FT                   /gap_type="unknown"
FT   assembly_gap    4495554..4495637
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    4499863..4500113
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    4508032..4510268
FT                   /estimated_length=2237
FT                   /gap_type="unknown"
FT   assembly_gap    4512046..4512065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4521722..4521741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4523068..4523469
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    4528072..4528441
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    4533574..4533593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4537616..4537635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4550311..4550330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4555593..4555708
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    4558166..4558185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4577336..4579094
FT                   /estimated_length=1759
FT                   /gap_type="unknown"
FT   assembly_gap    4580135..4580651
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    4589803..4589822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4593524..4593714
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    4595099..4595118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4600795..4601441
FT                   /estimated_length=647
FT                   /gap_type="unknown"
FT   assembly_gap    4604611..4604792
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    4626129..4627079
FT                   /estimated_length=951
FT                   /gap_type="unknown"
FT   assembly_gap    4670080..4670240
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    4671749..4672166
FT                   /estimated_length=418
FT                   /gap_type="unknown"
FT   assembly_gap    4675037..4675217
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    4680167..4680323
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    4745085..4747953
FT                   /estimated_length=2869
FT                   /gap_type="unknown"
FT   assembly_gap    4811357..4816825
FT                   /estimated_length=5469
FT                   /gap_type="unknown"
FT   assembly_gap    4863488..4863511
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    4886143..4886162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4937249..4937268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5001799..5001818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5031915..5031934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5037845..5037864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5047052..5047129
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    5053918..5054056
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    5069582..5070612
FT                   /estimated_length=1031
FT                   /gap_type="unknown"
FT   assembly_gap    5086201..5086220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5088126..5091729
FT                   /estimated_length=3604
FT                   /gap_type="unknown"
FT   assembly_gap    5186953..5186972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5221452..5221471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5240604..5240623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5248405..5248424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5300969..5300988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5332657..5332676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5365432..5365451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5376352..5376371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5458974..5460441
FT                   /estimated_length=1468
FT                   /gap_type="unknown"
FT   assembly_gap    5469432..5469451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5470716..5470735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5474955..5474974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5481073..5481092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5482649..5483404
FT                   /estimated_length=756
FT                   /gap_type="unknown"
FT   assembly_gap    5502236..5502347
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    5507936..5507955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5551241..5551334
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    5598843..5598862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5618454..5619413
FT                   /estimated_length=960
FT                   /gap_type="unknown"
FT   assembly_gap    5621427..5621446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5628115..5629289
FT                   /estimated_length=1175
FT                   /gap_type="unknown"
FT   assembly_gap    5630457..5630817
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    5643137..5643192
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    5655623..5655642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5659460..5659479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5660242..5661247
FT                   /estimated_length=1006
FT                   /gap_type="unknown"
FT   assembly_gap    5662327..5662492
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    5666951..5666970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5696743..5696832
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    5701861..5701880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5704556..5704836
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    5710706..5710825
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    5735850..5735869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5737264..5737394
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    5738265..5738284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5740666..5741217
FT                   /estimated_length=552
FT                   /gap_type="unknown"
FT   assembly_gap    5767165..5767677
FT                   /estimated_length=513
FT                   /gap_type="unknown"
FT   assembly_gap    5770019..5774529
FT                   /estimated_length=4511
FT                   /gap_type="unknown"
FT   assembly_gap    5777126..5777365
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    5798384..5800631
FT                   /estimated_length=2248
FT                   /gap_type="unknown"
FT   assembly_gap    5803308..5804474
FT                   /estimated_length=1167
FT                   /gap_type="unknown"
FT   assembly_gap    5816573..5822297
FT                   /estimated_length=5725
FT                   /gap_type="unknown"
FT   assembly_gap    5825567..5825586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5834718..5834737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5840917..5841452
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    5853863..5853882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5857896..5857915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5859841..5860539
FT                   /estimated_length=699
FT                   /gap_type="unknown"
FT   assembly_gap    5874843..5875370
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    5888584..5888622
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    5890637..5890656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5902824..5902998
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    5910476..5913142
FT                   /estimated_length=2667
FT                   /gap_type="unknown"
FT   assembly_gap    5917262..5917281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5923908..5924054
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    5927230..5927353
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    5928774..5928793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5933236..5933395
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    5949631..5949650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5986368..5986586
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    5997850..5997895
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    6004129..6004192
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    6006552..6006571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6008189..6008208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6045173..6045192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6047714..6048198
FT                   /estimated_length=485
FT                   /gap_type="unknown"
FT   assembly_gap    6049445..6049491
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    6091796..6092547
FT                   /estimated_length=752
FT                   /gap_type="unknown"
FT   assembly_gap    6099402..6099548
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    6101581..6102075
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    6112231..6112250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6132220..6132377
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    6149807..6153187
FT                   /estimated_length=3381
FT                   /gap_type="unknown"
FT   assembly_gap    6154786..6156905
FT                   /estimated_length=2120
FT                   /gap_type="unknown"
FT   assembly_gap    6158329..6160343
FT                   /estimated_length=2015
FT                   /gap_type="unknown"
FT   assembly_gap    6163355..6163838
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   assembly_gap    6165018..6165902
FT                   /estimated_length=885
FT                   /gap_type="unknown"
FT   assembly_gap    6173073..6173265
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    6176966..6177152
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    6185507..6190106
FT                   /estimated_length=4600
FT                   /gap_type="unknown"
FT   assembly_gap    6191402..6192432
FT                   /estimated_length=1031
FT                   /gap_type="unknown"
FT   assembly_gap    6199377..6199449
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    6214713..6214732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6231084..6231103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6239703..6239729
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    6240685..6241180
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   assembly_gap    6242516..6242610
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    6245526..6245966
FT                   /estimated_length=441
FT                   /gap_type="unknown"
FT   assembly_gap    6248598..6248617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6254495..6255252
FT                   /estimated_length=758
FT                   /gap_type="unknown"
FT   assembly_gap    6256295..6257066
FT                   /estimated_length=772
FT                   /gap_type="unknown"
FT   assembly_gap    6259407..6259426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6261247..6261266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6264478..6264497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6268691..6268842
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    6282379..6282464
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    6284096..6284115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6291630..6292756
FT                   /estimated_length=1127
FT                   /gap_type="unknown"
FT   assembly_gap    6308243..6308271
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    6312104..6312169
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    6316990..6317009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6335588..6341791
FT                   /estimated_length=6204
FT                   /gap_type="unknown"
FT   assembly_gap    6342533..6342816
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    6345381..6345400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6356834..6356853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6374319..6378987
FT                   /estimated_length=4669
FT                   /gap_type="unknown"
FT   assembly_gap    6385997..6388596
FT                   /estimated_length=2600
FT                   /gap_type="unknown"
FT   assembly_gap    6401302..6401677
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    6402682..6404209
FT                   /estimated_length=1528
FT                   /gap_type="unknown"
FT   assembly_gap    6405794..6406847
FT                   /estimated_length=1054
FT                   /gap_type="unknown"
FT   assembly_gap    6412943..6413131
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    6416768..6417767
FT                   /estimated_length=1000
FT                   /gap_type="unknown"
FT   assembly_gap    6424669..6427244
FT                   /estimated_length=2576
FT                   /gap_type="unknown"
FT   assembly_gap    6429117..6429136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6434009..6434028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6436588..6436946
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    6437784..6437882
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    6458925..6458944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6483326..6483345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6521741..6521891
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    6526690..6531700
FT                   /estimated_length=5011
FT                   /gap_type="unknown"
FT   assembly_gap    6544519..6545169
FT                   /estimated_length=651
FT                   /gap_type="unknown"
FT   assembly_gap    6547841..6547860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6560942..6561617
FT                   /estimated_length=676
FT                   /gap_type="unknown"
FT   assembly_gap    6564964..6565100
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    6572183..6572278
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    6575201..6577165
FT                   /estimated_length=1965
FT                   /gap_type="unknown"
FT   assembly_gap    6599171..6599755
FT                   /estimated_length=585
FT                   /gap_type="unknown"
FT   assembly_gap    6610668..6611614
FT                   /estimated_length=947
FT                   /gap_type="unknown"
FT   assembly_gap    6614119..6614138
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6615222..6620548
FT                   /estimated_length=5327
FT                   /gap_type="unknown"
FT   assembly_gap    6625866..6625991
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    6634490..6638592
FT                   /estimated_length=4103
FT                   /gap_type="unknown"
FT   assembly_gap    6644118..6644137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6645483..6645502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6647470..6647489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6649040..6649148
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    6654616..6654635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6659262..6664646
FT                   /estimated_length=5385
FT                   /gap_type="unknown"
FT   assembly_gap    6668318..6668337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6675811..6675830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6687397..6687416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6705356..6706939
FT                   /estimated_length=1584
FT                   /gap_type="unknown"
FT   assembly_gap    6711938..6712454
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    6713886..6713905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6716278..6716297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6723552..6723583
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    6724884..6724903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6731578..6731621
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    6733985..6734004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6735594..6738384
FT                   /estimated_length=2791
FT                   /gap_type="unknown"
FT   assembly_gap    6746083..6746102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6753774..6754227
FT                   /estimated_length=454
FT                   /gap_type="unknown"
FT   assembly_gap    6759644..6759710
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    6774423..6775659
FT                   /estimated_length=1237
FT                   /gap_type="unknown"
FT   assembly_gap    6779800..6779819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6780901..6781546
FT                   /estimated_length=646
FT                   /gap_type="unknown"
FT   assembly_gap    6782854..6782990
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    6786459..6786606
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    6797299..6807317
FT                   /estimated_length=10019
FT                   /gap_type="unknown"
FT   assembly_gap    6830937..6830962
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    6849945..6849964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6856218..6856237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6873051..6873070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6874439..6881024
FT                   /estimated_length=6586
FT                   /gap_type="unknown"
FT   assembly_gap    6912522..6912751
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    6923843..6924628
FT                   /estimated_length=786
FT                   /gap_type="unknown"
FT   assembly_gap    6934859..6935260
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    6939121..6939459
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    6943970..6944336
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    6957299..6957318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6965975..6966178
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    6972672..6973852
FT                   /estimated_length=1181
FT                   /gap_type="unknown"
FT   assembly_gap    6985501..6985527
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    7008326..7008477
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    7010867..7011259
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    7013338..7014247
FT                   /estimated_length=910
FT                   /gap_type="unknown"
FT   assembly_gap    7024819..7024838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7061261..7061509
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    7065712..7066246
FT                   /estimated_length=535
FT                   /gap_type="unknown"
FT   assembly_gap    7071509..7071528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7072554..7072671
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    7080092..7080166
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    7088716..7088735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7099791..7099810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7103744..7103763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7135676..7136105
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    7139963..7139982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7152907..7159878
FT                   /estimated_length=6972
FT                   /gap_type="unknown"
FT   assembly_gap    7162932..7162966
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    7176806..7177066
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    7191720..7192275
FT                   /estimated_length=556
FT                   /gap_type="unknown"
FT   assembly_gap    7201273..7201292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7202538..7202557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7204002..7204021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7222479..7222498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7223560..7223642
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    7244763..7244965
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    7246671..7247789
FT                   /estimated_length=1119
FT                   /gap_type="unknown"
FT   assembly_gap    7259828..7260234
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    7263136..7263155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7264560..7264579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7271683..7271995
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    7272654..7272673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7286677..7286696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7307685..7308699
FT                   /estimated_length=1015
FT                   /gap_type="unknown"
FT   assembly_gap    7319782..7319801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7322297..7322416
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    7343604..7343623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7345737..7345813
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    7346861..7347143
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    7350816..7350993
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    7353074..7353621
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    7356564..7357417
FT                   /estimated_length=854
FT                   /gap_type="unknown"
FT   assembly_gap    7360153..7360331
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    7366819..7383706
FT                   /estimated_length=16888
FT                   /gap_type="unknown"
FT   assembly_gap    7392246..7399363
FT                   /estimated_length=7118
FT                   /gap_type="unknown"
FT   assembly_gap    7401452..7401471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7414513..7414532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7447863..7447882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7450686..7450855
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    7455100..7455153
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    7464455..7464484
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    7484175..7484194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7500831..7500858
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    7511910..7518548
FT                   /estimated_length=6639
FT                   /gap_type="unknown"
FT   assembly_gap    7521024..7521145
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    7522131..7522343
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    7547003..7547111
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    7566408..7566427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7589550..7589710
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    7606172..7606788
FT                   /estimated_length=617
FT                   /gap_type="unknown"
FT   assembly_gap    7609770..7609789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7623239..7623379
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    7625158..7625177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7639038..7639079
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    7642459..7643239
FT                   /estimated_length=781
FT                   /gap_type="unknown"
FT   assembly_gap    7646631..7647353
FT                   /estimated_length=723
FT                   /gap_type="unknown"
FT   assembly_gap    7648646..7648665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7656565..7656739
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    7662361..7662380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7667225..7667266
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    7669480..7670243
FT                   /estimated_length=764
FT                   /gap_type="unknown"
FT   assembly_gap    7672571..7673818
FT                   /estimated_length=1248
FT                   /gap_type="unknown"
FT   assembly_gap    7697189..7697208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7703357..7703549
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    7737401..7737420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7739858..7739951
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    7759403..7764093
FT                   /estimated_length=4691
FT                   /gap_type="unknown"
FT   assembly_gap    7772760..7772825
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    7774174..7774524
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    7776663..7783006
FT                   /estimated_length=6344
FT                   /gap_type="unknown"
FT   assembly_gap    7789530..7789549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7791595..7791614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7794233..7794252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7796555..7796985
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    7798510..7801557
FT                   /estimated_length=3048
FT                   /gap_type="unknown"
FT   assembly_gap    7803971..7804466
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   assembly_gap    7825499..7825518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7830077..7830185
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    7832153..7832363
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    7837855..7837874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7839448..7839520
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    7849687..7849706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7851649..7851791
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    7852338..7852357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7892133..7892308
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    7899718..7899737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7915806..7915825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7922821..7922840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7935219..7935238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7951460..7951479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7958895..7959619
FT                   /estimated_length=725
FT                   /gap_type="unknown"
FT   assembly_gap    7967603..7967622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7968521..7969395
FT                   /estimated_length=875
FT                   /gap_type="unknown"
FT   assembly_gap    7976607..7976814
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    8000821..8000840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8013151..8013357
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    8014579..8014598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8017933..8017952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8024818..8024837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8041940..8041959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8049690..8049709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8053744..8053901
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    8057295..8058582
FT                   /estimated_length=1288
FT                   /gap_type="unknown"
FT   assembly_gap    8067424..8067611
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    8070974..8070993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8090804..8091014
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    8092324..8092343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8094641..8094660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8098201..8098220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8099267..8099286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8100793..8103603
FT                   /estimated_length=2811
FT                   /gap_type="unknown"
FT   assembly_gap    8107798..8107885
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    8137254..8138274
FT                   /estimated_length=1021
FT                   /gap_type="unknown"
FT   assembly_gap    8146760..8146779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8148311..8150208
FT                   /estimated_length=1898
FT                   /gap_type="unknown"
FT   assembly_gap    8152085..8152129
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    8165842..8166061
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    8175599..8175618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8189464..8189483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8192148..8192223
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    8212549..8212568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8223399..8223418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8241236..8241571
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    8242919..8242938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8256817..8256836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8267755..8267774
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8270971..8271303
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    8278831..8278850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8301889..8301947
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    8309468..8309650
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    8328234..8328341
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    8339148..8339176
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    8343867..8343958
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    8347906..8347925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8349957..8350738
FT                   /estimated_length=782
FT                   /gap_type="unknown"
FT   assembly_gap    8351864..8359996
FT                   /estimated_length=8133
FT                   /gap_type="unknown"
FT   assembly_gap    8383207..8383226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8403818..8408855
FT                   /estimated_length=5038
FT                   /gap_type="unknown"
FT   assembly_gap    8419200..8419629
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    8423608..8423840
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    8440239..8443472
FT                   /estimated_length=3234
FT                   /gap_type="unknown"
FT   assembly_gap    8445373..8445839
FT                   /estimated_length=467
FT                   /gap_type="unknown"
FT   assembly_gap    8448948..8448967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8458094..8458317
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    8463900..8464035
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    8493131..8493150
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8499839..8499858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8507347..8507366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8514704..8514723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8569281..8569300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8587972..8592110
FT                   /estimated_length=4139
FT                   /gap_type="unknown"
FT   assembly_gap    8595563..8595582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8615721..8615740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8623398..8623417
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8628425..8628469
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    8633096..8633115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8653954..8655504
FT                   /estimated_length=1551
FT                   /gap_type="unknown"
FT   assembly_gap    8658126..8660696
FT                   /estimated_length=2571
FT                   /gap_type="unknown"
FT   assembly_gap    8662611..8662630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8665854..8665873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8673098..8673117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8674293..8674312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8687221..8687550
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    8695751..8695770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8697192..8697211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8701895..8701990
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    8703454..8703473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8743405..8743524
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    8750177..8750196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8756119..8756301
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    8757151..8759856
FT                   /estimated_length=2706
FT                   /gap_type="unknown"
FT   assembly_gap    8761192..8761292
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    8769838..8769857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8773370..8773511
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    8789960..8790033
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    8794936..8794955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8807341..8807360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8807983..8808376
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    8815411..8815430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8819496..8819515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8827150..8828247
FT                   /estimated_length=1098
FT                   /gap_type="unknown"
FT   assembly_gap    8847583..8847783
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    8873097..8873116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8881537..8881556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8887340..8887359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8893473..8893535
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    8899021..8899040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8901468..8901487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8911197..8913133
FT                   /estimated_length=1937
FT                   /gap_type="unknown"
FT   assembly_gap    8913942..8914037
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    8922478..8922497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8924102..8924121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8931366..8935456
FT                   /estimated_length=4091
FT                   /gap_type="unknown"
FT   assembly_gap    8948625..8949033
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    8950443..8952316
FT                   /estimated_length=1874
FT                   /gap_type="unknown"
FT   assembly_gap    8960017..8960036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8979966..8979985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8981217..8981236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9044920..9044939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9049866..9049885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9051589..9051608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9053522..9054186
FT                   /estimated_length=665
FT                   /gap_type="unknown"
FT   assembly_gap    9056105..9056498
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    9068417..9069110
FT                   /estimated_length=694
FT                   /gap_type="unknown"
FT   assembly_gap    9083628..9083647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9099999..9100018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9109043..9114048
FT                   /estimated_length=5006
FT                   /gap_type="unknown"
FT   assembly_gap    9121006..9122039
FT                   /estimated_length=1034
FT                   /gap_type="unknown"
FT   assembly_gap    9124982..9125873
FT                   /estimated_length=892
FT                   /gap_type="unknown"
FT   assembly_gap    9126739..9126892
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    9129564..9129583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9147064..9147083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9159427..9159473
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    9164534..9164952
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    9173024..9173043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9183374..9183393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9189291..9189310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9203169..9203282
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    9207291..9207310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9212465..9212484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9217918..9217937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9223249..9223495
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    9229287..9229306
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9245208..9247366
FT                   /estimated_length=2159
FT                   /gap_type="unknown"
FT   assembly_gap    9248516..9249246
FT                   /estimated_length=731
FT                   /gap_type="unknown"
FT   assembly_gap    9258153..9258172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9261402..9268097
FT                   /estimated_length=6696
FT                   /gap_type="unknown"
FT   assembly_gap    9271460..9271636
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    9279360..9279502
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    9283364..9283383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9285685..9285704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9293551..9293646
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    9322032..9322220
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    9324773..9325596
FT                   /estimated_length=824
FT                   /gap_type="unknown"
FT   assembly_gap    9329664..9330478
FT                   /estimated_length=815
FT                   /gap_type="unknown"
FT   assembly_gap    9339385..9339404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9364999..9365018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9400170..9400394
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    9406073..9406105
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    9407007..9407432
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    9413181..9413595
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    9423301..9423359
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    9467040..9467161
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    9473518..9473537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9475832..9475857
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    9478776..9478795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9481230..9481651
FT                   /estimated_length=422
FT                   /gap_type="unknown"
FT   assembly_gap    9484525..9490686
FT                   /estimated_length=6162
FT                   /gap_type="unknown"
FT   assembly_gap    9505080..9505099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9524492..9524668
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    9539548..9539994
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   assembly_gap    9540833..9540852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9542055..9542690
FT                   /estimated_length=636
FT                   /gap_type="unknown"
FT   assembly_gap    9545518..9545537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9547791..9548305
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   assembly_gap    9549108..9552308
FT                   /estimated_length=3201
FT                   /gap_type="unknown"
FT   assembly_gap    9561080..9561498
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    9564444..9564463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9573406..9573425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9576465..9576484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9616505..9616524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9629916..9629935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9631448..9631467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9645738..9646236
FT                   /estimated_length=499
FT                   /gap_type="unknown"
FT   assembly_gap    9650753..9650846
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    9664236..9664255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9670932..9670951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9672623..9672777
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    9674316..9675390
FT                   /estimated_length=1075
FT                   /gap_type="unknown"
FT   assembly_gap    9677020..9677616
FT                   /estimated_length=597
FT                   /gap_type="unknown"
FT   assembly_gap    9679891..9679910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9683159..9683178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9695533..9695552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9702156..9702175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9707006..9707101
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    9712496..9712859
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    9743031..9743109
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    9748750..9749136
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   assembly_gap    9753508..9753527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9768553..9768572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9777482..9777501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9782347..9782789
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    9810020..9810039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9812362..9812868
FT                   /estimated_length=507
FT                   /gap_type="unknown"
FT   assembly_gap    9849205..9849324
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    9856735..9856754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9857938..9858189
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    9860314..9860626
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    9880504..9882644
FT                   /estimated_length=2141
FT                   /gap_type="unknown"
FT   assembly_gap    9887857..9887876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9902964..9906739
FT                   /estimated_length=3776
FT                   /gap_type="unknown"
FT   assembly_gap    9940433..9940452
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9961250..9961430
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    9974960..9975447
FT                   /estimated_length=488
FT                   /gap_type="unknown"
FT   assembly_gap    9977374..9977393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9987864..9988387
FT                   /estimated_length=524
FT                   /gap_type="unknown"
FT   assembly_gap    9998152..9998328
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    10016642..10017380
FT                   /estimated_length=739
FT                   /gap_type="unknown"
FT   assembly_gap    10018467..10018486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10024379..10024580
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    10030764..10031126
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    10054278..10054297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10074778..10075422
FT                   /estimated_length=645
FT                   /gap_type="unknown"
FT   assembly_gap    10083766..10083785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10103155..10103419
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    10141453..10141472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10145999..10146325
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    10167293..10167312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10201765..10202153
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    10235493..10235512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10241627..10241646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10254152..10254210
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    10269374..10269393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10278315..10278427
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    10286565..10286584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10288851..10289126
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    10290705..10290724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10297189..10297371
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    10310092..10310111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10330307..10330485
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    10338319..10338338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10340537..10340639
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    10350410..10350609
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    10353334..10353353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10358774..10358793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10366405..10366437
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    10368791..10368810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10370896..10371102
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    10373584..10373607
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    10378727..10378746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10381902..10381943
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    10389072..10389253
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    10390215..10391064
FT                   /estimated_length=850
FT                   /gap_type="unknown"
FT   assembly_gap    10393818..10397939
FT                   /estimated_length=4122
FT                   /gap_type="unknown"
FT   assembly_gap    10407053..10407404
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    10410825..10410844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10412899..10412918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10421234..10421399
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    10428015..10429129
FT                   /estimated_length=1115
FT                   /gap_type="unknown"
FT   assembly_gap    10430868..10431021
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    10432185..10432956
FT                   /estimated_length=772
FT                   /gap_type="unknown"
FT   assembly_gap    10439463..10440101
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   assembly_gap    10441215..10442265
FT                   /estimated_length=1051
FT                   /gap_type="unknown"
FT   assembly_gap    10446513..10447141
FT                   /estimated_length=629
FT                   /gap_type="unknown"
FT   assembly_gap    10450585..10451098
FT                   /estimated_length=514
FT                   /gap_type="unknown"
FT   assembly_gap    10456922..10456957
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    10464701..10465437
FT                   /estimated_length=737
FT                   /gap_type="unknown"
FT   assembly_gap    10478796..10478815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10493967..10493986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10509931..10509950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10516405..10516733
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    10519889..10520093
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    10525218..10525858
FT                   /estimated_length=641
FT                   /gap_type="unknown"
FT   assembly_gap    10531936..10531955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10551306..10551325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10553782..10554830
FT                   /estimated_length=1049
FT                   /gap_type="unknown"
FT   assembly_gap    10557426..10557445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10559197..10560380
FT                   /estimated_length=1184
FT                   /gap_type="unknown"
FT   assembly_gap    10566177..10566321
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    10568754..10568773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10569548..10570455
FT                   /estimated_length=908
FT                   /gap_type="unknown"
FT   assembly_gap    10577552..10579752
FT                   /estimated_length=2201
FT                   /gap_type="unknown"
FT   assembly_gap    10591854..10592585
FT                   /estimated_length=732
FT                   /gap_type="unknown"
FT   assembly_gap    10598288..10598942
FT                   /estimated_length=655
FT                   /gap_type="unknown"
FT   assembly_gap    10599980..10599999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10612236..10612255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10619503..10619522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10623252..10623271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10631114..10631190
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    10632263..10632341
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    10634240..10634531
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    10635914..10636809
FT                   /estimated_length=896
FT                   /gap_type="unknown"
FT   assembly_gap    10642860..10642879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10651556..10651575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10662143..10662259
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    10667515..10668263
FT                   /estimated_length=749
FT                   /gap_type="unknown"
FT   assembly_gap    10670609..10671090
FT                   /estimated_length=482
FT                   /gap_type="unknown"
FT   assembly_gap    10672571..10672590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10674165..10674962
FT                   /estimated_length=798
FT                   /gap_type="unknown"
FT   assembly_gap    10676470..10676791
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    10698720..10702396
FT                   /estimated_length=3677
FT                   /gap_type="unknown"
FT   assembly_gap    10704715..10705461
FT                   /estimated_length=747
FT                   /gap_type="unknown"
FT   assembly_gap    10706908..10707986
FT                   /estimated_length=1079
FT                   /gap_type="unknown"
FT   assembly_gap    10709690..10709709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10713220..10713900
FT                   /estimated_length=681
FT                   /gap_type="unknown"
FT   assembly_gap    10715217..10715236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10719269..10720247
FT                   /estimated_length=979
FT                   /gap_type="unknown"
FT   assembly_gap    10725323..10725342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10737828..10738057
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    10742123..10742142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10743176..10743320
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    10746317..10747407
FT                   /estimated_length=1091
FT                   /gap_type="unknown"
FT   assembly_gap    10753263..10753367
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    10760361..10760540
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    10765324..10765343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10788887..10788906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10802863..10802899
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    10806329..10808373
FT                   /estimated_length=2045
FT                   /gap_type="unknown"
FT   assembly_gap    10821151..10821458
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    10842530..10868314
FT                   /estimated_length=25785
FT                   /gap_type="unknown"
FT   assembly_gap    10869805..10869824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10870940..10873981
FT                   /estimated_length=3042
FT                   /gap_type="unknown"
FT   assembly_gap    10875092..10875111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10893689..10893878
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    10896026..10896387
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    10923893..10923912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10940436..10940965
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    10942392..10942432
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    10953505..10955224
FT                   /estimated_length=1720
FT                   /gap_type="unknown"
FT   assembly_gap    10969132..10969151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10971638..10972361
FT                   /estimated_length=724
FT                   /gap_type="unknown"
FT   assembly_gap    10974519..10974538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11006263..11006300
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    11010599..11010618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11012871..11012890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11033759..11034070
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    11038132..11038950
FT                   /estimated_length=819
FT                   /gap_type="unknown"
FT   assembly_gap    11043352..11043530
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    11046997..11047016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11050276..11050295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11055218..11056480
FT                   /estimated_length=1263
FT                   /gap_type="unknown"
FT   assembly_gap    11057555..11057574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11059674..11059693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11064057..11064545
FT                   /estimated_length=489
FT                   /gap_type="unknown"
FT   assembly_gap    11065711..11068608
FT                   /estimated_length=2898
FT                   /gap_type="unknown"
FT   assembly_gap    11069860..11070088
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    11112664..11112791
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    11113933..11114085
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    11127621..11127640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11139251..11139372
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    11141171..11141190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11158541..11158823
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    11209407..11209463
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    11215253..11215272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11217390..11217409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11229652..11229991
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    11231228..11232039
FT                   /estimated_length=812
FT                   /gap_type="unknown"
FT   assembly_gap    11237770..11237789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11262943..11262962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11267181..11267309
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    11271812..11271831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11273638..11273833
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    11295460..11295479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11296493..11296612
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    11299864..11299883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11302655..11304332
FT                   /estimated_length=1678
FT                   /gap_type="unknown"
FT   assembly_gap    11337595..11338485
FT                   /estimated_length=891
FT                   /gap_type="unknown"
FT   assembly_gap    11343721..11344067
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    11373002..11374111
FT                   /estimated_length=1110
FT                   /gap_type="unknown"
FT   assembly_gap    11388286..11388305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11389939..11389966
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    11399571..11399973
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    11401534..11401553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11406201..11406220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11408729..11408748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11411819..11411922
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    11412611..11413159
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   assembly_gap    11415793..11416614
FT                   /estimated_length=822
FT                   /gap_type="unknown"
FT   assembly_gap    11453482..11453501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11468305..11468324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11468713..11468732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11482244..11483236
FT                   /estimated_length=993
FT                   /gap_type="unknown"
FT   assembly_gap    11486648..11486676
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    11497555..11500215
FT                   /estimated_length=2661
FT                   /gap_type="unknown"
FT   assembly_gap    11507131..11507150
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11509030..11509418
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    11512610..11512840
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    11535545..11535564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11540507..11540526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11542062..11542373
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    11545786..11545888
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    11563351..11563486
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    11583176..11583195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11586344..11587452
FT                   /estimated_length=1109
FT                   /gap_type="unknown"
FT   assembly_gap    11589380..11589399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11605462..11605922
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    11625052..11625071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11635014..11635063
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    11643727..11643746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11650320..11650500
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    11688337..11688469
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    11695251..11695899
FT                   /estimated_length=649
FT                   /gap_type="unknown"
FT   assembly_gap    11704156..11705176
FT                   /estimated_length=1021
FT                   /gap_type="unknown"
FT   assembly_gap    11713089..11713108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11714202..11715795
FT                   /estimated_length=1594
FT                   /gap_type="unknown"
FT   assembly_gap    11717563..11717654
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    11719377..11719396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11731369..11731488
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    11747687..11758348
FT                   /estimated_length=10662
FT                   /gap_type="unknown"
FT   assembly_gap    11759790..11759809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11771806..11771825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11784055..11784479
FT                   /estimated_length=425
FT                   /gap_type="unknown"
FT   assembly_gap    11787329..11787469
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    11789675..11790549
FT                   /estimated_length=875
FT                   /gap_type="unknown"
FT   assembly_gap    11792693..11794149
FT                   /estimated_length=1457
FT                   /gap_type="unknown"
FT   assembly_gap    11812653..11812749
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    11815397..11815443
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    11835924..11835943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11844015..11844558
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    11845448..11846342
FT                   /estimated_length=895
FT                   /gap_type="unknown"
FT   assembly_gap    11864418..11864437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11870523..11871210
FT                   /estimated_length=688
FT                   /gap_type="unknown"
FT   assembly_gap    11874687..11874760
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    11895415..11895434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11906559..11906578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11914627..11914646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11941836..11941930
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    11945459..11945739
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    11947680..11947777
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    11975874..11976056
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    11986200..11987125
FT                   /estimated_length=926
FT                   /gap_type="unknown"
FT   assembly_gap    11994686..11997169
FT                   /estimated_length=2484
FT                   /gap_type="unknown"
FT   assembly_gap    12007070..12009846
FT                   /estimated_length=2777
FT                   /gap_type="unknown"
FT   assembly_gap    12013062..12013081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12015762..12015781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12021404..12022488
FT                   /estimated_length=1085
FT                   /gap_type="unknown"
FT   assembly_gap    12024440..12024783
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    12027949..12028101
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    12040004..12046466
FT                   /estimated_length=6463
FT                   /gap_type="unknown"
FT   assembly_gap    12057739..12057758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12071328..12071440
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    12075984..12076003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12079845..12080281
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    12080920..12081171
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    12091322..12091341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12096784..12098995
FT                   /estimated_length=2212
FT                   /gap_type="unknown"
FT   assembly_gap    12100880..12101394
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   assembly_gap    12103699..12103718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12105046..12107040
FT                   /estimated_length=1995
FT                   /gap_type="unknown"
FT   assembly_gap    12113460..12113479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12122717..12134684
FT                   /estimated_length=11968
FT                   /gap_type="unknown"
FT   assembly_gap    12138164..12138183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12140691..12140728
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    12146736..12147148
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   assembly_gap    12152187..12152440
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    12157401..12157955
FT                   /estimated_length=555
FT                   /gap_type="unknown"
FT   assembly_gap    12159787..12159806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12169519..12169621
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    12173323..12173482
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    12185043..12185062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12200478..12205291
FT                   /estimated_length=4814
FT                   /gap_type="unknown"
FT   assembly_gap    12212981..12214324
FT                   /estimated_length=1344
FT                   /gap_type="unknown"
FT   assembly_gap    12222816..12225700
FT                   /estimated_length=2885
FT                   /gap_type="unknown"
FT   assembly_gap    12233445..12233464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12242674..12242693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12244907..12246230
FT                   /estimated_length=1324
FT                   /gap_type="unknown"
FT   assembly_gap    12247245..12248359
FT                   /estimated_length=1115
FT                   /gap_type="unknown"
FT   assembly_gap    12250121..12250140
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12252456..12252475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12254444..12259163
FT                   /estimated_length=4720
FT                   /gap_type="unknown"
FT   assembly_gap    12276304..12276323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12277719..12278551
FT                   /estimated_length=833
FT                   /gap_type="unknown"
FT   assembly_gap    12286044..12286075
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    12287495..12287514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12292714..12293158
FT                   /estimated_length=445
FT                   /gap_type="unknown"
FT   assembly_gap    12300985..12302413
FT                   /estimated_length=1429
FT                   /gap_type="unknown"
FT   assembly_gap    12304227..12304817
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    12312035..12312348
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    12315520..12315539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12320079..12320098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12361183..12361202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12367435..12367555
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    12379993..12385130
FT                   /estimated_length=5138
FT                   /gap_type="unknown"
FT   assembly_gap    12388615..12388634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12391713..12392585
FT                   /estimated_length=873
FT                   /gap_type="unknown"
FT   assembly_gap    12395379..12395398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12412504..12412659
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    12416941..12417002
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    12421176..12424848
FT                   /estimated_length=3673
FT                   /gap_type="unknown"
FT   assembly_gap    12431414..12431947
FT                   /estimated_length=534
FT                   /gap_type="unknown"
FT   assembly_gap    12432446..12433193
FT                   /estimated_length=748
FT                   /gap_type="unknown"
FT   assembly_gap    12438428..12438796
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    12440711..12443138
FT                   /estimated_length=2428
FT                   /gap_type="unknown"
FT   assembly_gap    12443872..12445404
FT                   /estimated_length=1533
FT                   /gap_type="unknown"
FT   assembly_gap    12447902..12448016
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    12449432..12449451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12459680..12459699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12482852..12482871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12488363..12488382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12510136..12510173
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    12528568..12532390
FT                   /estimated_length=3823
FT                   /gap_type="unknown"
FT   assembly_gap    12533250..12533754
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    12534920..12535460
FT                   /estimated_length=541
FT                   /gap_type="unknown"
FT   assembly_gap    12537235..12537491
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    12538997..12539016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12540673..12544562
FT                   /estimated_length=3890
FT                   /gap_type="unknown"
FT   assembly_gap    12546542..12546561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12552946..12553388
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    12558181..12558275
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    12562489..12562508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12574348..12575078
FT                   /estimated_length=731
FT                   /gap_type="unknown"
FT   assembly_gap    12578269..12578288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12590490..12590523
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    12614615..12614634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12624334..12624353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12630173..12630192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12635406..12635960
FT                   /estimated_length=555
FT                   /gap_type="unknown"
FT   assembly_gap    12642186..12642224
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    12649021..12651260
FT                   /estimated_length=2240
FT                   /gap_type="unknown"
FT   assembly_gap    12664859..12664892
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    12665518..12665537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12672654..12672673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12673964..12674411
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   assembly_gap    12678760..12678843
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    12683181..12683329
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    12688361..12688400
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    12691845..12691864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12710278..12710297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12752897..12754328
FT                   /estimated_length=1432
FT                   /gap_type="unknown"
FT   assembly_gap    12774834..12775157
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    12776708..12778290
FT                   /estimated_length=1583
FT                   /gap_type="unknown"
FT   assembly_gap    12796778..12796797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12825685..12825704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12826944..12827767
FT                   /estimated_length=824
FT                   /gap_type="unknown"
FT   assembly_gap    12833405..12833874
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    12835613..12839623
FT                   /estimated_length=4011
FT                   /gap_type="unknown"
FT   assembly_gap    12857687..12857865
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    12862697..12862716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12882419..12882453
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    12887677..12887696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12891769..12891788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12892418..12894072
FT                   /estimated_length=1655
FT                   /gap_type="unknown"
FT   assembly_gap    12895591..12895610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12907428..12907579
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    12918564..12918755
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    12920227..12920247
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    12921943..12922866
FT                   /estimated_length=924
FT                   /gap_type="unknown"
FT   assembly_gap    12925079..12925127
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    12939442..12940147
FT                   /estimated_length=706
FT                   /gap_type="unknown"
FT   assembly_gap    12943500..12943752
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    12960864..12960883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12986659..12986678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12996196..12996292
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    12999457..12999476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13010709..13010800
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    13017278..13017297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13018801..13020007
FT                   /estimated_length=1207
FT                   /gap_type="unknown"
FT   assembly_gap    13027328..13027347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13040354..13040977
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   assembly_gap    13044154..13044173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13052961..13053669
FT                   /estimated_length=709
FT                   /gap_type="unknown"
FT   assembly_gap    13059156..13060133
FT                   /estimated_length=978
FT                   /gap_type="unknown"
FT   assembly_gap    13063693..13064546
FT                   /estimated_length=854
FT                   /gap_type="unknown"
FT   assembly_gap    13072786..13072805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13076664..13076749
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    13083623..13083743
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    13087001..13087020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13088358..13088384
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    13091103..13091132
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    13100627..13100899
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    13101285..13101558
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    13107564..13107660
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    13113996..13114708
FT                   /estimated_length=713
FT                   /gap_type="unknown"
FT   assembly_gap    13116702..13116813
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    13128080..13128508
FT                   /estimated_length=429
FT                   /gap_type="unknown"
FT   assembly_gap    13139055..13139105
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    13143025..13143044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13152152..13152171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13153769..13153788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13215533..13216062
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    13224754..13224773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13230190..13230898
FT                   /estimated_length=709
FT                   /gap_type="unknown"
FT   assembly_gap    13246164..13246222
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    13253381..13253400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13258703..13258830
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    13259984..13260090
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    13262887..13262906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13280843..13280862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13282072..13284426
FT                   /estimated_length=2355
FT                   /gap_type="unknown"
FT   assembly_gap    13285175..13288051
FT                   /estimated_length=2877
FT                   /gap_type="unknown"
FT   assembly_gap    13290281..13290399
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    13295800..13300987
FT                   /estimated_length=5188
FT                   /gap_type="unknown"
FT   assembly_gap    13305271..13305420
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    13313434..13314250
FT                   /estimated_length=817
FT                   /gap_type="unknown"
FT   assembly_gap    13321667..13321760
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    13330880..13331005
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    13334087..13334146
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    13338433..13338825
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    13344883..13346567
FT                   /estimated_length=1685
FT                   /gap_type="unknown"
FT   assembly_gap    13351159..13351178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13353087..13353855
FT                   /estimated_length=769
FT                   /gap_type="unknown"
FT   assembly_gap    13360013..13360034
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    13361628..13361647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13363601..13363632
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    13376448..13377171
FT                   /estimated_length=724
FT                   /gap_type="unknown"
FT   assembly_gap    13379330..13381093
FT                   /estimated_length=1764
FT                   /gap_type="unknown"
FT   assembly_gap    13383802..13384253
FT                   /estimated_length=452
FT                   /gap_type="unknown"
FT   assembly_gap    13384593..13384802
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    13387932..13387951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13402275..13402330
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    13404871..13405063
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    13429627..13430060
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    13432519..13432702
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    13454550..13454569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13456156..13456175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13462644..13467546
FT                   /estimated_length=4903
FT                   /gap_type="unknown"
FT   assembly_gap    13480232..13480251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13483480..13483656
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    13488172..13488233
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    13516813..13517032
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    13528675..13528694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13536129..13536148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13541655..13541722
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    13545656..13545763
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    13554712..13555529
FT                   /estimated_length=818
FT                   /gap_type="unknown"
FT   assembly_gap    13569555..13569574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13571355..13571421
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    13574048..13574182
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    13577387..13577562
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    13594383..13597854
FT                   /estimated_length=3472
FT                   /gap_type="unknown"
FT   assembly_gap    13645591..13645661
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    13679990..13680009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13732883..13732925
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    13755828..13761415
FT                   /estimated_length=5588
FT                   /gap_type="unknown"
FT   assembly_gap    13797056..13797523
FT                   /estimated_length=468
FT                   /gap_type="unknown"
FT   assembly_gap    13805118..13805137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13809856..13810535
FT                   /estimated_length=680
FT                   /gap_type="unknown"
FT   assembly_gap    13811720..13811739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13813959..13814167
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    13817349..13817392
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    13833102..13833210
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    13836272..13836291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13875348..13875459
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    13880341..13880618
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    13884960..13884979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13886411..13886652
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    13891297..13891325
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    13904893..13905040
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    13913127..13913808
FT                   /estimated_length=682
FT                   /gap_type="unknown"
FT   assembly_gap    13915736..13915755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13917283..13917506
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    13932641..13932700
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    13942177..13944675
FT                   /estimated_length=2499
FT                   /gap_type="unknown"
FT   assembly_gap    13947668..13955542
FT                   /estimated_length=7875
FT                   /gap_type="unknown"
FT   assembly_gap    13956783..13956802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13958966..13959142
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    13966154..13966173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13975277..13975296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13988485..13988765
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    13994169..13994232
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    13997165..13997578
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    14007973..14008139
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    14015128..14015147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14023812..14023831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14026568..14026963
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    14034084..14034146
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    14035307..14038741
FT                   /estimated_length=3435
FT                   /gap_type="unknown"
FT   assembly_gap    14049955..14049974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14052877..14052981
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    14054771..14056270
FT                   /estimated_length=1500
FT                   /gap_type="unknown"
FT   assembly_gap    14057622..14057641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14061303..14061639
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    14062338..14062850
FT                   /estimated_length=513
FT                   /gap_type="unknown"
FT   assembly_gap    14067895..14068357
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   assembly_gap    14069763..14069954
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    14071238..14071764
FT                   /estimated_length=527
FT                   /gap_type="unknown"
FT   assembly_gap    14073886..14073905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14075348..14075367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14082971..14083451
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    14110027..14110068
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    14111560..14111710
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    14122830..14122849
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14125592..14125827
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    14132486..14132666
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    14153714..14153925
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    14178157..14178231
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    14182022..14182041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14199595..14199826
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    14201001..14201227
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    14203556..14204327
FT                   /estimated_length=772
FT                   /gap_type="unknown"
FT   assembly_gap    14208282..14208340
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    14209600..14209870
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    14226783..14226802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14229114..14229133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14242130..14242889
FT                   /estimated_length=760
FT                   /gap_type="unknown"
FT   assembly_gap    14245524..14245543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14246719..14246802
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    14252642..14252661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14254320..14254374
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    14265468..14265510
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    14275810..14276175
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    14283530..14283549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14315675..14316653
FT                   /estimated_length=979
FT                   /gap_type="unknown"
FT   assembly_gap    14329535..14329554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14332638..14332672
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    14337017..14337036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14364032..14364051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14367752..14370455
FT                   /estimated_length=2704
FT                   /gap_type="unknown"
FT   assembly_gap    14374178..14380148
FT                   /estimated_length=5971
FT                   /gap_type="unknown"
FT   assembly_gap    14383735..14383936
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    14393940..14393959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14396018..14396037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14399646..14399840
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    14407944..14408533
FT                   /estimated_length=590
FT                   /gap_type="unknown"
FT   assembly_gap    14412636..14412789
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    14428671..14428690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14439269..14439784
FT                   /estimated_length=516
FT                   /gap_type="unknown"
FT   assembly_gap    14448744..14448889
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    14460765..14460784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14472405..14472424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14485629..14485761
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    14501851..14501870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14527237..14527316
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    14533745..14534575
FT                   /estimated_length=831
FT                   /gap_type="unknown"
FT   assembly_gap    14540191..14540210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14544793..14545403
FT                   /estimated_length=611
FT                   /gap_type="unknown"
FT   assembly_gap    14601414..14601491
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    14614383..14614402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14618280..14618567
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    14637111..14637800
FT                   /estimated_length=690
FT                   /gap_type="unknown"
FT   assembly_gap    14649407..14650290
FT                   /estimated_length=884
FT                   /gap_type="unknown"
FT   assembly_gap    14653196..14653215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14667377..14667396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14671251..14671270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14677743..14677762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14690501..14690597
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    14713557..14713598
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    14719759..14719778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14727767..14728091
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    14729341..14730772
FT                   /estimated_length=1432
FT                   /gap_type="unknown"
FT   assembly_gap    14734723..14735728
FT                   /estimated_length=1006
FT                   /gap_type="unknown"
FT   assembly_gap    14739353..14739611
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    14745640..14745659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14746609..14746929
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    14755014..14755033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14756196..14756395
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    14774845..14774864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14781120..14781598
FT                   /estimated_length=479
FT                   /gap_type="unknown"
FT   assembly_gap    14782919..14782977
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    14784767..14785475
FT                   /estimated_length=709
FT                   /gap_type="unknown"
FT   assembly_gap    14788915..14789800
FT                   /estimated_length=886
FT                   /gap_type="unknown"
FT   assembly_gap    14793010..14793029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14795810..14796026
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    14796575..14796594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14800391..14800468
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    14804169..14804395
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    14806250..14806269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14819047..14819066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14836193..14836212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14838314..14838333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14841572..14843119
FT                   /estimated_length=1548
FT                   /gap_type="unknown"
FT   assembly_gap    14846689..14846708
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14850221..14850576
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    14856328..14856414
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    14859345..14859421
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    14868616..14868809
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    14869851..14870073
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    14879771..14880372
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   assembly_gap    14881784..14881803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14895178..14895269
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    14900172..14900563
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    14908990..14909009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14910898..14910959
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    14913195..14915570
FT                   /estimated_length=2376
FT                   /gap_type="unknown"
FT   assembly_gap    14926037..14926056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14933489..14933836
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    14934768..14934851
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    14938827..14938869
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    14949084..14949145
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    14951807..14951826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14970837..14970856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14973762..14974040
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    14975421..14975440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14978206..14978417
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    14979318..14979599
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    14992806..14992968
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    15006103..15006419
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    15010841..15010860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15013866..15013885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15014650..15015083
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    15022730..15022749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15027648..15027667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15028978..15029855
FT                   /estimated_length=878
FT                   /gap_type="unknown"
FT   assembly_gap    15032009..15032410
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    15033332..15033351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15044754..15045342
FT                   /estimated_length=589
FT                   /gap_type="unknown"
FT   assembly_gap    15064214..15064233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15065984..15066122
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    15067648..15067667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15069789..15069808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15078928..15078961
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    15080504..15080523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15100886..15100957
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    15102999..15103150
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    15122804..15123399
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    15132249..15132278
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    15136449..15136468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15141179..15141565
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   assembly_gap    15145672..15146308
FT                   /estimated_length=637
FT                   /gap_type="unknown"
FT   assembly_gap    15148474..15148739
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    15151526..15151545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15156675..15157428
FT                   /estimated_length=754
FT                   /gap_type="unknown"
FT   assembly_gap    15173468..15173487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15175274..15175456
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    15184826..15184845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15187281..15187300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15190211..15190329
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    15207072..15207091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15214856..15214875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15222837..15223185
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    15224444..15224549
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    15236522..15236541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15239578..15239597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15240694..15250114
FT                   /estimated_length=9421
FT                   /gap_type="unknown"
FT   assembly_gap    15251511..15252054
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    15262358..15262388
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    15270564..15271063
FT                   /estimated_length=500
FT                   /gap_type="unknown"
FT   assembly_gap    15278644..15278959
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    15282865..15282884
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15300938..15300992
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    15302078..15302107
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    15313020..15313946
FT                   /estimated_length=927
FT                   /gap_type="unknown"
FT   assembly_gap    15314995..15315014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15317258..15317277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15325504..15325523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15329131..15329326
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    15334457..15334476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15344040..15344059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15345565..15345745
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    15367660..15373752
FT                   /estimated_length=6093
FT                   /gap_type="unknown"
FT   assembly_gap    15401212..15401231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15403270..15403360
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    15415250..15415574
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    15423013..15423032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15426630..15426663
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    15437115..15437422
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    15441313..15441332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15445614..15445633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15450624..15453948
FT                   /estimated_length=3325
FT                   /gap_type="unknown"
FT   assembly_gap    15457631..15457650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15458813..15458885
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    15469736..15469755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15470860..15470950
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    15474482..15474501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15478164..15478351
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    15482758..15488865
FT                   /estimated_length=6108
FT                   /gap_type="unknown"
FT   assembly_gap    15496022..15496581
FT                   /estimated_length=560
FT                   /gap_type="unknown"
FT   assembly_gap    15498426..15499041
FT                   /estimated_length=616
FT                   /gap_type="unknown"
FT   assembly_gap    15499837..15500194
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    15501376..15501412
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    15502673..15512094
FT                   /estimated_length=9422
FT                   /gap_type="unknown"
FT   assembly_gap    15514854..15515449
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    15520035..15522870
FT                   /estimated_length=2836
FT                   /gap_type="unknown"
FT   assembly_gap    15526616..15526681
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    15528815..15528834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15535903..15540287
FT                   /estimated_length=4385
FT                   /gap_type="unknown"
FT   assembly_gap    15544451..15547081
FT                   /estimated_length=2631
FT                   /gap_type="unknown"
FT   assembly_gap    15550193..15550212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15573013..15573193
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    15578720..15578812
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    15581987..15582316
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    15584899..15585093
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    15595506..15632853
FT                   /estimated_length=37348
FT                   /gap_type="unknown"
FT   assembly_gap    15634609..15634839
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    15636444..15636463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15638099..15638371
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    15639881..15639900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15646038..15646057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15653505..15654300
FT                   /estimated_length=796
FT                   /gap_type="unknown"
FT   assembly_gap    15661684..15661901
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    15673227..15673246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15681249..15681268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15683198..15683217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15685797..15686269
FT                   /estimated_length=473
FT                   /gap_type="unknown"
FT   assembly_gap    15711911..15711930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15728641..15732596
FT                   /estimated_length=3956
FT                   /gap_type="unknown"
FT   assembly_gap    15734407..15739335
FT                   /estimated_length=4929
FT                   /gap_type="unknown"
FT   assembly_gap    15751277..15751443
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    15758101..15759852
FT                   /estimated_length=1752
FT                   /gap_type="unknown"
FT   assembly_gap    15783274..15783646
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    15785731..15785760
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    15789226..15790343
FT                   /estimated_length=1118
FT                   /gap_type="unknown"
FT   assembly_gap    15791487..15791881
FT                   /estimated_length=395
FT                   /gap_type="unknown"
FT   assembly_gap    15811428..15811466
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    15815507..15815526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15816693..15816712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15851138..15851157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15856972..15857114
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    15863765..15863784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15873681..15873700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15883299..15883326
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    15904625..15904911
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    15908581..15908600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15910280..15910384
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    15913048..15913180
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    15918868..15918887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15935293..15935390
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    15949910..15950527
FT                   /estimated_length=618
FT                   /gap_type="unknown"
FT   assembly_gap    15954775..15956855
FT                   /estimated_length=2081
FT                   /gap_type="unknown"
FT   assembly_gap    15966563..15968116
FT                   /estimated_length=1554
FT                   /gap_type="unknown"
FT   assembly_gap    15969131..15969188
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    15976629..15977405
FT                   /estimated_length=777
FT                   /gap_type="unknown"
FT   assembly_gap    15981841..15981860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15983404..15983423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15985958..15987594
FT                   /estimated_length=1637
FT                   /gap_type="unknown"
FT   assembly_gap    15988799..15988818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15996609..15996628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16008303..16008531
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    16020215..16020234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16022731..16023550
FT                   /estimated_length=820
FT                   /gap_type="unknown"
FT   assembly_gap    16038689..16040443
FT                   /estimated_length=1755
FT                   /gap_type="unknown"
FT   assembly_gap    16047664..16047721
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    16054367..16055164
FT                   /estimated_length=798
FT                   /gap_type="unknown"
FT   assembly_gap    16067645..16068108
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   assembly_gap    16089042..16089139
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    16118703..16118722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16129239..16129258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16135539..16136678
FT                   /estimated_length=1140
FT                   /gap_type="unknown"
FT   assembly_gap    16139086..16142071
FT                   /estimated_length=2986
FT                   /gap_type="unknown"
FT   assembly_gap    16143590..16145889
FT                   /estimated_length=2300
FT                   /gap_type="unknown"
FT   assembly_gap    16150672..16151199
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    16152341..16160369
FT                   /estimated_length=8029
FT                   /gap_type="unknown"
FT   assembly_gap    16165921..16166759
FT                   /estimated_length=839
FT                   /gap_type="unknown"
FT   assembly_gap    16167515..16168598
FT                   /estimated_length=1084
FT                   /gap_type="unknown"
FT   assembly_gap    16172724..16173593
FT                   /estimated_length=870
FT                   /gap_type="unknown"
FT   assembly_gap    16174620..16174639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16177850..16178588
FT                   /estimated_length=739
FT                   /gap_type="unknown"
FT   assembly_gap    16182068..16188818
FT                   /estimated_length=6751
FT                   /gap_type="unknown"
XX
CO   join(AAHY01208832.1:1..3689,gap(845),AAHY01208833.1:1..1500,gap(543),
CO   AAHY01208834.1:1..914,gap(1627),AAHY01208835.1:1..18159,gap(766),
CO   AAHY01208836.1:1..4305,gap(349),AAHY01208837.1:1..10020,gap(557),
CO   AAHY01208838.1:1..4778,gap(9399),AAHY01208839.1:1..1282,gap(20),
CO   complement(AAHY01208840.1:1..3309),gap(973),
CO   complement(AAHY01208841.1:1..6764),gap(280),AAHY01208842.1:1..27050,
CO   gap(119),AAHY01208843.1:1..41770,gap(11102),AAHY01208844.1:1..15144,
CO   gap(3166),complement(AAHY01208845.1:1..9694),gap(131),
CO   AAHY01208846.1:1..2316,gap(1041),AAHY01208847.1:1..1082,gap(446),
CO   AAHY01208848.1:1..4892,gap(20),complement(AAHY01208849.1:1..22118),
CO   gap(6509),complement(AAHY01208850.1:1..2607),gap(169),
CO   complement(AAHY01208851.1:1..3433),gap(41),AAHY01208852.1:1..17331,
CO   gap(2248),AAHY01208853.1:1..20113,gap(20),AAHY01208854.1:1..16690,gap(20),
CO   AAHY01208855.1:1..2027,gap(20),complement(AAHY01208856.1:1..1946),
CO   gap(2405),AAHY01208857.1:1..5211,gap(240),AAHY01208858.1:1..5721,gap(20),
CO   AAHY01208859.1:1..3209,gap(20),complement(AAHY01208860.1:1..2200),gap(20),
CO   complement(AAHY01208861.1:1..20545),gap(20),
CO   complement(AAHY01208862.1:1..2381),gap(976),AAHY01208863.1:1..11279,
CO   gap(120),AAHY01208864.1:1..17327,gap(26),
CO   complement(AAHY01208865.1:1..1065),gap(226),
CO   complement(AAHY01208866.1:1..1081),gap(757),AAHY01208867.1:1..17422,
CO   gap(144),AAHY01208868.1:1..156881,gap(2857),AAHY01208869.1:1..2812,
CO   gap(602),AAHY01208870.1:1..17038,gap(518),AAHY01208871.1:1..107878,
CO   gap(343),AAHY01208872.1:1..84021,gap(60),AAHY01208873.1:1..113330,gap(20),
CO   AAHY01208874.1:1..3441,gap(301),AAHY01208875.1:1..5267,gap(91),
CO   complement(AAHY01208876.1:1..1617),gap(20),
CO   complement(AAHY01208877.1:1..2016),gap(20),AAHY01208878.1:1..1290,gap(70),
CO   complement(AAHY01208879.1:1..8483),gap(20),AAHY01208880.1:1..13334,
CO   gap(2937),AAHY01208881.1:1..11386,gap(2975),AAHY01208882.1:1..10806,
CO   gap(145),AAHY01208883.1:1..37236,gap(3818),AAHY01208884.1:1..40135,gap(20),
CO   complement(AAHY01208885.1:1..1662),gap(671),AAHY01208886.1:1..7169,
CO   gap(3105),AAHY01208887.1:1..14505,gap(5162),AAHY01208888.1:1..12886,
CO   gap(779),AAHY01208889.1:1..5200,gap(20),AAHY01208890.1:1..1519,gap(122),
CO   AAHY01208891.1:1..11547,gap(167),complement(AAHY01208892.1:1..1891),
CO   gap(207),AAHY01208893.1:1..7802,gap(2557),AAHY01208894.1:1..2406,gap(620),
CO   AAHY01208895.1:1..2461,gap(20),AAHY01208896.1:1..3172,gap(279),
CO   AAHY01208897.1:1..2316,gap(331),AAHY01208898.1:1..2677,gap(1973),
CO   AAHY01208899.1:1..12103,gap(124),complement(AAHY01208900.1:1..25942),
CO   gap(20),AAHY01208901.1:1..25440,gap(36),complement(AAHY01208902.1:1..1418),
CO   gap(166),AAHY01208903.1:1..3188,gap(71),complement(AAHY01208904.1:1..2087),
CO   gap(380),AAHY01208905.1:1..3917,gap(20),AAHY01208906.1:1..4707,gap(20),
CO   AAHY01208907.1:1..5831,gap(20),complement(AAHY01208908.1:1..9557),gap(549),
CO   AAHY01208909.1:1..5876,gap(104),complement(AAHY01208910.1:1..18562),
CO   gap(20),AAHY01208911.1:1..5273,gap(1222),AAHY01208912.1:1..1534,gap(2261),
CO   AAHY01208913.1:1..6940,gap(2656),AAHY01208914.1:1..2997,gap(2240),
CO   AAHY01208915.1:1..23280,gap(20),complement(AAHY01208916.1:1..4178),gap(20),
CO   AAHY01208917.1:1..5189,gap(79),AAHY01208918.1:1..19148,gap(20),
CO   AAHY01208919.1:1..5648,gap(20),AAHY01208920.1:1..7656,gap(20),
CO   AAHY01208921.1:1..4568,gap(2301),AAHY01208922.1:1..1492,gap(863),
CO   AAHY01208923.1:1..35118,gap(20),AAHY01208924.1:1..10809,gap(211),
CO   AAHY01208925.1:1..5500,gap(957),AAHY01208926.1:1..2012,gap(12288),
CO   complement(AAHY01208927.1:1..10044),gap(5310),AAHY01208928.1:1..3426,
CO   gap(532),AAHY01208929.1:1..1071,gap(356),AAHY01208930.1:1..1143,gap(20),
CO   AAHY01208931.1:1..37218,gap(6205),AAHY01208932.1:1..1897,gap(538),
CO   AAHY01208933.1:1..2610,gap(679),AAHY01208934.1:1..4548,gap(720),
CO   AAHY01208935.1:1..8858,gap(475),AAHY01208936.1:1..11980,gap(20),
CO   complement(AAHY01208937.1:1..2218),gap(368),
CO   complement(AAHY01208938.1:1..1165),gap(153),AAHY01208939.1:1..10156,
CO   gap(20),complement(AAHY01208940.1:1..1866),gap(274),AAHY01208941.1:1..2671,
CO   gap(228),AAHY01208942.1:1..68477,gap(1139),AAHY01208943.1:1..2260,gap(567),
CO   AAHY01208944.1:1..8040,gap(20),AAHY01208945.1:1..3201,gap(20),
CO   AAHY01208946.1:1..3930,gap(10967),AAHY01208947.1:1..11021,gap(196),
CO   AAHY01208948.1:1..3424,gap(20),AAHY01208949.1:1..3906,gap(48),
CO   complement(AAHY01208950.1:1..1238),gap(73),AAHY01208951.1:1..32903,
CO   gap(701),AAHY01208952.1:1..15733,gap(680),AAHY01208953.1:1..1373,gap(2478),
CO   complement(AAHY01208954.1:1..3624),gap(20),
CO   complement(AAHY01208955.1:1..8717),gap(20),AAHY01208956.1:1..10740,gap(20),
CO   AAHY01208957.1:1..26015,gap(566),AAHY01208958.1:1..4738,gap(911),
CO   AAHY01208959.1:1..1241,gap(2131),AAHY01208960.1:1..10461,gap(20),
CO   AAHY01208961.1:1..13674,gap(1274),AAHY01208962.1:1..8373,gap(20),
CO   AAHY01208963.1:1..5899,gap(184),AAHY01208964.1:1..13204,gap(1018),
CO   AAHY01208965.1:1..5989,gap(125),AAHY01208966.1:1..388,gap(286),
CO   AAHY01208967.1:1..14469,gap(168),AAHY01208968.1:1..2660,gap(269),
CO   AAHY01208969.1:1..3551,gap(20),complement(AAHY01208970.1:1..1378),gap(160),
CO   AAHY01208971.1:1..3089,gap(226),complement(AAHY01208972.1:1..1981),
CO   gap(163),complement(AAHY01208973.1:1..1749),gap(4925),
CO   AAHY01208974.1:1..2757,gap(402),AAHY01208975.1:1..13927,gap(444),
CO   AAHY01208976.1:1..23351,gap(20),AAHY01208977.1:1..11254,gap(20),
CO   complement(AAHY01208978.1:1..7481),gap(8883),AAHY01208979.1:1..1991,
CO   gap(482),AAHY01208980.1:1..1125,gap(856),AAHY01208981.1:1..7215,gap(20),
CO   AAHY01208982.1:1..2719,gap(20),complement(AAHY01208983.1:1..11126),gap(20),
CO   complement(AAHY01208984.1:1..4821),gap(20),AAHY01208985.1:1..27275,gap(20),
CO   complement(AAHY01208986.1:1..1981),gap(651),
CO   complement(AAHY01208987.1:1..9710),gap(20),AAHY01208988.1:1..6729,gap(404),
CO   AAHY01208989.1:1..17549,gap(20),AAHY01208990.1:1..11068,gap(75),
CO   complement(AAHY01208991.1:1..5679),gap(20),AAHY01208992.1:1..8646,gap(420),
CO   complement(AAHY01208993.1:1..4980),gap(1494),AAHY01208994.1:1..1435,
CO   gap(796),complement(AAHY01208995.1:1..3220),gap(537),
CO   AAHY01208996.1:1..1539,gap(1492),AAHY01208997.1:1..3529,gap(20),
CO   AAHY01208998.1:1..20713,gap(357),AAHY01208999.1:1..1115,gap(211),
CO   complement(AAHY01209000.1:1..19036),gap(20),AAHY01209001.1:1..28107,
CO   gap(20),AAHY01209002.1:1..7156,gap(20),AAHY01209003.1:1..34479,gap(20),
CO   AAHY01209004.1:1..3610,gap(4786),complement(AAHY01209005.1:1..1274),
CO   gap(33),AAHY01209006.1:1..2883,gap(463),AAHY01209007.1:1..2839,gap(131),
CO   complement(AAHY01209008.1:1..10130),gap(20),
CO   complement(AAHY01209009.1:1..7810),gap(71),AAHY01209010.1:1..987,gap(242),
CO   complement(AAHY01209011.1:1..2728),gap(83),
CO   complement(AAHY01209012.1:1..5587),gap(148),
CO   complement(AAHY01209013.1:1..13917),gap(107),AAHY01209014.1:1..20925,
CO   gap(20),complement(AAHY01209015.1:1..6586),gap(20),AAHY01209016.1:1..3089,
CO   gap(20),complement(AAHY01209017.1:1..2989),gap(2209),AAHY01209018.1:1..819,
CO   gap(181),complement(AAHY01209019.1:1..8400),gap(20),
CO   complement(AAHY01209020.1:1..5417),gap(1329),
CO   complement(AAHY01209021.1:1..1730),gap(1245),AAHY01209022.1:1..6942,
CO   gap(20),complement(AAHY01209023.1:1..7813),gap(524),AAHY01209024.1:1..4990,
CO   gap(213),AAHY01209025.1:1..3134,gap(50),AAHY01209026.1:1..10487,gap(20),
CO   complement(AAHY01209027.1:1..1670),gap(20),
CO   complement(AAHY01209028.1:1..1120),gap(20),
CO   complement(AAHY01209029.1:1..3307),gap(635),
CO   complement(AAHY01209030.1:1..4110),gap(486),AAHY01209031.1:1..15788,
CO   gap(153),AAHY01209032.1:1..3599,gap(196),AAHY01209033.1:1..3258,gap(4697),
CO   AAHY01209034.1:1..2399,gap(282),AAHY01209035.1:1..2095,gap(20),
CO   AAHY01209036.1:1..4294,gap(20),complement(AAHY01209037.1:1..15012),
CO   gap(1263),AAHY01209038.1:1..6015,gap(20),AAHY01209039.1:1..13143,gap(69),
CO   AAHY01209040.1:1..7529,gap(20),AAHY01209041.1:1..11407,gap(1380),
CO   AAHY01209042.1:1..19872,gap(20),complement(AAHY01209043.1:1..4093),gap(20),
CO   AAHY01209044.1:1..2053,gap(436),AAHY01209045.1:1..3542,gap(98),
CO   AAHY01209046.1:1..949,gap(204),AAHY01209047.1:1..22076,gap(1871),
CO   AAHY01209048.1:1..6484,gap(20),AAHY01209049.1:1..6693,gap(20),
CO   AAHY01209050.1:1..12042,gap(112),complement(AAHY01209051.1:1..7350),
CO   gap(20),complement(AAHY01209052.1:1..7300),gap(332),
CO   complement(AAHY01209053.1:1..6301),gap(532),AAHY01209054.1:1..4105,gap(20),
CO   complement(AAHY01209055.1:1..1685),gap(37),AAHY01209056.1:1..4343,
CO   gap(10787),AAHY01209057.1:1..12199,gap(246),AAHY01209058.1:1..18487,
CO   gap(314),AAHY01209059.1:1..5034,gap(66),AAHY01209060.1:1..12937,gap(490),
CO   AAHY01209061.1:1..3959,gap(897),complement(AAHY01209062.1:1..7824),gap(59),
CO   complement(AAHY01209063.1:1..30219),gap(358),
CO   complement(AAHY01209064.1:1..30034),gap(79),
CO   complement(AAHY01209065.1:1..4230),gap(20),
CO   complement(AAHY01209066.1:1..1657),gap(113),AAHY01209067.1:1..7975,gap(56),
CO   complement(AAHY01209068.1:1..2030),gap(20),AAHY01209069.1:1..22326,
CO   gap(2499),AAHY01209070.1:1..29643,gap(367),
CO   complement(AAHY01209071.1:1..14675),gap(20),
CO   complement(AAHY01209072.1:1..3043),gap(1876),AAHY01209073.1:1..6929,
CO   gap(1149),AAHY01209074.1:1..11017,gap(210),
CO   complement(AAHY01209075.1:1..838),gap(341),
CO   complement(AAHY01209076.1:1..9486),gap(696),
CO   complement(AAHY01209077.1:1..20473),gap(120),AAHY01209078.1:1..5949,
CO   gap(133),AAHY01209079.1:1..5378,gap(20),AAHY01209080.1:1..6791,gap(20),
CO   AAHY01209081.1:1..8644,gap(99),AAHY01209082.1:1..3598,gap(20),
CO   AAHY01209083.1:1..11769,gap(20),AAHY01209084.1:1..2147,gap(465),
CO   complement(AAHY01209085.1:1..819),gap(572),AAHY01209086.1:1..2050,
CO   gap(6474),AAHY01209087.1:1..26693,gap(42),AAHY01209088.1:1..21744,gap(20),
CO   AAHY01209089.1:1..29875,gap(20),AAHY01209090.1:1..2686,gap(20),
CO   AAHY01209091.1:1..7671,gap(20),AAHY01209092.1:1..32329,gap(639),
CO   AAHY01209093.1:1..890,gap(422),AAHY01209094.1:1..2628,gap(67),
CO   AAHY01209095.1:1..10140,gap(25),AAHY01209096.1:1..9708,gap(186),
CO   AAHY01209097.1:1..3231,gap(20),AAHY01209098.1:1..28843,gap(136),
CO   AAHY01209099.1:1..17424,gap(6018),AAHY01209100.1:1..11839,gap(20),
CO   AAHY01209101.1:1..6710,gap(116),AAHY01209102.1:1..4838,gap(72),
CO   AAHY01209103.1:1..4181,gap(3216),complement(AAHY01209104.1:1..2081),
CO   gap(364),AAHY01209105.1:1..6508,gap(20),AAHY01209106.1:1..12725,gap(20),
CO   AAHY01209107.1:1..14567,gap(67),AAHY01209108.1:1..10838,gap(250),
CO   complement(AAHY01209109.1:1..5672),gap(20),AAHY01209110.1:1..15896,gap(20),
CO   complement(AAHY01209111.1:1..1266),gap(162),AAHY01209112.1:1..6024,gap(20),
CO   AAHY01209113.1:1..6192,gap(20),AAHY01209114.1:1..4600,gap(1289),
CO   complement(AAHY01209115.1:1..3416),gap(131),
CO   complement(AAHY01209116.1:1..4787),gap(75),AAHY01209117.1:1..7508,gap(20),
CO   complement(AAHY01209118.1:1..1566),gap(34),AAHY01209119.1:1..1406,gap(20),
CO   complement(AAHY01209120.1:1..6349),gap(6094),AAHY01209121.1:1..4914,
CO   gap(400),AAHY01209122.1:1..7534,gap(92),AAHY01209123.1:1..14003,gap(20),
CO   AAHY01209124.1:1..3422,gap(140),complement(AAHY01209125.1:1..787),gap(182),
CO   AAHY01209126.1:1..13371,gap(20),AAHY01209127.1:1..772,gap(200),
CO   AAHY01209128.1:1..1619,gap(23),AAHY01209129.1:1..42005,gap(20),
CO   complement(AAHY01209130.1:1..3791),gap(243),AAHY01209131.1:1..4187,
CO   gap(1966),AAHY01209132.1:1..9245,gap(194),AAHY01209133.1:1..22102,
CO   gap(1249),complement(AAHY01209134.1:1..5968),gap(20),
CO   AAHY01209135.1:1..1581,gap(178),AAHY01209136.1:1..13126,gap(20),
CO   complement(AAHY01209137.1:1..4735),gap(169),
CO   complement(AAHY01209138.1:1..8140),gap(20),
CO   complement(AAHY01209139.1:1..4662),gap(604),AAHY01209140.1:1..5469,
CO   gap(3302),AAHY01209141.1:1..3333,gap(2576),AAHY01209142.1:1..5464,gap(20),
CO   complement(AAHY01209143.1:1..2014),gap(553),
CO   complement(AAHY01209144.1:1..2312),gap(20),
CO   complement(AAHY01209145.1:1..11815),gap(20),
CO   complement(AAHY01209146.1:1..15425),gap(20),
CO   complement(AAHY01209147.1:1..5763),gap(1434),AAHY01209148.1:1..11909,
CO   gap(104),AAHY01209149.1:1..18630,gap(91),AAHY01209150.1:1..19528,gap(20),
CO   complement(AAHY01209151.1:1..1233),gap(20),AAHY01209152.1:1..13975,
CO   gap(7422),AAHY01209153.1:1..63551,gap(20),AAHY01209154.1:1..23046,gap(107),
CO   AAHY01209155.1:1..26618,gap(20),AAHY01209156.1:1..1467,gap(20),
CO   complement(AAHY01209157.1:1..34332),gap(315),
CO   complement(AAHY01209158.1:1..1785),gap(72),AAHY01209159.1:1..9055,gap(175),
CO   AAHY01209160.1:1..1230,gap(490),AAHY01209161.1:1..2382,gap(895),
CO   complement(AAHY01209162.1:1..2587),gap(20),AAHY01209163.1:1..4942,
CO   gap(4814),AAHY01209164.1:1..2045,gap(1126),AAHY01209165.1:1..5497,gap(98),
CO   complement(AAHY01209166.1:1..3983),gap(142),AAHY01209167.1:1..21282,
CO   gap(96),AAHY01209168.1:1..19386,gap(371),AAHY01209169.1:1..7065,gap(650),
CO   AAHY01209170.1:1..67945,gap(20),complement(AAHY01209171.1:1..5532),gap(20),
CO   AAHY01209172.1:1..1918,gap(20),complement(AAHY01209173.1:1..2048),gap(421),
CO   AAHY01209174.1:1..741,gap(133),AAHY01209175.1:1..2014,gap(346),
CO   complement(AAHY01209176.1:1..2550),gap(288),
CO   complement(AAHY01209177.1:1..2701),gap(4358),AAHY01209178.1:1..3870,
CO   gap(877),complement(AAHY01209179.1:1..4779),gap(269),
CO   complement(AAHY01209180.1:1..9837),gap(130),
CO   complement(AAHY01209181.1:1..11824),gap(609),
CO   complement(AAHY01209182.1:1..10910),gap(69),AAHY01209183.1:1..12656,
CO   gap(5646),complement(AAHY01209184.1:1..4721),gap(217),
CO   complement(AAHY01209185.1:1..1918),gap(20),AAHY01209186.1:1..12978,gap(20),
CO   AAHY01209187.1:1..12455,gap(20),complement(AAHY01209188.1:1..4203),
CO   gap(7358),complement(AAHY01209189.1:1..5204),gap(1052),
CO   complement(AAHY01209190.1:1..1084),gap(329),
CO   complement(AAHY01209191.1:1..7106),gap(20),
CO   complement(AAHY01209192.1:1..4556),gap(83),AAHY01209193.1:1..3157,
CO   gap(3389),AAHY01209194.1:1..6524,gap(20),AAHY01209195.1:1..6833,gap(38),
CO   AAHY01209196.1:1..9090,gap(215),AAHY01209197.1:1..5505,gap(214),
CO   complement(AAHY01209198.1:1..1500),gap(152),AAHY01209199.1:1..2810,
CO   gap(118),complement(AAHY01209200.1:1..1881),gap(1037),
CO   complement(AAHY01209201.1:1..4039),gap(40),
CO   complement(AAHY01209202.1:1..4207),gap(130),AAHY01209203.1:1..2454,gap(39),
CO   complement(AAHY01209204.1:1..4496),gap(314),AAHY01209205.1:1..8643,
CO   gap(783),complement(AAHY01209206.1:1..3709),gap(32),
CO   complement(AAHY01209207.1:1..10870),gap(20),AAHY01209208.1:1..88193,
CO   gap(20),AAHY01209209.1:1..65786,gap(40),
CO   complement(AAHY01209210.1:1..11315),gap(335),
CO   complement(AAHY01209211.1:1..1358),gap(20),
CO   complement(AAHY01209212.1:1..1900),gap(20),AAHY01209213.1:1..3087,gap(568),
CO   AAHY01209214.1:1..1295,gap(365),AAHY01209215.1:1..5003,gap(55),
CO   AAHY01209216.1:1..3657,gap(330),complement(AAHY01209217.1:1..7156),
CO   gap(153),AAHY01209218.1:1..8273,gap(632),AAHY01209219.1:1..5456,gap(20),
CO   AAHY01209220.1:1..2767,gap(185),complement(AAHY01209221.1:1..390),gap(73),
CO   complement(AAHY01209222.1:1..16567),gap(242),AAHY01209223.1:1..8390,
CO   gap(20),complement(AAHY01209224.1:1..2155),gap(43),AAHY01209225.1:1..24170,
CO   gap(20),complement(AAHY01209226.1:1..2061),gap(20),
CO   complement(AAHY01209227.1:1..3233),gap(104),AAHY01209228.1:1..21065,
CO   gap(20),AAHY01209229.1:1..2509,gap(236),complement(AAHY01209230.1:1..510),
CO   gap(1071),AAHY01209231.1:1..4722,gap(385),AAHY01209232.1:1..5203,gap(790),
CO   AAHY01209233.1:1..18964,gap(20),complement(AAHY01209234.1:1..3076),gap(20),
CO   AAHY01209235.1:1..21253,gap(20),AAHY01209236.1:1..1906,gap(33),
CO   AAHY01209237.1:1..24489,gap(246),AAHY01209238.1:1..1713,gap(906),
CO   complement(AAHY01209239.1:1..3981),gap(339),AAHY01209240.1:1..10392,
CO   gap(166),AAHY01209241.1:1..21904,gap(20),
CO   complement(AAHY01209242.1:1..2105),gap(581),AAHY01209243.1:1..10405,
CO   gap(20),AAHY01209244.1:1..11694,gap(141),
CO   complement(AAHY01209245.1:1..2908),gap(4262),AAHY01209246.1:1..12369,
CO   gap(84),AAHY01209247.1:1..4225,gap(251),AAHY01209248.1:1..7918,gap(2237),
CO   AAHY01209249.1:1..1777,gap(20),complement(AAHY01209250.1:1..9656),gap(20),
CO   AAHY01209251.1:1..1326,gap(402),complement(AAHY01209252.1:1..4602),
CO   gap(370),AAHY01209253.1:1..5132,gap(20),complement(AAHY01209254.1:1..4022),
CO   gap(20),complement(AAHY01209255.1:1..12675),gap(20),AAHY01209256.1:1..5262,
CO   gap(116),AAHY01209257.1:1..2457,gap(20),
CO   complement(AAHY01209258.1:1..19150),gap(1759),AAHY01209259.1:1..1040,
CO   gap(517),AAHY01209260.1:1..9151,gap(20),AAHY01209261.1:1..3701,gap(191),
CO   AAHY01209262.1:1..1384,gap(20),AAHY01209263.1:1..5676,gap(647),
CO   complement(AAHY01209264.1:1..3169),gap(182),
CO   complement(AAHY01209265.1:1..21336),gap(951),
CO   complement(AAHY01209266.1:1..43000),gap(161),AAHY01209267.1:1..1508,
CO   gap(418),complement(AAHY01209268.1:1..2870),gap(181),
CO   complement(AAHY01209269.1:1..4949),gap(157),AAHY01209270.1:1..64761,
CO   gap(2869),AAHY01209271.1:1..63403,gap(5469),AAHY01209272.1:1..46662,
CO   gap(24),AAHY01209273.1:1..22631,gap(20),
CO   complement(AAHY01209274.1:1..51086),gap(20),
CO   complement(AAHY01209275.1:1..64530),gap(20),AAHY01209276.1:1..30096,
CO   gap(20),AAHY01209277.1:1..5910,gap(20),complement(AAHY01209278.1:1..9187),
CO   gap(78),complement(AAHY01209279.1:1..6788),gap(139),
CO   AAHY01209280.1:1..15525,gap(1031),complement(AAHY01209281.1:1..15588),
CO   gap(20),AAHY01209282.1:1..1905,gap(3604),AAHY01209283.1:1..95223,gap(20),
CO   AAHY01209284.1:1..34479,gap(20),AAHY01209285.1:1..19132,gap(20),
CO   complement(AAHY01209286.1:1..7781),gap(20),AAHY01209287.1:1..52544,gap(20),
CO   complement(AAHY01209288.1:1..31668),gap(20),AAHY01209289.1:1..32755,
CO   gap(20),complement(AAHY01209290.1:1..10900),gap(20),
CO   AAHY01209291.1:1..82602,gap(1468),complement(AAHY01209292.1:1..8990),
CO   gap(20),complement(AAHY01209293.1:1..1264),gap(20),
CO   complement(AAHY01209294.1:1..4219),gap(20),
CO   complement(AAHY01209295.1:1..6098),gap(20),
CO   complement(AAHY01209296.1:1..1556),gap(756),AAHY01209297.1:1..18831,
CO   gap(112),complement(AAHY01209298.1:1..5588),gap(20),
CO   AAHY01209299.1:1..43285,gap(94),complement(AAHY01209300.1:1..47508),
CO   gap(20),complement(AAHY01209301.1:1..19591),gap(960),
CO   AAHY01209302.1:1..2013,gap(20),complement(AAHY01209303.1:1..6668),
CO   gap(1175),AAHY01209304.1:1..1167,gap(361),AAHY01209305.1:1..12319,gap(56),
CO   AAHY01209306.1:1..12430,gap(20),complement(AAHY01209307.1:1..3817),gap(20),
CO   complement(AAHY01209308.1:1..762),gap(1006),AAHY01209309.1:1..1079,
CO   gap(166),complement(AAHY01209310.1:1..4458),gap(20),
CO   AAHY01209311.1:1..29772,gap(90),AAHY01209312.1:1..5028,gap(20),
CO   AAHY01209313.1:1..2675,gap(281),AAHY01209314.1:1..5869,gap(120),
CO   AAHY01209315.1:1..25024,gap(20),AAHY01209316.1:1..1394,gap(131),
CO   AAHY01209317.1:1..870,gap(20),complement(AAHY01209318.1:1..2381),gap(552),
CO   AAHY01209319.1:1..25947,gap(513),AAHY01209320.1:1..2341,gap(4511),
CO   AAHY01209321.1:1..2596,gap(240),AAHY01209322.1:1..21018,gap(2248),
CO   AAHY01209323.1:1..2676,gap(1167),AAHY01209324.1:1..12098,gap(5725),
CO   AAHY01209325.1:1..3269,gap(20),AAHY01209326.1:1..9131,gap(20),
CO   complement(AAHY01209327.1:1..6179),gap(536),AAHY01209328.1:1..12410,
CO   gap(20),AAHY01209329.1:1..4013,gap(20),AAHY01209330.1:1..1925,gap(699),
CO   AAHY01209331.1:1..14303,gap(528),AAHY01209332.1:1..13213,gap(39),
CO   AAHY01209333.1:1..2014,gap(20),AAHY01209334.1:1..12167,gap(175),
CO   AAHY01209335.1:1..7477,gap(2667),AAHY01209336.1:1..4119,gap(20),
CO   AAHY01209337.1:1..6626,gap(147),complement(AAHY01209338.1:1..3175),
CO   gap(124),complement(AAHY01209339.1:1..1420),gap(20),AAHY01209340.1:1..4442,
CO   gap(160),AAHY01209341.1:1..16235,gap(20),AAHY01209342.1:1..36717,gap(219),
CO   AAHY01209343.1:1..11263,gap(46),AAHY01209344.1:1..6233,gap(64),
CO   complement(AAHY01209345.1:1..2359),gap(20),
CO   complement(AAHY01209346.1:1..1617),gap(20),AAHY01209347.1:1..36964,gap(20),
CO   AAHY01209348.1:1..2521,gap(485),complement(AAHY01209349.1:1..1246),gap(47),
CO   AAHY01209350.1:1..42304,gap(752),AAHY01209351.1:1..6854,gap(147),
CO   complement(AAHY01209352.1:1..2032),gap(495),AAHY01209353.1:1..10155,
CO   gap(20),AAHY01209354.1:1..19969,gap(158),AAHY01209355.1:1..17429,gap(3381),
CO   AAHY01209356.1:1..1598,gap(2120),AAHY01209357.1:1..1423,gap(2015),
CO   AAHY01209358.1:1..3011,gap(484),AAHY01209359.1:1..1179,gap(885),
CO   AAHY01209360.1:1..7170,gap(193),AAHY01209361.1:1..3700,gap(187),
CO   AAHY01209362.1:1..8354,gap(4600),complement(AAHY01209363.1:1..1295),
CO   gap(1031),complement(AAHY01209364.1:1..6944),gap(73),
CO   complement(AAHY01209365.1:1..15263),gap(20),AAHY01209366.1:1..16351,
CO   gap(20),AAHY01209367.1:1..8599,gap(27),AAHY01209368.1:1..955,gap(496),
CO   AAHY01209369.1:1..1335,gap(95),AAHY01209370.1:1..2915,gap(441),
CO   complement(AAHY01209371.1:1..2631),gap(20),
CO   complement(AAHY01209372.1:1..5877),gap(758),
CO   complement(AAHY01209373.1:1..1042),gap(772),
CO   complement(AAHY01209374.1:1..2340),gap(20),AAHY01209375.1:1..1820,gap(20),
CO   complement(AAHY01209376.1:1..3211),gap(20),
CO   complement(AAHY01209377.1:1..4193),gap(152),AAHY01209378.1:1..13536,
CO   gap(86),complement(AAHY01209379.1:1..1631),gap(20),
CO   complement(AAHY01209380.1:1..7514),gap(1127),
CO   complement(AAHY01209381.1:1..15486),gap(29),AAHY01209382.1:1..3832,gap(66),
CO   AAHY01209383.1:1..4820,gap(20),complement(AAHY01209384.1:1..18578),
CO   gap(6204),AAHY01209385.1:1..741,gap(284),
CO   complement(AAHY01209386.1:1..2564),gap(20),
CO   complement(AAHY01209387.1:1..11433),gap(20),
CO   complement(AAHY01209388.1:1..17465),gap(4669),AAHY01209389.1:1..7009,
CO   gap(2600),AAHY01209390.1:1..12705,gap(376),AAHY01209391.1:1..1004,
CO   gap(1528),AAHY01209392.1:1..1584,gap(1054),AAHY01209393.1:1..6095,gap(189),
CO   complement(AAHY01209394.1:1..3636),gap(1000),AAHY01209395.1:1..6901,
CO   gap(2576),complement(AAHY01209396.1:1..1872),gap(20),
CO   AAHY01209397.1:1..4872,gap(20),AAHY01209398.1:1..2559,gap(359),
CO   AAHY01209399.1:1..837,gap(99),AAHY01209400.1:1..21042,gap(20),
CO   AAHY01209401.1:1..24381,gap(20),AAHY01209402.1:1..38395,gap(151),
CO   AAHY01209403.1:1..4798,gap(5011),AAHY01209404.1:1..12818,gap(651),
CO   complement(AAHY01209405.1:1..2671),gap(20),AAHY01209406.1:1..13081,
CO   gap(676),AAHY01209407.1:1..3346,gap(137),AAHY01209408.1:1..7082,gap(96),
CO   complement(AAHY01209409.1:1..2922),gap(1965),AAHY01209410.1:1..22005,
CO   gap(585),AAHY01209411.1:1..10912,gap(947),
CO   complement(AAHY01209412.1:1..2504),gap(20),AAHY01209413.1:1..1083,
CO   gap(5327),AAHY01209414.1:1..5317,gap(126),AAHY01209415.1:1..8498,gap(4103),
CO   AAHY01209416.1:1..5525,gap(20),complement(AAHY01209417.1:1..1345),gap(20),
CO   AAHY01209418.1:1..1967,gap(20),AAHY01209419.1:1..1550,gap(109),
CO   AAHY01209420.1:1..5467,gap(20),complement(AAHY01209421.1:1..4626),
CO   gap(5385),complement(AAHY01209422.1:1..3671),gap(20),
CO   complement(AAHY01209423.1:1..7473),gap(20),AAHY01209424.1:1..11566,gap(20),
CO   AAHY01209425.1:1..17939,gap(1584),AAHY01209426.1:1..4998,gap(517),
CO   AAHY01209427.1:1..1431,gap(20),complement(AAHY01209428.1:1..2372),gap(20),
CO   complement(AAHY01209429.1:1..7254),gap(32),AAHY01209430.1:1..1300,gap(20),
CO   AAHY01209431.1:1..6674,gap(44),complement(AAHY01209432.1:1..2363),gap(20),
CO   AAHY01209433.1:1..1589,gap(2791),AAHY01209434.1:1..7698,gap(20),
CO   AAHY01209435.1:1..7671,gap(454),AAHY01209436.1:1..5416,gap(67),
CO   AAHY01209437.1:1..14712,gap(1237),AAHY01209438.1:1..4140,gap(20),
CO   AAHY01209439.1:1..1081,gap(646),complement(AAHY01209440.1:1..1307),
CO   gap(137),complement(AAHY01209441.1:1..3468),gap(148),
CO   AAHY01209442.1:1..10692,gap(10019),AAHY01209443.1:1..23619,gap(26),
CO   complement(AAHY01209444.1:1..18982),gap(20),AAHY01209445.1:1..6253,gap(20),
CO   AAHY01209446.1:1..16813,gap(20),AAHY01209447.1:1..1368,gap(6586),
CO   AAHY01209448.1:1..31497,gap(230),complement(AAHY01209449.1:1..11091),
CO   gap(786),AAHY01209450.1:1..10230,gap(402),AAHY01209451.1:1..3860,gap(339),
CO   AAHY01209452.1:1..4510,gap(367),complement(AAHY01209453.1:1..12962),
CO   gap(20),AAHY01209454.1:1..8656,gap(204),AAHY01209455.1:1..6493,gap(1181),
CO   AAHY01209456.1:1..11648,gap(27),AAHY01209457.1:1..22798,gap(152),
CO   AAHY01209458.1:1..2389,gap(393),AAHY01209459.1:1..2078,gap(910),
CO   AAHY01209460.1:1..10571,gap(20),AAHY01209461.1:1..36422,gap(249),
CO   AAHY01209462.1:1..4202,gap(535),AAHY01209463.1:1..5262,gap(20),
CO   AAHY01209464.1:1..1025,gap(118),AAHY01209465.1:1..7420,gap(75),
CO   AAHY01209466.1:1..8549,gap(20),AAHY01209467.1:1..11055,gap(20),
CO   AAHY01209468.1:1..3933,gap(20),AAHY01209469.1:1..31912,gap(430),
CO   AAHY01209470.1:1..3857,gap(20),complement(AAHY01209471.1:1..12924),
CO   gap(6972),AAHY01209472.1:1..3053,gap(35),AAHY01209473.1:1..13839,gap(261),
CO   AAHY01209474.1:1..14653,gap(556),AAHY01209475.1:1..8997,gap(20),
CO   AAHY01209476.1:1..1245,gap(20),complement(AAHY01209477.1:1..1444),gap(20),
CO   AAHY01209478.1:1..18457,gap(20),AAHY01209479.1:1..1061,gap(83),
CO   AAHY01209480.1:1..21120,gap(203),AAHY01209481.1:1..1705,gap(1119),
CO   AAHY01209482.1:1..12038,gap(407),complement(AAHY01209483.1:1..2901),
CO   gap(20),AAHY01209484.1:1..1404,gap(20),AAHY01209485.1:1..7103,gap(313),
CO   AAHY01209486.1:1..658,gap(20),AAHY01209487.1:1..14003,gap(20),
CO   AAHY01209488.1:1..20988,gap(1015),complement(AAHY01209489.1:1..11082),
CO   gap(20),complement(AAHY01209490.1:1..2495),gap(120),
CO   AAHY01209491.1:1..21187,gap(20),complement(AAHY01209492.1:1..2113),gap(77),
CO   AAHY01209493.1:1..1047,gap(283),complement(AAHY01209494.1:1..3672),
CO   gap(178),complement(AAHY01209495.1:1..2080),gap(548),
CO   complement(AAHY01209496.1:1..2942),gap(854),
CO   complement(AAHY01209497.1:1..2735),gap(179),
CO   complement(AAHY01209498.1:1..6487),gap(16888),AAHY01209499.1:1..8539,
CO   gap(7118),AAHY01209500.1:1..2088,gap(20),
CO   complement(AAHY01209501.1:1..13041),gap(20),
CO   complement(AAHY01209502.1:1..33330),gap(20),AAHY01209503.1:1..2803,
CO   gap(170),AAHY01209504.1:1..4244,gap(54),complement(AAHY01209505.1:1..9301),
CO   gap(30),AAHY01209506.1:1..19690,gap(20),
CO   complement(AAHY01209507.1:1..16636),gap(28),
CO   complement(AAHY01209508.1:1..11051),gap(6639),
CO   complement(AAHY01209509.1:1..2475),gap(122),AAHY01209510.1:1..985,gap(213),
CO   AAHY01209511.1:1..24659,gap(109),complement(AAHY01209512.1:1..19296),
CO   gap(20),complement(AAHY01209513.1:1..23122),gap(161),
CO   AAHY01209514.1:1..16461,gap(617),AAHY01209515.1:1..2981,gap(20),
CO   complement(AAHY01209516.1:1..13449),gap(141),
CO   complement(AAHY01209517.1:1..1778),gap(20),
CO   complement(AAHY01209518.1:1..13860),gap(42),
CO   complement(AAHY01209519.1:1..3379),gap(781),AAHY01209520.1:1..3391,
CO   gap(723),complement(AAHY01209521.1:1..1292),gap(20),
CO   complement(AAHY01209522.1:1..7899),gap(175),AAHY01209523.1:1..5621,gap(20),
CO   AAHY01209524.1:1..4844,gap(42),AAHY01209525.1:1..2213,gap(764),
CO   AAHY01209526.1:1..2327,gap(1248),complement(AAHY01209527.1:1..23370),
CO   gap(20),complement(AAHY01209528.1:1..6148),gap(193),
CO   AAHY01209529.1:1..33851,gap(20),AAHY01209530.1:1..2437,gap(94),
CO   AAHY01209531.1:1..19451,gap(4691),AAHY01209532.1:1..8666,gap(66),
CO   AAHY01209533.1:1..1348,gap(351),AAHY01209534.1:1..2138,gap(6344),
CO   complement(AAHY01209535.1:1..6523),gap(20),
CO   complement(AAHY01209536.1:1..2045),gap(20),AAHY01209537.1:1..2618,gap(20),
CO   AAHY01209538.1:1..2302,gap(431),complement(AAHY01209539.1:1..1524),
CO   gap(3048),complement(AAHY01209540.1:1..2413),gap(496),
CO   AAHY01209541.1:1..21032,gap(20),AAHY01209542.1:1..4558,gap(109),
CO   AAHY01209543.1:1..1967,gap(211),AAHY01209544.1:1..5491,gap(20),
CO   complement(AAHY01209545.1:1..1573),gap(73),
CO   complement(AAHY01209546.1:1..10166),gap(20),AAHY01209547.1:1..1942,
CO   gap(143),AAHY01209548.1:1..546,gap(20),AAHY01209549.1:1..39775,gap(176),
CO   complement(AAHY01209550.1:1..7409),gap(20),
CO   complement(AAHY01209551.1:1..16068),gap(20),
CO   complement(AAHY01209552.1:1..6995),gap(20),AAHY01209553.1:1..12378,gap(20),
CO   AAHY01209554.1:1..16221,gap(20),AAHY01209555.1:1..7415,gap(725),
CO   complement(AAHY01209556.1:1..7983),gap(20),AAHY01209557.1:1..898,gap(875),
CO   complement(AAHY01209558.1:1..7211),gap(208),AAHY01209559.1:1..24006,
CO   gap(20),complement(AAHY01209560.1:1..12310),gap(207),
CO   AAHY01209561.1:1..1221,gap(20),AAHY01209562.1:1..3334,gap(20),
CO   complement(AAHY01209563.1:1..6865),gap(20),AAHY01209564.1:1..17102,gap(20),
CO   AAHY01209565.1:1..7730,gap(20),complement(AAHY01209566.1:1..4034),gap(158),
CO   complement(AAHY01209567.1:1..3393),gap(1288),
CO   complement(AAHY01209568.1:1..8841),gap(188),
CO   complement(AAHY01209569.1:1..3362),gap(20),
CO   complement(AAHY01209570.1:1..19810),gap(211),
CO   complement(AAHY01209571.1:1..1309),gap(20),AAHY01209572.1:1..2297,gap(20),
CO   AAHY01209573.1:1..3540,gap(20),AAHY01209574.1:1..1046,gap(20),
CO   complement(AAHY01209575.1:1..1506),gap(2811),
CO   complement(AAHY01209576.1:1..4194),gap(88),AAHY01209577.1:1..29368,
CO   gap(1021),complement(AAHY01209578.1:1..8485),gap(20),
CO   AAHY01209579.1:1..1531,gap(1898),AAHY01209580.1:1..1876,gap(45),
CO   AAHY01209581.1:1..13712,gap(220),complement(AAHY01209582.1:1..9537),
CO   gap(20),complement(AAHY01209583.1:1..13845),gap(20),AAHY01209584.1:1..2664,
CO   gap(76),AAHY01209585.1:1..20325,gap(20),AAHY01209586.1:1..10830,gap(20),
CO   AAHY01209587.1:1..17817,gap(336),AAHY01209588.1:1..1347,gap(20),
CO   AAHY01209589.1:1..13878,gap(20),AAHY01209590.1:1..10918,gap(20),
CO   AAHY01209591.1:1..3196,gap(333),complement(AAHY01209592.1:1..7527),gap(20),
CO   complement(AAHY01209593.1:1..23038),gap(59),
CO   complement(AAHY01209594.1:1..7520),gap(183),AAHY01209595.1:1..18583,
CO   gap(108),AAHY01209596.1:1..10806,gap(29),
CO   complement(AAHY01209597.1:1..4690),gap(92),AAHY01209598.1:1..3947,gap(20),
CO   AAHY01209599.1:1..2031,gap(782),complement(AAHY01209600.1:1..1125),
CO   gap(8133),AAHY01209601.1:1..23210,gap(20),AAHY01209602.1:1..20591,
CO   gap(5038),complement(AAHY01209603.1:1..10344),gap(430),
CO   AAHY01209604.1:1..3978,gap(233),AAHY01209605.1:1..16398,gap(3234),
CO   AAHY01209606.1:1..1900,gap(467),AAHY01209607.1:1..3108,gap(20),
CO   AAHY01209608.1:1..9126,gap(224),complement(AAHY01209609.1:1..5582),
CO   gap(136),AAHY01209610.1:1..29095,gap(20),AAHY01209611.1:1..6688,gap(20),
CO   AAHY01209612.1:1..7488,gap(20),AAHY01209613.1:1..7337,gap(20),
CO   AAHY01209614.1:1..54557,gap(20),AAHY01209615.1:1..18671,gap(4139),
CO   AAHY01209616.1:1..3452,gap(20),AAHY01209617.1:1..20138,gap(20),
CO   AAHY01209618.1:1..7657,gap(20),AAHY01209619.1:1..5007,gap(45),
CO   AAHY01209620.1:1..4626,gap(20),AAHY01209621.1:1..20838,gap(1551),
CO   AAHY01209622.1:1..2621,gap(2571),AAHY01209623.1:1..1914,gap(20),
CO   AAHY01209624.1:1..3223,gap(20),complement(AAHY01209625.1:1..7224),gap(20),
CO   AAHY01209626.1:1..1175,gap(20),AAHY01209627.1:1..12908,gap(330),
CO   complement(AAHY01209628.1:1..8200),gap(20),
CO   complement(AAHY01209629.1:1..1421),gap(20),AAHY01209630.1:1..4683,gap(96),
CO   AAHY01209631.1:1..1463,gap(20),AAHY01209632.1:1..39931,gap(120),
CO   AAHY01209633.1:1..6652,gap(20),AAHY01209634.1:1..5922,gap(183),
CO   AAHY01209635.1:1..849,gap(2706),AAHY01209636.1:1..1335,gap(101),
CO   AAHY01209637.1:1..8545,gap(20),AAHY01209638.1:1..3512,gap(142),
CO   AAHY01209639.1:1..16448,gap(74),AAHY01209640.1:1..4902,gap(20),
CO   AAHY01209641.1:1..12385,gap(20),AAHY01209642.1:1..622,gap(394),
CO   AAHY01209643.1:1..7034,gap(20),complement(AAHY01209644.1:1..4065),gap(20),
CO   AAHY01209645.1:1..7634,gap(1098),AAHY01209646.1:1..19335,gap(201),
CO   AAHY01209647.1:1..25313,gap(20),AAHY01209648.1:1..8420,gap(20),
CO   AAHY01209649.1:1..5783,gap(20),AAHY01209650.1:1..6113,gap(63),
CO   complement(AAHY01209651.1:1..5485),gap(20),AAHY01209652.1:1..2427,gap(20),
CO   complement(AAHY01209653.1:1..9709),gap(1937),
CO   complement(AAHY01209654.1:1..808),gap(96),
CO   complement(AAHY01209655.1:1..8440),gap(20),
CO   complement(AAHY01209656.1:1..1604),gap(20),AAHY01209657.1:1..7244,
CO   gap(4091),AAHY01209658.1:1..13168,gap(409),AAHY01209659.1:1..1409,
CO   gap(1874),AAHY01209660.1:1..7700,gap(20),
CO   complement(AAHY01209661.1:1..19929),gap(20),
CO   complement(AAHY01209662.1:1..1231),gap(20),AAHY01209663.1:1..63683,gap(20),
CO   complement(AAHY01209664.1:1..4926),gap(20),
CO   complement(AAHY01209665.1:1..1703),gap(20),AAHY01209666.1:1..1913,gap(665),
CO   complement(AAHY01209667.1:1..1918),gap(394),AAHY01209668.1:1..11918,
CO   gap(694),complement(AAHY01209669.1:1..14517),gap(20),
CO   AAHY01209670.1:1..16351,gap(20),AAHY01209671.1:1..9024,gap(5006),
CO   complement(AAHY01209672.1:1..6957),gap(1034),AAHY01209673.1:1..2942,
CO   gap(892),AAHY01209674.1:1..865,gap(154),complement(AAHY01209675.1:1..2671),
CO   gap(20),AAHY01209676.1:1..17480,gap(20),
CO   complement(AAHY01209677.1:1..12343),gap(47),AAHY01209678.1:1..5060,
CO   gap(419),AAHY01209679.1:1..8071,gap(20),AAHY01209680.1:1..10330,gap(20),
CO   complement(AAHY01209681.1:1..5897),gap(20),
CO   complement(AAHY01209682.1:1..13858),gap(114),
CO   complement(AAHY01209683.1:1..4008),gap(20),
CO   complement(AAHY01209684.1:1..5154),gap(20),AAHY01209685.1:1..5433,gap(20),
CO   complement(AAHY01209686.1:1..5311),gap(247),AAHY01209687.1:1..5791,gap(20),
CO   complement(AAHY01209688.1:1..15901),gap(2159),
CO   complement(AAHY01209689.1:1..1149),gap(731),AAHY01209690.1:1..8906,gap(20),
CO   complement(AAHY01209691.1:1..3229),gap(6696),AAHY01209692.1:1..3362,
CO   gap(177),complement(AAHY01209693.1:1..7723),gap(143),
CO   complement(AAHY01209694.1:1..3861),gap(20),
CO   complement(AAHY01209695.1:1..2301),gap(20),
CO   complement(AAHY01209696.1:1..7846),gap(96),
CO   complement(AAHY01209697.1:1..28385),gap(189),
CO   complement(AAHY01209698.1:1..2552),gap(824),
CO   complement(AAHY01209699.1:1..4067),gap(815),AAHY01209700.1:1..8906,gap(20),
CO   complement(AAHY01209701.1:1..25594),gap(20),AAHY01209702.1:1..35151,
CO   gap(225),complement(AAHY01209703.1:1..5678),gap(33),AAHY01209704.1:1..901,
CO   gap(426),AAHY01209705.1:1..5748,gap(415),AAHY01209706.1:1..9705,gap(59),
CO   complement(AAHY01209707.1:1..43680),gap(122),
CO   complement(AAHY01209708.1:1..6356),gap(20),AAHY01209709.1:1..2294,gap(26),
CO   AAHY01209710.1:1..2918,gap(20),AAHY01209711.1:1..2434,gap(422),
CO   AAHY01209712.1:1..2873,gap(6162),AAHY01209713.1:1..14393,gap(20),
CO   AAHY01209714.1:1..19392,gap(177),AAHY01209715.1:1..14879,gap(447),
CO   AAHY01209716.1:1..838,gap(20),AAHY01209717.1:1..1202,gap(636),
CO   AAHY01209718.1:1..2827,gap(20),AAHY01209719.1:1..2253,gap(515),
CO   complement(AAHY01209720.1:1..802),gap(3201),AAHY01209721.1:1..8771,
CO   gap(419),AAHY01209722.1:1..2945,gap(20),AAHY01209723.1:1..8942,gap(20),
CO   AAHY01209724.1:1..3039,gap(20),AAHY01209725.1:1..40020,gap(20),
CO   AAHY01209726.1:1..13391,gap(20),complement(AAHY01209727.1:1..1512),gap(20),
CO   AAHY01209728.1:1..14270,gap(499),AAHY01209729.1:1..4516,gap(94),
CO   AAHY01209730.1:1..13389,gap(20),AAHY01209731.1:1..6676,gap(20),
CO   AAHY01209732.1:1..1671,gap(155),AAHY01209733.1:1..1538,gap(1075),
CO   complement(AAHY01209734.1:1..1629),gap(597),AAHY01209735.1:1..2274,gap(20),
CO   complement(AAHY01209736.1:1..3248),gap(20),
CO   complement(AAHY01209737.1:1..12354),gap(20),
CO   complement(AAHY01209738.1:1..6603),gap(20),
CO   complement(AAHY01209739.1:1..4830),gap(96),
CO   complement(AAHY01209740.1:1..5394),gap(364),AAHY01209741.1:1..30171,
CO   gap(79),complement(AAHY01209742.1:1..5640),gap(387),AAHY01209743.1:1..4371,
CO   gap(20),AAHY01209744.1:1..15025,gap(20),AAHY01209745.1:1..8909,gap(20),
CO   complement(AAHY01209746.1:1..4845),gap(443),AAHY01209747.1:1..27230,
CO   gap(20),complement(AAHY01209748.1:1..2322),gap(507),
CO   AAHY01209749.1:1..36336,gap(120),complement(AAHY01209750.1:1..7410),
CO   gap(20),AAHY01209751.1:1..1183,gap(252),complement(AAHY01209752.1:1..2124),
CO   gap(313),AAHY01209753.1:1..19877,gap(2141),AAHY01209754.1:1..5212,gap(20),
CO   AAHY01209755.1:1..15087,gap(3776),AAHY01209756.1:1..33693,gap(20),
CO   AAHY01209757.1:1..20797,gap(181),AAHY01209758.1:1..13529,gap(488),
CO   complement(AAHY01209759.1:1..1926),gap(20),AAHY01209760.1:1..10470,
CO   gap(524),AAHY01209761.1:1..9764,gap(177),AAHY01209762.1:1..18313,gap(739),
CO   AAHY01209763.1:1..1086,gap(20),AAHY01209764.1:1..5892,gap(202),
CO   AAHY01209765.1:1..6183,gap(363),AAHY01209766.1:1..23151,gap(20),
CO   AAHY01209767.1:1..20480,gap(645),complement(AAHY01209768.1:1..8343),
CO   gap(20),complement(AAHY01209769.1:1..19369),gap(265),
CO   complement(AAHY01209770.1:1..38033),gap(20),AAHY01209771.1:1..4526,
CO   gap(327),AAHY01209772.1:1..20967,gap(20),AAHY01209773.1:1..34452,gap(389),
CO   complement(AAHY01209774.1:1..33339),gap(20),
CO   complement(AAHY01209775.1:1..6114),gap(20),AAHY01209776.1:1..12505,gap(59),
CO   AAHY01209777.1:1..15163,gap(20),AAHY01209778.1:1..8921,gap(113),
CO   AAHY01209779.1:1..8137,gap(20),AAHY01209780.1:1..2266,gap(276),
CO   complement(AAHY01209781.1:1..1578),gap(20),AAHY01209782.1:1..6464,gap(183),
CO   AAHY01209783.1:1..12720,gap(20),AAHY01209784.1:1..20195,gap(179),
CO   AAHY01209785.1:1..7833,gap(20),AAHY01209786.1:1..2198,gap(103),
CO   complement(AAHY01209787.1:1..9770),gap(200),
CO   complement(AAHY01209788.1:1..2724),gap(20),AAHY01209789.1:1..5420,gap(20),
CO   complement(AAHY01209790.1:1..7611),gap(33),AAHY01209791.1:1..2353,gap(20),
CO   AAHY01209792.1:1..2085,gap(207),AAHY01209793.1:1..2481,gap(24),
CO   AAHY01209794.1:1..5119,gap(20),AAHY01209795.1:1..3155,gap(42),
CO   AAHY01209796.1:1..7128,gap(182),AAHY01209797.1:1..961,gap(850),
CO   complement(AAHY01209798.1:1..2753),gap(4122),AAHY01209799.1:1..9113,
CO   gap(352),complement(AAHY01209800.1:1..3420),gap(20),AAHY01209801.1:1..2054,
CO   gap(20),AAHY01209802.1:1..8315,gap(166),AAHY01209803.1:1..6615,gap(1115),
CO   AAHY01209804.1:1..1738,gap(154),complement(AAHY01209805.1:1..1163),
CO   gap(772),AAHY01209806.1:1..6506,gap(639),
CO   complement(AAHY01209807.1:1..1113),gap(1051),AAHY01209808.1:1..4247,
CO   gap(629),AAHY01209809.1:1..3443,gap(514),AAHY01209810.1:1..5823,gap(36),
CO   AAHY01209811.1:1..7743,gap(737),complement(AAHY01209812.1:1..13358),
CO   gap(20),AAHY01209813.1:1..15151,gap(20),AAHY01209814.1:1..15944,gap(20),
CO   AAHY01209815.1:1..6454,gap(329),complement(AAHY01209816.1:1..3155),
CO   gap(205),AAHY01209817.1:1..5124,gap(641),AAHY01209818.1:1..6077,gap(20),
CO   AAHY01209819.1:1..19350,gap(20),complement(AAHY01209820.1:1..2456),
CO   gap(1049),AAHY01209821.1:1..2595,gap(20),
CO   complement(AAHY01209822.1:1..1751),gap(1184),AAHY01209823.1:1..5796,
CO   gap(145),AAHY01209824.1:1..2432,gap(20),AAHY01209825.1:1..774,gap(908),
CO   AAHY01209826.1:1..7096,gap(2201),AAHY01209827.1:1..12101,gap(732),
CO   complement(AAHY01209828.1:1..5702),gap(655),
CO   complement(AAHY01209829.1:1..1037),gap(20),
CO   complement(AAHY01209830.1:1..12236),gap(20),AAHY01209831.1:1..7247,gap(20),
CO   AAHY01209832.1:1..3729,gap(20),AAHY01209833.1:1..7842,gap(77),
CO   complement(AAHY01209834.1:1..1072),gap(79),
CO   complement(AAHY01209835.1:1..1898),gap(292),
CO   complement(AAHY01209836.1:1..1382),gap(896),AAHY01209837.1:1..6050,gap(20),
CO   AAHY01209838.1:1..8676,gap(20),AAHY01209839.1:1..10567,gap(117),
CO   AAHY01209840.1:1..5255,gap(749),AAHY01209841.1:1..2345,gap(482),
CO   complement(AAHY01209842.1:1..1480),gap(20),
CO   complement(AAHY01209843.1:1..1574),gap(798),AAHY01209844.1:1..1507,
CO   gap(322),AAHY01209845.1:1..21928,gap(3677),AAHY01209846.1:1..2318,gap(747),
CO   complement(AAHY01209847.1:1..1446),gap(1079),AAHY01209848.1:1..1703,
CO   gap(20),AAHY01209849.1:1..3510,gap(681),AAHY01209850.1:1..1316,gap(20),
CO   complement(AAHY01209851.1:1..4032),gap(979),AAHY01209852.1:1..5075,gap(20),
CO   AAHY01209853.1:1..12485,gap(230),AAHY01209854.1:1..4065,gap(20),
CO   complement(AAHY01209855.1:1..1033),gap(145),AAHY01209856.1:1..2996,
CO   gap(1091),AAHY01209857.1:1..5855,gap(105),AAHY01209858.1:1..6993,gap(180),
CO   AAHY01209859.1:1..4783,gap(20),complement(AAHY01209860.1:1..23543),gap(20),
CO   AAHY01209861.1:1..13956,gap(37),AAHY01209862.1:1..3429,gap(2045),
CO   AAHY01209863.1:1..12777,gap(308),AAHY01209864.1:1..21071,gap(25785),
CO   AAHY01209865.1:1..1490,gap(20),complement(AAHY01209866.1:1..1115),
CO   gap(3042),AAHY01209867.1:1..1110,gap(20),AAHY01209868.1:1..18577,gap(190),
CO   complement(AAHY01209869.1:1..2147),gap(362),
CO   complement(AAHY01209870.1:1..27505),gap(20),
CO   complement(AAHY01209871.1:1..16523),gap(530),
CO   complement(AAHY01209872.1:1..1426),gap(41),AAHY01209873.1:1..11072,
CO   gap(1720),AAHY01209874.1:1..13907,gap(20),
CO   complement(AAHY01209875.1:1..2486),gap(724),AAHY01209876.1:1..2157,gap(20),
CO   complement(AAHY01209877.1:1..31724),gap(38),
CO   complement(AAHY01209878.1:1..4298),gap(20),
CO   complement(AAHY01209879.1:1..2252),gap(20),AAHY01209880.1:1..20868,
CO   gap(312),complement(AAHY01209881.1:1..4061),gap(819),
CO   complement(AAHY01209882.1:1..4401),gap(179),
CO   complement(AAHY01209883.1:1..3466),gap(20),AAHY01209884.1:1..3259,gap(20),
CO   complement(AAHY01209885.1:1..4922),gap(1263),AAHY01209886.1:1..1074,
CO   gap(20),AAHY01209887.1:1..2099,gap(20),complement(AAHY01209888.1:1..4363),
CO   gap(489),AAHY01209889.1:1..1165,gap(2898),AAHY01209890.1:1..1251,gap(229),
CO   AAHY01209891.1:1..42575,gap(128),complement(AAHY01209892.1:1..1141),
CO   gap(153),AAHY01209893.1:1..13535,gap(20),AAHY01209894.1:1..11610,gap(122),
CO   AAHY01209895.1:1..1798,gap(20),complement(AAHY01209896.1:1..17350),
CO   gap(283),complement(AAHY01209897.1:1..50583),gap(57),
CO   AAHY01209898.1:1..5789,gap(20),AAHY01209899.1:1..2117,gap(20),
CO   complement(AAHY01209900.1:1..12242),gap(340),
CO   complement(AAHY01209901.1:1..1236),gap(812),AAHY01209902.1:1..5730,gap(20),
CO   complement(AAHY01209903.1:1..25153),gap(20),AAHY01209904.1:1..4218,
CO   gap(129),complement(AAHY01209905.1:1..4502),gap(20),AAHY01209906.1:1..1806,
CO   gap(196),complement(AAHY01209907.1:1..21626),gap(20),
CO   complement(AAHY01209908.1:1..1013),gap(120),
CO   complement(AAHY01209909.1:1..3251),gap(20),AAHY01209910.1:1..2771,
CO   gap(1678),AAHY01209911.1:1..33262,gap(891),AAHY01209912.1:1..5235,gap(347),
CO   AAHY01209913.1:1..28934,gap(1110),complement(AAHY01209914.1:1..14174),
CO   gap(20),complement(AAHY01209915.1:1..1633),gap(28),
CO   complement(AAHY01209916.1:1..9604),gap(403),AAHY01209917.1:1..1560,gap(20),
CO   AAHY01209918.1:1..4647,gap(20),complement(AAHY01209919.1:1..2508),gap(20),
CO   AAHY01209920.1:1..3070,gap(104),complement(AAHY01209921.1:1..688),gap(549),
CO   AAHY01209922.1:1..2633,gap(822),AAHY01209923.1:1..36867,gap(20),
CO   complement(AAHY01209924.1:1..14803),gap(20),
CO   complement(AAHY01209925.1:1..388),gap(20),AAHY01209926.1:1..13511,gap(993),
CO   complement(AAHY01209927.1:1..3411),gap(29),AAHY01209928.1:1..10878,
CO   gap(2661),AAHY01209929.1:1..6915,gap(20),
CO   complement(AAHY01209930.1:1..1879),gap(389),AAHY01209931.1:1..3191,
CO   gap(231),AAHY01209932.1:1..22704,gap(20),AAHY01209933.1:1..4942,gap(20),
CO   AAHY01209934.1:1..1535,gap(312),AAHY01209935.1:1..3412,gap(103),
CO   AAHY01209936.1:1..17462,gap(136),AAHY01209937.1:1..19689,gap(20),
CO   AAHY01209938.1:1..3148,gap(1109),AAHY01209939.1:1..1927,gap(20),
CO   AAHY01209940.1:1..16062,gap(461),complement(AAHY01209941.1:1..19129),
CO   gap(20),AAHY01209942.1:1..9942,gap(50),AAHY01209943.1:1..8663,gap(20),
CO   AAHY01209944.1:1..6573,gap(181),AAHY01209945.1:1..37836,gap(133),
CO   AAHY01209946.1:1..6781,gap(649),AAHY01209947.1:1..8256,gap(1021),
CO   AAHY01209948.1:1..7912,gap(20),AAHY01209949.1:1..1093,gap(1594),
CO   complement(AAHY01209950.1:1..1767),gap(92),
CO   complement(AAHY01209951.1:1..1722),gap(20),
CO   complement(AAHY01209952.1:1..11972),gap(120),AAHY01209953.1:1..16198,
CO   gap(10662),complement(AAHY01209954.1:1..1441),gap(20),
CO   complement(AAHY01209955.1:1..11996),gap(20),AAHY01209956.1:1..12229,
CO   gap(425),complement(AAHY01209957.1:1..2849),gap(141),
CO   AAHY01209958.1:1..2205,gap(875),AAHY01209959.1:1..2143,gap(1457),
CO   complement(AAHY01209960.1:1..18503),gap(97),
CO   complement(AAHY01209961.1:1..2647),gap(47),
CO   complement(AAHY01209962.1:1..20480),gap(20),
CO   complement(AAHY01209963.1:1..8071),gap(544),
CO   complement(AAHY01209964.1:1..889),gap(895),AAHY01209965.1:1..18075,gap(20),
CO   AAHY01209966.1:1..6085,gap(688),complement(AAHY01209967.1:1..3476),gap(74),
CO   complement(AAHY01209968.1:1..20654),gap(20),AAHY01209969.1:1..11124,
CO   gap(20),complement(AAHY01209970.1:1..8048),gap(20),AAHY01209971.1:1..27189,
CO   gap(95),complement(AAHY01209972.1:1..3528),gap(281),
CO   complement(AAHY01209973.1:1..1940),gap(98),
CO   complement(AAHY01209974.1:1..28096),gap(183),AAHY01209975.1:1..10143,
CO   gap(926),AAHY01209976.1:1..7560,gap(2484),AAHY01209977.1:1..9900,gap(2777),
CO   AAHY01209978.1:1..3215,gap(20),AAHY01209979.1:1..2680,gap(20),
CO   AAHY01209980.1:1..5622,gap(1085),complement(AAHY01209981.1:1..1951),
CO   gap(344),complement(AAHY01209982.1:1..3165),gap(153),
CO   AAHY01209983.1:1..11902,gap(6463),AAHY01209984.1:1..11272,gap(20),
CO   AAHY01209985.1:1..13569,gap(113),complement(AAHY01209986.1:1..4543),
CO   gap(20),complement(AAHY01209987.1:1..3841),gap(437),
CO   complement(AAHY01209988.1:1..638),gap(252),AAHY01209989.1:1..10150,gap(20),
CO   complement(AAHY01209990.1:1..5442),gap(2212),AAHY01209991.1:1..1884,
CO   gap(515),AAHY01209992.1:1..2304,gap(20),complement(AAHY01209993.1:1..1327),
CO   gap(1995),complement(AAHY01209994.1:1..6419),gap(20),
CO   complement(AAHY01209995.1:1..9237),gap(11968),
CO   complement(AAHY01209996.1:1..3479),gap(20),
CO   complement(AAHY01209997.1:1..2507),gap(38),AAHY01209998.1:1..6007,gap(413),
CO   AAHY01209999.1:1..5038,gap(254),complement(AAHY01210000.1:1..4960),
CO   gap(555),complement(AAHY01210001.1:1..1831),gap(20),AAHY01210002.1:1..9712,
CO   gap(103),AAHY01210003.1:1..3701,gap(160),AAHY01210004.1:1..11560,gap(20),
CO   AAHY01210005.1:1..15415,gap(4814),AAHY01210006.1:1..7689,gap(1344),
CO   AAHY01210007.1:1..8491,gap(2885),AAHY01210008.1:1..7744,gap(20),
CO   complement(AAHY01210009.1:1..9209),gap(20),AAHY01210010.1:1..2213,
CO   gap(1324),AAHY01210011.1:1..1014,gap(1115),
CO   complement(AAHY01210012.1:1..1761),gap(20),AAHY01210013.1:1..2315,gap(20),
CO   AAHY01210014.1:1..1968,gap(4720),AAHY01210015.1:1..17140,gap(20),
CO   AAHY01210016.1:1..1395,gap(833),AAHY01210017.1:1..7492,gap(32),
CO   complement(AAHY01210018.1:1..1419),gap(20),AAHY01210019.1:1..5199,gap(445),
CO   complement(AAHY01210020.1:1..7826),gap(1429),AAHY01210021.1:1..1813,
CO   gap(591),AAHY01210022.1:1..7217,gap(314),AAHY01210023.1:1..3171,gap(20),
CO   AAHY01210024.1:1..4539,gap(20),AAHY01210025.1:1..41084,gap(20),
CO   AAHY01210026.1:1..6232,gap(121),AAHY01210027.1:1..12437,gap(5138),
CO   AAHY01210028.1:1..3484,gap(20),AAHY01210029.1:1..3078,gap(873),
CO   AAHY01210030.1:1..2793,gap(20),complement(AAHY01210031.1:1..17105),
CO   gap(156),AAHY01210032.1:1..4281,gap(62),AAHY01210033.1:1..4173,gap(3673),
CO   AAHY01210034.1:1..6565,gap(534),AAHY01210035.1:1..498,gap(748),
CO   AAHY01210036.1:1..5234,gap(369),AAHY01210037.1:1..1914,gap(2428),
CO   complement(AAHY01210038.1:1..733),gap(1533),AAHY01210039.1:1..2497,
CO   gap(115),complement(AAHY01210040.1:1..1415),gap(20),
CO   AAHY01210041.1:1..10228,gap(20),AAHY01210042.1:1..23152,gap(20),
CO   AAHY01210043.1:1..5491,gap(20),AAHY01210044.1:1..21753,gap(38),
CO   AAHY01210045.1:1..18394,gap(3823),AAHY01210046.1:1..859,gap(505),
CO   AAHY01210047.1:1..1165,gap(541),AAHY01210048.1:1..1774,gap(257),
CO   AAHY01210049.1:1..1505,gap(20),AAHY01210050.1:1..1656,gap(3890),
CO   complement(AAHY01210051.1:1..1979),gap(20),AAHY01210052.1:1..6384,gap(443),
CO   complement(AAHY01210053.1:1..4792),gap(95),AAHY01210054.1:1..4213,gap(20),
CO   AAHY01210055.1:1..11839,gap(731),complement(AAHY01210056.1:1..3190),
CO   gap(20),AAHY01210057.1:1..12201,gap(34),
CO   complement(AAHY01210058.1:1..24091),gap(20),
CO   complement(AAHY01210059.1:1..9699),gap(20),
CO   complement(AAHY01210060.1:1..5819),gap(20),
CO   complement(AAHY01210061.1:1..5213),gap(555),AAHY01210062.1:1..6225,gap(39),
CO   AAHY01210063.1:1..6796,gap(2240),AAHY01210064.1:1..13598,gap(34),
CO   complement(AAHY01210065.1:1..625),gap(20),AAHY01210066.1:1..7116,gap(20),
CO   AAHY01210067.1:1..1290,gap(448),AAHY01210068.1:1..4348,gap(84),
CO   AAHY01210069.1:1..4337,gap(149),AAHY01210070.1:1..5031,gap(40),
CO   complement(AAHY01210071.1:1..3444),gap(20),AAHY01210072.1:1..18413,gap(20),
CO   AAHY01210073.1:1..42599,gap(1432),AAHY01210074.1:1..20505,gap(324),
CO   AAHY01210075.1:1..1550,gap(1583),AAHY01210076.1:1..18487,gap(20),
CO   AAHY01210077.1:1..28887,gap(20),AAHY01210078.1:1..1239,gap(824),
CO   AAHY01210079.1:1..5637,gap(470),complement(AAHY01210080.1:1..1738),
CO   gap(4011),AAHY01210081.1:1..18063,gap(179),AAHY01210082.1:1..4831,gap(20),
CO   AAHY01210083.1:1..19702,gap(35),AAHY01210084.1:1..5223,gap(20),
CO   AAHY01210085.1:1..4072,gap(20),complement(AAHY01210086.1:1..629),gap(1655),
CO   complement(AAHY01210087.1:1..1518),gap(20),AAHY01210088.1:1..11817,
CO   gap(152),complement(AAHY01210089.1:1..10984),gap(192),
CO   AAHY01210090.1:1..1471,gap(21),AAHY01210091.1:1..1695,gap(924),
CO   complement(AAHY01210092.1:1..2212),gap(49),AAHY01210093.1:1..14314,
CO   gap(706),complement(AAHY01210094.1:1..3352),gap(253),
CO   AAHY01210095.1:1..17111,gap(20),AAHY01210096.1:1..25775,gap(20),
CO   AAHY01210097.1:1..9517,gap(97),complement(AAHY01210098.1:1..3164),gap(20),
CO   AAHY01210099.1:1..11232,gap(92),AAHY01210100.1:1..6477,gap(20),
CO   complement(AAHY01210101.1:1..1503),gap(1207),
CO   complement(AAHY01210102.1:1..7320),gap(20),AAHY01210103.1:1..13006,
CO   gap(624),complement(AAHY01210104.1:1..3176),gap(20),AAHY01210105.1:1..8787,
CO   gap(709),complement(AAHY01210106.1:1..5486),gap(978),
CO   complement(AAHY01210107.1:1..3559),gap(854),
CO   complement(AAHY01210108.1:1..8239),gap(20),AAHY01210109.1:1..3858,gap(86),
CO   complement(AAHY01210110.1:1..6873),gap(121),AAHY01210111.1:1..3257,gap(20),
CO   AAHY01210112.1:1..1337,gap(27),complement(AAHY01210113.1:1..2718),gap(30),
CO   AAHY01210114.1:1..9494,gap(273),AAHY01210115.1:1..385,gap(274),
CO   AAHY01210116.1:1..6005,gap(97),AAHY01210117.1:1..6335,gap(713),
CO   AAHY01210118.1:1..1993,gap(112),AAHY01210119.1:1..11266,gap(429),
CO   AAHY01210120.1:1..10546,gap(51),complement(AAHY01210121.1:1..3919),gap(20),
CO   AAHY01210122.1:1..9107,gap(20),AAHY01210123.1:1..1597,gap(20),
CO   AAHY01210124.1:1..61744,gap(530),AAHY01210125.1:1..8691,gap(20),
CO   AAHY01210126.1:1..5416,gap(709),AAHY01210127.1:1..15265,gap(59),
CO   AAHY01210128.1:1..7158,gap(20),AAHY01210129.1:1..5302,gap(128),
CO   complement(AAHY01210130.1:1..1153),gap(107),
CO   complement(AAHY01210131.1:1..2796),gap(20),AAHY01210132.1:1..17936,gap(20),
CO   AAHY01210133.1:1..1209,gap(2355),complement(AAHY01210134.1:1..748),
CO   gap(2877),AAHY01210135.1:1..2229,gap(119),AAHY01210136.1:1..5400,gap(5188),
CO   AAHY01210137.1:1..4283,gap(150),complement(AAHY01210138.1:1..8013),
CO   gap(817),complement(AAHY01210139.1:1..7416),gap(94),AAHY01210140.1:1..9119,
CO   gap(126),AAHY01210141.1:1..3081,gap(60),complement(AAHY01210142.1:1..4286),
CO   gap(393),complement(AAHY01210143.1:1..6057),gap(1685),
CO   AAHY01210144.1:1..4591,gap(20),complement(AAHY01210145.1:1..1908),gap(769),
CO   AAHY01210146.1:1..6157,gap(22),AAHY01210147.1:1..1593,gap(20),
CO   AAHY01210148.1:1..1953,gap(32),AAHY01210149.1:1..12815,gap(724),
CO   AAHY01210150.1:1..2158,gap(1764),AAHY01210151.1:1..2708,gap(452),
CO   AAHY01210152.1:1..339,gap(210),AAHY01210153.1:1..3129,gap(20),
CO   AAHY01210154.1:1..14323,gap(56),AAHY01210155.1:1..2540,gap(193),
CO   complement(AAHY01210156.1:1..24563),gap(434),AAHY01210157.1:1..2458,
CO   gap(184),complement(AAHY01210158.1:1..21847),gap(20),
CO   complement(AAHY01210159.1:1..1586),gap(20),AAHY01210160.1:1..6468,
CO   gap(4903),complement(AAHY01210161.1:1..12685),gap(20),
CO   AAHY01210162.1:1..3228,gap(177),complement(AAHY01210163.1:1..4515),gap(62),
CO   complement(AAHY01210164.1:1..28579),gap(220),AAHY01210165.1:1..11642,
CO   gap(20),complement(AAHY01210166.1:1..7434),gap(20),
CO   complement(AAHY01210167.1:1..5506),gap(68),AAHY01210168.1:1..3933,gap(108),
CO   AAHY01210169.1:1..8948,gap(818),complement(AAHY01210170.1:1..14025),
CO   gap(20),complement(AAHY01210171.1:1..1780),gap(67),
CO   complement(AAHY01210172.1:1..2626),gap(135),
CO   complement(AAHY01210173.1:1..3204),gap(176),AAHY01210174.1:1..16820,
CO   gap(3472),complement(AAHY01210175.1:1..47736),gap(71),
CO   complement(AAHY01210176.1:1..34328),gap(20),AAHY01210177.1:1..52873,
CO   gap(43),AAHY01210178.1:1..22902,gap(5588),AAHY01210179.1:1..35640,gap(468),
CO   complement(AAHY01210180.1:1..7594),gap(20),AAHY01210181.1:1..4718,gap(680),
CO   AAHY01210182.1:1..1184,gap(20),complement(AAHY01210183.1:1..2219),gap(209),
CO   AAHY01210184.1:1..3181,gap(44),AAHY01210185.1:1..15709,gap(109),
CO   complement(AAHY01210186.1:1..3061),gap(20),AAHY01210187.1:1..39056,
CO   gap(112),complement(AAHY01210188.1:1..4881),gap(278),
CO   complement(AAHY01210189.1:1..4341),gap(20),
CO   complement(AAHY01210190.1:1..1431),gap(242),
CO   complement(AAHY01210191.1:1..4644),gap(29),
CO   complement(AAHY01210192.1:1..13567),gap(148),AAHY01210193.1:1..8086,
CO   gap(682),AAHY01210194.1:1..1927,gap(20),AAHY01210195.1:1..1527,gap(224),
CO   complement(AAHY01210196.1:1..15134),gap(60),
CO   complement(AAHY01210197.1:1..9476),gap(2499),AAHY01210198.1:1..2992,
CO   gap(7875),complement(AAHY01210199.1:1..1240),gap(20),
CO   AAHY01210200.1:1..2163,gap(177),complement(AAHY01210201.1:1..7011),gap(20),
CO   complement(AAHY01210202.1:1..9103),gap(20),
CO   complement(AAHY01210203.1:1..13188),gap(281),
CO   complement(AAHY01210204.1:1..5403),gap(64),
CO   complement(AAHY01210205.1:1..2932),gap(414),
CO   complement(AAHY01210206.1:1..10394),gap(167),AAHY01210207.1:1..6988,
CO   gap(20),AAHY01210208.1:1..8664,gap(20),AAHY01210209.1:1..2736,gap(396),
CO   complement(AAHY01210210.1:1..7120),gap(63),AAHY01210211.1:1..1160,
CO   gap(3435),complement(AAHY01210212.1:1..11213),gap(20),
CO   AAHY01210213.1:1..2902,gap(105),AAHY01210214.1:1..1789,gap(1500),
CO   complement(AAHY01210215.1:1..1351),gap(20),
CO   complement(AAHY01210216.1:1..3661),gap(337),
CO   complement(AAHY01210217.1:1..698),gap(513),AAHY01210218.1:1..5044,gap(463),
CO   complement(AAHY01210219.1:1..1405),gap(192),
CO   complement(AAHY01210220.1:1..1283),gap(527),
CO   complement(AAHY01210221.1:1..2121),gap(20),
CO   complement(AAHY01210222.1:1..1442),gap(20),AAHY01210223.1:1..7603,gap(481),
CO   complement(AAHY01210224.1:1..26575),gap(42),AAHY01210225.1:1..1491,
CO   gap(151),complement(AAHY01210226.1:1..11119),gap(20),
CO   AAHY01210227.1:1..2742,gap(236),complement(AAHY01210228.1:1..6658),
CO   gap(181),AAHY01210229.1:1..21047,gap(212),AAHY01210230.1:1..24231,gap(75),
CO   AAHY01210231.1:1..3790,gap(20),AAHY01210232.1:1..17553,gap(232),
CO   AAHY01210233.1:1..1174,gap(227),AAHY01210234.1:1..2328,gap(772),
CO   AAHY01210235.1:1..3954,gap(59),complement(AAHY01210236.1:1..1259),gap(271),
CO   complement(AAHY01210237.1:1..16912),gap(20),AAHY01210238.1:1..2311,gap(20),
CO   AAHY01210239.1:1..12996,gap(760),AAHY01210240.1:1..2634,gap(20),
CO   AAHY01210241.1:1..1175,gap(84),complement(AAHY01210242.1:1..5839),gap(20),
CO   complement(AAHY01210243.1:1..1658),gap(55),
CO   complement(AAHY01210244.1:1..11093),gap(43),
CO   complement(AAHY01210245.1:1..10299),gap(366),AAHY01210246.1:1..7354,
CO   gap(20),AAHY01210247.1:1..32125,gap(979),
CO   complement(AAHY01210248.1:1..12881),gap(20),AAHY01210249.1:1..3083,gap(35),
CO   complement(AAHY01210250.1:1..4344),gap(20),
CO   complement(AAHY01210251.1:1..26995),gap(20),AAHY01210252.1:1..3700,
CO   gap(2704),complement(AAHY01210253.1:1..3722),gap(5971),
CO   AAHY01210254.1:1..3586,gap(202),complement(AAHY01210255.1:1..10003),
CO   gap(20),AAHY01210256.1:1..2058,gap(20),complement(AAHY01210257.1:1..3608),
CO   gap(195),complement(AAHY01210258.1:1..8103),gap(590),
CO   complement(AAHY01210259.1:1..4102),gap(154),
CO   complement(AAHY01210260.1:1..15881),gap(20),
CO   complement(AAHY01210261.1:1..10578),gap(516),AAHY01210262.1:1..8959,
CO   gap(146),complement(AAHY01210263.1:1..11875),gap(20),
CO   AAHY01210264.1:1..11620,gap(20),complement(AAHY01210265.1:1..13204),
CO   gap(133),complement(AAHY01210266.1:1..16089),gap(20),
CO   AAHY01210267.1:1..25366,gap(80),complement(AAHY01210268.1:1..6428),
CO   gap(831),complement(AAHY01210269.1:1..5615),gap(20),AAHY01210270.1:1..4582,
CO   gap(611),complement(AAHY01210271.1:1..56010),gap(78),
CO   complement(AAHY01210272.1:1..12891),gap(20),
CO   complement(AAHY01210273.1:1..3877),gap(288),
CO   complement(AAHY01210274.1:1..18543),gap(690),
CO   complement(AAHY01210275.1:1..11606),gap(884),
CO   complement(AAHY01210276.1:1..2905),gap(20),
CO   complement(AAHY01210277.1:1..14161),gap(20),AAHY01210278.1:1..3854,gap(20),
CO   AAHY01210279.1:1..6472,gap(20),complement(AAHY01210280.1:1..12738),gap(97),
CO   AAHY01210281.1:1..22959,gap(42),complement(AAHY01210282.1:1..6160),gap(20),
CO   complement(AAHY01210283.1:1..7988),gap(325),AAHY01210284.1:1..1249,
CO   gap(1432),AAHY01210285.1:1..3950,gap(1006),AAHY01210286.1:1..3624,gap(259),
CO   complement(AAHY01210287.1:1..6028),gap(20),
CO   complement(AAHY01210288.1:1..949),gap(321),AAHY01210289.1:1..8084,gap(20),
CO   AAHY01210290.1:1..1162,gap(200),AAHY01210291.1:1..18449,gap(20),
CO   complement(AAHY01210292.1:1..6255),gap(479),
CO   complement(AAHY01210293.1:1..1320),gap(59),AAHY01210294.1:1..1789,gap(709),
CO   complement(AAHY01210295.1:1..3439),gap(886),
CO   complement(AAHY01210296.1:1..3209),gap(20),
CO   complement(AAHY01210297.1:1..2780),gap(217),AAHY01210298.1:1..548,gap(20),
CO   complement(AAHY01210299.1:1..3796),gap(78),
CO   complement(AAHY01210300.1:1..3700),gap(227),
CO   complement(AAHY01210301.1:1..1854),gap(20),
CO   complement(AAHY01210302.1:1..12777),gap(20),
CO   complement(AAHY01210303.1:1..17126),gap(20),AAHY01210304.1:1..2101,gap(20),
CO   AAHY01210305.1:1..3238,gap(1548),complement(AAHY01210306.1:1..3569),
CO   gap(20),AAHY01210307.1:1..3512,gap(356),AAHY01210308.1:1..5751,gap(87),
CO   AAHY01210309.1:1..2930,gap(77),complement(AAHY01210310.1:1..9194),gap(194),
CO   complement(AAHY01210311.1:1..1041),gap(223),
CO   complement(AAHY01210312.1:1..9697),gap(602),AAHY01210313.1:1..1411,gap(20),
CO   AAHY01210314.1:1..13374,gap(92),AAHY01210315.1:1..4902,gap(392),
CO   complement(AAHY01210316.1:1..8426),gap(20),AAHY01210317.1:1..1888,gap(62),
CO   complement(AAHY01210318.1:1..2235),gap(2376),AAHY01210319.1:1..10466,
CO   gap(20),AAHY01210320.1:1..7432,gap(348),AAHY01210321.1:1..931,gap(84),
CO   complement(AAHY01210322.1:1..3975),gap(43),
CO   complement(AAHY01210323.1:1..10214),gap(62),AAHY01210324.1:1..2661,gap(20),
CO   AAHY01210325.1:1..19010,gap(20),AAHY01210326.1:1..2905,gap(279),
CO   AAHY01210327.1:1..1380,gap(20),AAHY01210328.1:1..2765,gap(212),
CO   complement(AAHY01210329.1:1..900),gap(282),AAHY01210330.1:1..13206,
CO   gap(163),AAHY01210331.1:1..13134,gap(317),
CO   complement(AAHY01210332.1:1..4421),gap(20),
CO   complement(AAHY01210333.1:1..3005),gap(20),
CO   complement(AAHY01210334.1:1..764),gap(434),AAHY01210335.1:1..7646,gap(20),
CO   AAHY01210336.1:1..4898,gap(20),complement(AAHY01210337.1:1..1310),gap(878),
CO   AAHY01210338.1:1..2153,gap(402),AAHY01210339.1:1..921,gap(20),
CO   AAHY01210340.1:1..11402,gap(589),AAHY01210341.1:1..18871,gap(20),
CO   complement(AAHY01210342.1:1..1750),gap(139),
CO   complement(AAHY01210343.1:1..1525),gap(20),
CO   complement(AAHY01210344.1:1..2121),gap(20),AAHY01210345.1:1..9119,gap(34),
CO   AAHY01210346.1:1..1542,gap(20),AAHY01210347.1:1..20362,gap(72),
CO   AAHY01210348.1:1..2041,gap(152),AAHY01210349.1:1..19653,gap(596),
CO   AAHY01210350.1:1..8849,gap(30),AAHY01210351.1:1..4170,gap(20),
CO   AAHY01210352.1:1..4710,gap(387),AAHY01210353.1:1..4106,gap(637),
CO   complement(AAHY01210354.1:1..2165),gap(266),AAHY01210355.1:1..2786,gap(20),
CO   complement(AAHY01210356.1:1..5129),gap(754),
CO   complement(AAHY01210357.1:1..16039),gap(20),AAHY01210358.1:1..1786,
CO   gap(183),AAHY01210359.1:1..9369,gap(20),AAHY01210360.1:1..2435,gap(20),
CO   AAHY01210361.1:1..2910,gap(119),AAHY01210362.1:1..16742,gap(20),
CO   AAHY01210363.1:1..7764,gap(20),complement(AAHY01210364.1:1..7961),gap(349),
CO   AAHY01210365.1:1..1258,gap(106),AAHY01210366.1:1..11972,gap(20),
CO   AAHY01210367.1:1..3036,gap(20),AAHY01210368.1:1..1096,gap(9421),
CO   AAHY01210369.1:1..1396,gap(544),AAHY01210370.1:1..10303,gap(31),
CO   AAHY01210371.1:1..8175,gap(500),complement(AAHY01210372.1:1..7580),
CO   gap(316),AAHY01210373.1:1..3905,gap(20),AAHY01210374.1:1..18053,gap(55),
CO   AAHY01210375.1:1..1085,gap(30),AAHY01210376.1:1..10912,gap(927),
CO   complement(AAHY01210377.1:1..1048),gap(20),AAHY01210378.1:1..2243,gap(20),
CO   AAHY01210379.1:1..8226,gap(20),complement(AAHY01210380.1:1..3607),gap(196),
CO   complement(AAHY01210381.1:1..5130),gap(20),AAHY01210382.1:1..9563,gap(20),
CO   AAHY01210383.1:1..1505,gap(181),AAHY01210384.1:1..21914,gap(6093),
CO   AAHY01210385.1:1..27459,gap(20),AAHY01210386.1:1..2038,gap(91),
CO   AAHY01210387.1:1..11889,gap(325),AAHY01210388.1:1..7438,gap(20),
CO   AAHY01210389.1:1..3597,gap(34),AAHY01210390.1:1..10451,gap(308),
CO   complement(AAHY01210391.1:1..3890),gap(20),
CO   complement(AAHY01210392.1:1..4281),gap(20),AAHY01210393.1:1..4990,
CO   gap(3325),AAHY01210394.1:1..3682,gap(20),AAHY01210395.1:1..1162,gap(73),
CO   AAHY01210396.1:1..10850,gap(20),AAHY01210397.1:1..1104,gap(91),
CO   complement(AAHY01210398.1:1..3531),gap(20),AAHY01210399.1:1..3662,gap(188),
CO   AAHY01210400.1:1..4406,gap(6108),AAHY01210401.1:1..7156,gap(560),
CO   AAHY01210402.1:1..1844,gap(616),AAHY01210403.1:1..795,gap(358),
CO   AAHY01210404.1:1..1181,gap(37),complement(AAHY01210405.1:1..1260),
CO   gap(9422),AAHY01210406.1:1..2759,gap(596),AAHY01210407.1:1..4585,gap(2836),
CO   complement(AAHY01210408.1:1..3745),gap(66),
CO   complement(AAHY01210409.1:1..2133),gap(20),
CO   complement(AAHY01210410.1:1..7068),gap(4385),AAHY01210411.1:1..4163,
CO   gap(2631),AAHY01210412.1:1..3111,gap(20),AAHY01210413.1:1..22800,gap(181),
CO   complement(AAHY01210414.1:1..5526),gap(93),
CO   complement(AAHY01210415.1:1..3174),gap(330),AAHY01210416.1:1..2582,
CO   gap(195),AAHY01210417.1:1..10412,gap(37348),AAHY01210418.1:1..1755,
CO   gap(231),complement(AAHY01210419.1:1..1604),gap(20),AAHY01210420.1:1..1635,
CO   gap(273),complement(AAHY01210421.1:1..1509),gap(20),AAHY01210422.1:1..6137,
CO   gap(20),complement(AAHY01210423.1:1..7447),gap(796),
CO   complement(AAHY01210424.1:1..7383),gap(218),AAHY01210425.1:1..11325,
CO   gap(20),AAHY01210426.1:1..8002,gap(20),complement(AAHY01210427.1:1..1929),
CO   gap(20),AAHY01210428.1:1..2579,gap(473),AAHY01210429.1:1..25641,gap(20),
CO   AAHY01210430.1:1..16710,gap(3956),AAHY01210431.1:1..1810,gap(4929),
CO   complement(AAHY01210432.1:1..11941),gap(167),
CO   complement(AAHY01210433.1:1..6657),gap(1752),
CO   complement(AAHY01210434.1:1..23421),gap(373),AAHY01210435.1:1..2084,
CO   gap(30),complement(AAHY01210436.1:1..3465),gap(1118),
CO   complement(AAHY01210437.1:1..1143),gap(395),
CO   complement(AAHY01210438.1:1..19546),gap(39),AAHY01210439.1:1..4040,gap(20),
CO   AAHY01210440.1:1..1166,gap(20),AAHY01210441.1:1..34425,gap(20),
CO   complement(AAHY01210442.1:1..5814),gap(143),AAHY01210443.1:1..6650,gap(20),
CO   complement(AAHY01210444.1:1..9896),gap(20),
CO   complement(AAHY01210445.1:1..9598),gap(28),
CO   complement(AAHY01210446.1:1..21298),gap(287),AAHY01210447.1:1..3669,
CO   gap(20),complement(AAHY01210448.1:1..1679),gap(105),AAHY01210449.1:1..2663,
CO   gap(133),complement(AAHY01210450.1:1..5687),gap(20),
CO   complement(AAHY01210451.1:1..16405),gap(98),
CO   complement(AAHY01210452.1:1..14519),gap(618),
CO   complement(AAHY01210453.1:1..4247),gap(2081),AAHY01210454.1:1..9707,
CO   gap(1554),complement(AAHY01210455.1:1..1014),gap(58),
CO   complement(AAHY01210456.1:1..7440),gap(777),AAHY01210457.1:1..4435,gap(20),
CO   AAHY01210458.1:1..1543,gap(20),AAHY01210459.1:1..2534,gap(1637),
CO   complement(AAHY01210460.1:1..1204),gap(20),AAHY01210461.1:1..7790,gap(20),
CO   AAHY01210462.1:1..11674,gap(229),AAHY01210463.1:1..11683,gap(20),
CO   AAHY01210464.1:1..2496,gap(820),AAHY01210465.1:1..15138,gap(1755),
CO   AAHY01210466.1:1..7220,gap(58),AAHY01210467.1:1..6645,gap(798),
CO   AAHY01210468.1:1..12480,gap(464),AAHY01210469.1:1..20933,gap(98),
CO   AAHY01210470.1:1..29563,gap(20),AAHY01210471.1:1..10516,gap(20),
CO   AAHY01210472.1:1..6280,gap(1140),AAHY01210473.1:1..2407,gap(2986),
CO   complement(AAHY01210474.1:1..1518),gap(2300),AAHY01210475.1:1..4782,
CO   gap(528),complement(AAHY01210476.1:1..1141),gap(8029),
CO   AAHY01210477.1:1..5551,gap(839),complement(AAHY01210478.1:1..755),
CO   gap(1084),complement(AAHY01210479.1:1..4125),gap(870),
CO   complement(AAHY01210480.1:1..1026),gap(20),AAHY01210481.1:1..3210,gap(739),
CO   AAHY01210482.1:1..3479,gap(6751),AAHY01210483.1:1..3017)
//


spacer
spacer