spacer

EBI Dbfetch

ID   CH466570; SV 1; linear; genomic DNA; CON; MUS; 16191835 BP.
XX
AC   CH466570;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009803914 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-16191835
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-16191835
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 51ef012651d98bba899f24bcc6b358b6.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000228.
DR   Ensembl-Gn; ENSMUSG00000001986; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006200; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016150; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016327; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016534; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025860; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031095; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031104; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036109; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037005; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041453; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044533; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045996; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048047; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054626; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054727; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055555; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055653; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068048; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073207; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079593; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079619; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079627; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091957; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095180; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097200; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097306; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097436; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006362; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016294; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016471; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026978; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033430; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035983; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049740; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050083; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054289; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055483; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061755; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067763; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067782; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067940; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069209; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069360; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074913; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075453; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089062; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101588; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114810; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114876; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115094; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115095; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115162; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129769; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170335; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170715; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179626; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180893; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181131; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181916; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184866; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185127; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..16191835
FT                   /organism="Mus musculus"
FT                   /chromosome="X"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gap             3690..4534
FT                   /estimated_length=845
FT   gap             6035..6577
FT                   /estimated_length=543
FT   gap             7492..9118
FT                   /estimated_length=1627
FT   gene            complement(13262..17542)
FT                   /locus_tag="mCG_119345"
FT                   /note="gene_id=mCG119345.0"
FT   mRNA            complement(join(13262..13487,15285..15330,16872..17283,
FT                   17446..17542))
FT                   /locus_tag="mCG_119345"
FT                   /product="mCG119345"
FT                   /note="gene_id=mCG119345.0 transcript_id=mCT120517.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(13437..13487,15285..15330,16872..17283,
FT                   17446..17512))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119345"
FT                   /product="mCG119345"
FT                   /note="gene_id=mCG119345.0 transcript_id=mCT120517.0
FT                   protein_id=mCP87567.1"
FT                   /db_xref="GOA:K7N6P1"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:3713490"
FT                   /db_xref="UniProtKB/TrEMBL:K7N6P1"
FT                   /protein_id="EDL28997.1"
FT                   /translation="MEKRSINYLLDVGPEEDEENANGVKTLMVLLAGEGRNEGESGRGL
FT                   PGSGVSAAEGYRAGELSAGGPAAPVAGLMDNSNQEDLSATGCAQEKETQPEEPVPDSMG
FT                   DLENVKPMSGPWSTVNPVRVLVPKFRHLWRHNFNVLQLQELESIFQCNHYISTTEENRL
FT                   ARSMGVSEATVQEWFLKRREKYRSYKRL"
FT   gap             27278..28043
FT                   /estimated_length=766
FT   gap             32349..32697
FT                   /estimated_length=349
FT   gap             42718..43274
FT                   /estimated_length=557
FT   gap             48053..57451
FT                   /estimated_length=9399
FT   gene            58479..64556
FT                   /gene="Rhox5"
FT                   /locus_tag="mCG_119349"
FT                   /note="gene_id=mCG119349.0"
FT   mRNA            join(58479..58513,60091..60159,60782..60863,61040..61397,
FT                   62008..62053,64293..64556)
FT                   /gene="Rhox5"
FT                   /locus_tag="mCG_119349"
FT                   /product="reproductive homeobox 5"
FT                   /note="gene_id=mCG119349.0 transcript_id=mCT120521.0
FT                   created on 04-SEP-2002"
FT   gap             58734..58753
FT                   /estimated_length=20
FT   CDS             join(60785..60863,61040..61397,62008..62053,64293..64442)
FT                   /codon_start=1
FT                   /gene="Rhox5"
FT                   /locus_tag="mCG_119349"
FT                   /product="reproductive homeobox 5"
FT                   /note="gene_id=mCG119349.0 transcript_id=mCT120521.0
FT                   protein_id=mCP87571.1"
FT                   /db_xref="GOA:Q3UJH4"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:97538"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UJH4"
FT                   /protein_id="EDL28998.1"
FT                   /translation="MEAEGSSRKVTRLLRLGVKEDSEEQHDVKAEAFFQAGEGRDEQGA
FT                   QGQPGVGAVGTEGEGEELNGGKGHFGPGAPGPMGDGDKDSGTRAGGVEQEQNEPVAEGT
FT                   ESQENGNPGGRQMPLQGSRFAQHRLRELESILQRTNSFDVPREDLDRLMDACVSRVQNW
FT                   FKIRRAAARRNRRRATPVPEHFRGTFECPACRGVRWGERCPFATPRF"
FT   gap             62063..63035
FT                   /estimated_length=973
FT   gap             69800..70079
FT                   /estimated_length=280
FT   gene            83403..86204
FT                   /locus_tag="mCG_17933"
FT                   /note="gene_id=mCG17933.1"
FT   mRNA            join(83403..83527,83714..84173,84763..84808,85972..86204)
FT                   /locus_tag="mCG_17933"
FT                   /product="mCG17933"
FT                   /note="gene_id=mCG17933.1 transcript_id=mCT17268.1 created
FT                   on 04-SEP-2002"
FT   CDS             join(83446..83527,83714..84173,84763..84808,85972..86067)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17933"
FT                   /product="mCG17933"
FT                   /note="gene_id=mCG17933.1 transcript_id=mCT17268.1
FT                   protein_id=mCP1339.2"
FT                   /db_xref="GOA:O70238"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:1202888"
FT                   /db_xref="UniProtKB/TrEMBL:O70238"
FT                   /protein_id="EDL28999.1"
FT                   /translation="METPQDSRQSIQKPPSPAAEEDKEEQPGGNAVVSGAPEERIDKKE
FT                   LVLNWLAQGEFDQGEGAQGEVAGGEQAQEEPAPLSPAQEATGGEEEGENKEGEMEGRHA
FT                   GDGASSSEDDSILEEGGENIDQQPPQQEAASPDSIRNPHVLNRLAQLRYRRTRFTHSQL
FT                   HDLERLFQETRYPSLRARRDLARWMGVDECDVQNWFRMRRALFQRNRRVLMFCELPPLP
FT                   QSDSP"
FT   gap             97130..97248
FT                   /estimated_length=119
FT   gene            complement(132821..>136489)
FT                   /gene="Rhox8"
FT                   /locus_tag="mCG_59536"
FT                   /note="gene_id=mCG59536.2"
FT   mRNA            complement(join(132821..133022,134242..134287,
FT                   135869..136214,136309..136352,136431..>136489))
FT                   /gene="Rhox8"
FT                   /locus_tag="mCG_59536"
FT                   /product="reproductive homeobox 8"
FT                   /note="gene_id=mCG59536.2 transcript_id=mCT59719.2 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(132975..133022,134242..134287,
FT                   135869..136214,136309..136352,136431..>136483))
FT                   /codon_start=1
FT                   /gene="Rhox8"
FT                   /locus_tag="mCG_59536"
FT                   /product="reproductive homeobox 8"
FT                   /note="gene_id=mCG59536.2 transcript_id=mCT59719.2
FT                   protein_id=mCP24273.2"
FT                   /protein_id="EDL29000.1"
FT                   /translation="RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRREEEEEEEEEEEE
FT                   EEEEEEEEEEEEEEAAAAAAARDETTAGSSAPVDDRSHDAGASSNGEDRGQGEELIPGG
FT                   TKGLEALPSPSGQLPRNRYRFTKFQLQELERIFERNHYPSAAARRELARWIGVTESRVE
FT                   NWFKSRRAKYRKCLM"
FT   gap             139019..150120
FT                   /estimated_length=11102
FT   gene            complement(151597..154268)
FT                   /locus_tag="mCG_119347"
FT                   /note="gene_id=mCG119347.0"
FT   mRNA            complement(join(151597..151797,152778..152823,
FT                   153450..153909,154096..154268))
FT                   /locus_tag="mCG_119347"
FT                   /product="mCG119347"
FT                   /note="gene_id=mCG119347.0 transcript_id=mCT120519.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(151702..151797,152778..152823,
FT                   153450..153909,154096..154177))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119347"
FT                   /product="mCG119347"
FT                   /note="gene_id=mCG119347.0 transcript_id=mCT120519.0
FT                   protein_id=mCP87569.1"
FT                   /db_xref="GOA:Q9EQM5"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:1890128"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EQM5"
FT                   /protein_id="EDL29001.1"
FT                   /translation="METPQDSRQSIQKPPSPGAEEDKEEQHGGNAVVSGAGEEGIDKKE
FT                   LVMSGLAQGGLDQGEGAQGEVAGGEQAQEEPAPLSPAQEATGGEEEGENKEGEMEGRHA
FT                   GDGASGPEDDNIQEEGGENIDQQPPQQEAAIPEGMRNPQAGNYLAHQRTRRTRFTHSQL
FT                   RDLERLFQENRFPSLRVRRDLARWMGVDESDVQEWFKMRRALFRRHSRLMMFCELPPIT
FT                   ENNSP"
FT   gap             165265..168430
FT                   /estimated_length=3166
FT   gap             178125..178255
FT                   /estimated_length=131
FT   gap             180572..181612
FT                   /estimated_length=1041
FT   gap             182695..183140
FT                   /estimated_length=446
FT   gap             188033..188052
FT                   /estimated_length=20
FT   gap             210171..216679
FT                   /estimated_length=6509
FT   gap             219287..219455
FT                   /estimated_length=169
FT   gap             222889..222929
FT                   /estimated_length=41
FT   gap             240261..242508
FT                   /estimated_length=2248
FT   gap             262622..262641
FT                   /estimated_length=20
FT   gene            complement(265281..>265910)
FT                   /locus_tag="mCG_141010"
FT                   /note="gene_id=mCG141010.0"
FT   mRNA            complement(265281..>265910)
FT                   /locus_tag="mCG_141010"
FT                   /product="mCG141010"
FT                   /note="gene_id=mCG141010.0 transcript_id=mCT172687.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(265401..>265910)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141010"
FT                   /product="mCG141010"
FT                   /note="gene_id=mCG141010.0 transcript_id=mCT172687.0
FT                   protein_id=mCP95606.0"
FT                   /protein_id="EDL29002.1"
FT                   /translation="PFLTLAATMIGEICAAATFICKFLCTKGLRNEELLQTFSQSLQEL
FT                   LVEHYKHHWFPEQPCKGSGYRCIRINHKMDPLVSQAAQQIGLSSRELFRLLPSELTLWV
FT                   DPYEVSYRIGEDGSICVLYEASPVGGSSHNSTNAQMVDSRISFKEEPLLGRTGPSKNYN
FT                   MMAVSV"
FT   gap             279332..279351
FT                   /estimated_length=20
FT   gap             281379..281398
FT                   /estimated_length=20
FT   gap             283345..285749
FT                   /estimated_length=2405
FT   gene            complement(289760..>290398)
FT                   /locus_tag="mCG_141009"
FT                   /note="gene_id=mCG141009.0"
FT   mRNA            complement(289760..>290398)
FT                   /locus_tag="mCG_141009"
FT                   /product="mCG141009"
FT                   /note="gene_id=mCG141009.0 transcript_id=mCT172688.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(289908..>290396)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141009"
FT                   /product="mCG141009"
FT                   /note="gene_id=mCG141009.0 transcript_id=mCT172688.0
FT                   protein_id=mCP95607.0"
FT                   /protein_id="EDL29003.1"
FT                   /translation="TMIGEICAAATFICKFLCTKGLRNEELLQTFSQSLQELLVEHYKH
FT                   HWFPEQPCKGSGYRCIRINHKMDPLVSQAAQQIGLSSRELFRLLPSELTLWVDPYEVSY
FT                   RIGEDGSICVLYEASPVGGSSHNSTNAQMVDSRSGCKEERLLRRTNSAKNYNMMTVLG"
FT   gap             290961..291200
FT                   /estimated_length=240
FT   gap             296922..296941
FT                   /estimated_length=20
FT   gap             300151..300170
FT                   /estimated_length=20
FT   gap             302371..302390
FT                   /estimated_length=20
FT   gap             322936..322955
FT                   /estimated_length=20
FT   gap             325337..326312
FT                   /estimated_length=976
FT   gene            complement(<329753..334485)
FT                   /gene="Rhox11"
FT                   /locus_tag="mCG_147981"
FT                   /note="gene_id=mCG147981.0"
FT   mRNA            complement(join(<329753..329804,333963..334485))
FT                   /gene="Rhox11"
FT                   /locus_tag="mCG_147981"
FT                   /product="reproductive homeobox 11"
FT                   /note="gene_id=mCG147981.0 transcript_id=mCT188244.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(<329753..329804,333963..334321))
FT                   /codon_start=1
FT                   /gene="Rhox11"
FT                   /locus_tag="mCG_147981"
FT                   /product="reproductive homeobox 11"
FT                   /note="gene_id=mCG147981.0 transcript_id=mCT188244.0
FT                   protein_id=mCP109519.0"
FT                   /protein_id="EDL29004.1"
FT                   /translation="MSRKYFYFDYDYYGMSFCEEEITTEPEEKVAYTSNSGGFADEVTG
FT                   IPKEGHQSSIGEHSCVMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPGQLWE
FT                   LQAVFVENQYPDALKRKELAGLLNVDEQKIKVS"
FT   gap             337592..337711
FT                   /estimated_length=120
FT   gap             355039..355064
FT                   /estimated_length=26
FT   gap             356130..356355
FT                   /estimated_length=226
FT   gap             357437..358193
FT                   /estimated_length=757
FT   gene            <367763..367973
FT                   /locus_tag="mCG_1041001"
FT                   /note="gene_id=mCG1041001.0"
FT   mRNA            join(<367763..367812,367839..367973)
FT                   /locus_tag="mCG_1041001"
FT                   /product="mCG1041001"
FT                   /note="gene_id=mCG1041001.0 transcript_id=mCT158705.1
FT                   created on 04-SEP-2002"
FT   CDS             join(<367764..367812,367839..367924)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041001"
FT                   /product="mCG1041001"
FT                   /note="gene_id=mCG1041001.0 transcript_id=mCT158705.1
FT                   protein_id=mCP87669.1"
FT                   /protein_id="EDL29005.1"
FT                   /translation="PRSKKPWTTHPSKDTERVPILTRPPTLSISLTVSIPGPHNKGGA"
FT   gene            <370851..379236
FT                   /locus_tag="mCG_16054"
FT                   /note="gene_id=mCG16054.1"
FT   mRNA            join(<370851..370993,372245..372290,379013..379236)
FT                   /locus_tag="mCG_16054"
FT                   /product="mCG16054"
FT                   /note="gene_id=mCG16054.1 transcript_id=mCT15269.0 created
FT                   on 04-SEP-2002"
FT   CDS             join(<370851..370993,372245..372290,379013..379132)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16054"
FT                   /product="mCG16054"
FT                   /note="gene_id=mCG16054.1 transcript_id=mCT15269.0
FT                   protein_id=mCP2283.0"
FT                   /protein_id="EDL29006.1"
FT                   /translation="IPGPYRYRPPRRHVRRRRRGPPFHFAQWQVEEMESLFEETQYPDL
FT                   LTRGELARTLNVPEVKVKVWFTNRRAKQRKIERREMLRNIPPGAEDFIFITDFEEPS"
FT   gap             375616..375759
FT                   /estimated_length=144
FT   gene            <439085..443958
FT                   /gene="Zbtb33"
FT                   /locus_tag="mCG_16053"
FT                   /note="gene_id=mCG16053.2"
FT   mRNA            join(<439085..439182,441489..443958)
FT                   /gene="Zbtb33"
FT                   /locus_tag="mCG_16053"
FT                   /product="zinc finger and BTB domain containing 33,
FT                   transcript variant mCT192569"
FT                   /note="gene_id=mCG16053.2 transcript_id=mCT192569.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<439086..439182,441489..443506)
FT                   /codon_start=1
FT                   /gene="Zbtb33"
FT                   /locus_tag="mCG_16053"
FT                   /product="zinc finger and BTB domain containing 33, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16053.2 transcript_id=mCT192569.0
FT                   protein_id=mCP113537.0 isoform=CRA_b"
FT                   /protein_id="EDL29008.1"
FT                   /translation="KAAAAALRSPAAWGRTLTLPRPRGGESGRRGAGMESRKLISATDI
FT                   QYSASLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFSVAGQVVELS
FT                   FIRAEIFAEILNYIYSSKVVRVRADLLDELIKSGQLLGVKFIAELGVPLSQVKSISGTE
FT                   QDGTAETLPSSSSDKSLDMEKSKDEAQDNGATVMPIITESFSLSAEDNEMKKIIVTDSD
FT                   DDDDDDVIFCSEILPAKEDLPSNNTATQVQPNPASVAISEVTPCASNNSPPVTNITPTQ
FT                   LPTPVNQATLSQTQGSEELLVSSASTHLTPNIILLNQAPLTAPPSASSSLPNHMSSSVN
FT                   VLVQNQQTPNSAVLTGNKAEEEEEIIDDDDDIISSSPDSAVSNTSLVPQADNSKSTTLD
FT                   GSLTQKMQIPVLPQEPPSNSLKISDVITRNTNDPGLRSKHVMEGQKIITLDTATEIEGL
FT                   STGCKVYANIGEDTYDIVIPVKDDPDGGEAKLDNELPKTSGSEPPNKRMKVKHDDHYEL
FT                   IVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYQCRYCDKVFPLAEYRTKHEIHHT
FT                   GERRYQCLTCGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCKSLQIRQYAYLSNKS
FT                   SAMPVMKDDAVGYKVDAGKEPPVGTTSTPPQNKSTFWEDIFIQQENDSIFKQNVTDGST
FT                   EFEFIIPESY"
FT   mRNA            join(439115..439356,441489..443814)
FT                   /gene="Zbtb33"
FT                   /locus_tag="mCG_16053"
FT                   /product="zinc finger and BTB domain containing 33,
FT                   transcript variant mCT15439"
FT                   /note="gene_id=mCG16053.2 transcript_id=mCT15439.1 created
FT                   on 04-SEP-2002"
FT   CDS             441491..443506
FT                   /codon_start=1
FT                   /gene="Zbtb33"
FT                   /locus_tag="mCG_16053"
FT                   /product="zinc finger and BTB domain containing 33, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16053.2 transcript_id=mCT15439.1
FT                   protein_id=mCP2282.2 isoform=CRA_a"
FT                   /db_xref="GOA:A2A3Z3"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1927290"
FT                   /db_xref="UniProtKB/TrEMBL:A2A3Z3"
FT                   /protein_id="EDL29007.1"
FT                   /translation="MESRKLISATDIQYSASLLNSLNEQRGHGLFCDVTVIVEDRKFRA
FT                   HRNILSASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIYSSKVVRVRADLLDELIKS
FT                   GQLLGVKFIAELGVPLSQVKSISGTEQDGTAETLPSSSSDKSLDMEKSKDEAQDNGATV
FT                   MPIITESFSLSAEDNEMKKIIVTDSDDDDDDDVIFCSEILPAKEDLPSNNTATQVQPNP
FT                   ASVAISEVTPCASNNSPPVTNITPTQLPTPVNQATLSQTQGSEELLVSSASTHLTPNII
FT                   LLNQAPLTAPPSASSSLPNHMSSSVNVLVQNQQTPNSAVLTGNKAEEEEEIIDDDDDII
FT                   SSSPDSAVSNTSLVPQADNSKSTTLDGSLTQKMQIPVLPQEPPSNSLKISDVITRNTND
FT                   PGLRSKHVMEGQKIITLDTATEIEGLSTGCKVYANIGEDTYDIVIPVKDDPDGGEAKLD
FT                   NELPKTSGSEPPNKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWE
FT                   KKYQCRYCDKVFPLAEYRTKHEIHHTGERRYQCLTCGKSFINYQFMSSHIKSVHSQDPS
FT                   GDSKLYRLHPCKSLQIRQYAYLSNKSSAMPVMKDDAVGYKVDAGKEPPVGTTSTPPQNK
FT                   STFWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY"
FT   gene            complement(448258..>501687)
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /note="gene_id=mCG16055.1"
FT   mRNA            complement(join(448258..448930,457239..457382,
FT                   464407..464569,473810..473898,474283..474354,
FT                   476117..476185,482332..482421,485070..485132,
FT                   494945..495087,501473..>501687))
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /product="RIKEN cDNA 6430550H21, transcript variant
FT                   mCT15440"
FT                   /note="gene_id=mCG16055.1 transcript_id=mCT15440.2 created
FT                   on 04-SEP-2002"
FT   mRNA            complement(join(448259..448930,457239..457382,
FT                   464407..464569,473810..473898,474283..474354,
FT                   482332..482421,485070..485132,494945..495087,
FT                   501473..501650))
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /product="RIKEN cDNA 6430550H21, transcript variant
FT                   mCT172686"
FT                   /note="gene_id=mCG16055.1 transcript_id=mCT172686.0 created
FT                   on 04-SEP-2002"
FT   mRNA            complement(join(448259..448930,457239..457382,
FT                   464514..464569,473810..473898,482332..482421,
FT                   485070..485132,494945..495087,501473..>501630))
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /product="RIKEN cDNA 6430550H21, transcript variant
FT                   mCT172685"
FT                   /note="gene_id=mCG16055.1 transcript_id=mCT172685.0 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(448766..448930,457239..457382,
FT                   464407..464569,473810..473898,474283..474354,
FT                   476117..476185,482332..482421,485070..485132,
FT                   494945..495087,501473..>501569))
FT                   /codon_start=1
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /product="RIKEN cDNA 6430550H21, isoform CRA_a"
FT                   /note="gene_id=mCG16055.1 transcript_id=mCT15440.2
FT                   protein_id=mCP2284.2 isoform=CRA_a"
FT                   /protein_id="EDL29009.1"
FT                   /translation="SSFGDRGNWTAFTMHQSLTQQRSSDMSLPDSMGAFNRRKRNSIYV
FT                   TVTLLIVSMLILTVGLAATTRTQNVTVGGYYPGVILGFGSFLGIIGSNLIENKRQMLVA
FT                   SIVFISFGVIAAFCCAIVDGVFAARHIDLKPLYANRCHYVPKTSQREAEEVITSSSKIT
FT                   PSTRALRNLTQAVKEVNCPQLSRGLCTPRIRGNTCFCCDLYNCGNRVEITGGYYEYIDV
FT                   SSCQDIIHLYHLLWSATILNIVGLFLGIITAAVLGGFKDMNPTLPALNCSVENAHPTVS
FT                   YYARPQVASYNTYYHSPPHLPPYSAYDFQHSGVFPSSPPSGLSDEQEPQSPSPSPSYMW
FT                   SSSAPPRYSPPYYPPFEKPPPYSP"
FT   CDS             complement(join(448766..448930,457239..457382,
FT                   464407..464569,473810..473898,474283..474354,
FT                   482332..482421,485070..485132,494945..495087,
FT                   501473..501530))
FT                   /codon_start=1
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /product="RIKEN cDNA 6430550H21, isoform CRA_c"
FT                   /note="gene_id=mCG16055.1 transcript_id=mCT172686.0
FT                   protein_id=mCP95604.0 isoform=CRA_c"
FT                   /protein_id="EDL29011.1"
FT                   /translation="MHQSLTQQRSSDMSLPDSMGAFNRRKRNSIYVTVTLLIVSMLILT
FT                   VGLAATTRTQNVTVGGYYPGVILGFGSFLGIIGSNLIENKRQMLVASIVFISFGVIAAF
FT                   CCAIVDGVFAARHIVITSSSKITPSTRALRNLTQAVKEVNCPQLSRGLCTPRIRGNTCF
FT                   CCDLYNCGNRVEITGGYYEYIDVSSCQDIIHLYHLLWSATILNIVGLFLGIITAAVLGG
FT                   FKDMNPTLPALNCSVENAHPTVSYYARPQVASYNTYYHSPPHLPPYSAYDFQHSGVFPS
FT                   SPPSGLSDEQEPQSPSPSPSYMWSSSAPPRYSPPYYPPFEKPPPYSP"
FT   CDS             complement(join(457348..457382,464514..464569,
FT                   473810..473898,482332..482421,485070..485132,
FT                   494945..495087,501473..>501569))
FT                   /codon_start=1
FT                   /gene="6430550H21Rik"
FT                   /locus_tag="mCG_16055"
FT                   /product="RIKEN cDNA 6430550H21, isoform CRA_b"
FT                   /note="gene_id=mCG16055.1 transcript_id=mCT172685.0
FT                   protein_id=mCP95605.0 isoform=CRA_b"
FT                   /protein_id="EDL29010.1"
FT                   /translation="SSFGDRGNWTAFTMHQSLTQQRSSDMSLPDSMGAFNRRKRNSIYV
FT                   TVTLLIVSMLILTVGLAATTRTQNVTVGGYYPGVILGFGSFLGIIGSNLIENKRQMLVA
FT                   SIVFISFGVIAAFCCAIVDGVFAARHIVNCPQLSRGLCTPRIRGNTCFCCDLYNCGNRV
FT                   EITGGYYEYIDVSSCQEPYSSGTELLC"
FT   gap             532641..535497
FT                   /estimated_length=2857
FT   gap             538310..538911
FT                   /estimated_length=602
FT   gap             555950..556467
FT                   /estimated_length=518
FT   gene            566603..587139
FT                   /gene="Atp1b4"
FT                   /locus_tag="mCG_1448"
FT                   /note="gene_id=mCG1448.2"
FT   mRNA            join(566603..566745,570927..571188,575061..575189,
FT                   575427..575531,579680..579876,580980..581036,
FT                   583180..583275,583987..587139)
FT                   /gene="Atp1b4"
FT                   /locus_tag="mCG_1448"
FT                   /product="ATPase, (Na+)/K+ transporting, beta 4
FT                   polypeptide, transcript variant mCT7867"
FT                   /note="gene_id=mCG1448.2 transcript_id=mCT7867.2 created on
FT                   04-SEP-2002"
FT   mRNA            join(<566683..566745,570927..571176,575061..575189,
FT                   575427..575531,579680..579876,580980..581036,
FT                   583180..583275,583987..587139)
FT                   /gene="Atp1b4"
FT                   /locus_tag="mCG_1448"
FT                   /product="ATPase, (Na+)/K+ transporting, beta 4
FT                   polypeptide, transcript variant mCT192587"
FT                   /note="gene_id=mCG1448.2 transcript_id=mCT192587.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(566683..566745,570927..571188,575061..575189,
FT                   575427..575531,579680..579876,580980..581036,
FT                   583180..583275,583987..584148)
FT                   /codon_start=1
FT                   /gene="Atp1b4"
FT                   /locus_tag="mCG_1448"
FT                   /product="ATPase, (Na+)/K+ transporting, beta 4
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG1448.2 transcript_id=mCT7867.2
FT                   protein_id=mCP2640.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q99ME6"
FT                   /db_xref="InterPro:IPR000402"
FT                   /db_xref="MGI:MGI:1915071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99ME6"
FT                   /protein_id="EDL29013.1"
FT                   /translation="MRRQLRSRRAPAFPYGYRYRLDDQDEANHNYLADEEEEAEEEAQV
FT                   MMVPGLEEEEEEEEGKEEEEEREEEEGQGQSTGSAWWRKLQIVNEYLWDPEKRMSLART
FT                   GQSRSLILVIYFFFYASLAAVITLFIYMLFLAISPYMPTFTEQVKPPGVMIRPFAHSLN
FT                   FNFNVSEPETWQRYVISLNGFLQGYNDSLQEEMNIDCPPGRYFIQDGDEDEDKKACQFK
FT                   RSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPEFGDPVKVSCKVQKGDENDIRSI
FT                   NYYPESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIVNDVI
FT                   NDRFVGRIIFTLNIET"
FT   CDS             join(566683..566745,570927..571176,575061..575189,
FT                   575427..575531,579680..579876,580980..581036,
FT                   583180..583275,583987..584148)
FT                   /codon_start=1
FT                   /gene="Atp1b4"
FT                   /locus_tag="mCG_1448"
FT                   /product="ATPase, (Na+)/K+ transporting, beta 4
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG1448.2 transcript_id=mCT192587.0
FT                   protein_id=mCP113536.0 isoform=CRA_a"
FT                   /db_xref="GOA:B1APX1"
FT                   /db_xref="InterPro:IPR000402"
FT                   /db_xref="MGI:MGI:1915071"
FT                   /db_xref="UniProtKB/TrEMBL:B1APX1"
FT                   /protein_id="EDL29012.1"
FT                   /translation="MRRQLRSRRAPAFPYGYRYRLDDQDEANHNYLADEEEEAEEEAQV
FT                   MMVPGLEEEEEEEEGKEEEEEREEEEGQGQSTGSAWWRKLQIVNEYLWDPEKRMSLART
FT                   GLILVIYFFFYASLAAVITLFIYMLFLAISPYMPTFTEQVKPPGVMIRPFAHSLNFNFN
FT                   VSEPETWQRYVISLNGFLQGYNDSLQEEMNIDCPPGRYFIQDGDEDEDKKACQFKRSFL
FT                   KNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPEFGDPVKVSCKVQKGDENDIRSINYYP
FT                   ESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIVNDVINDRF
FT                   VGRIIFTLNIET"
FT   gene            647314..647779
FT                   /locus_tag="mCG_1451"
FT                   /note="gene_id=mCG1451.1"
FT   mRNA            647314..647779
FT                   /locus_tag="mCG_1451"
FT                   /product="mCG1451"
FT                   /note="gene_id=mCG1451.1 transcript_id=mCT7870.1 created on
FT                   04-SEP-2002"
FT   CDS             647364..647678
FT                   /codon_start=1
FT                   /locus_tag="mCG_1451"
FT                   /product="mCG1451"
FT                   /note="gene_id=mCG1451.1 transcript_id=mCT7870.1
FT                   protein_id=mCP2639.1"
FT                   /protein_id="EDL29014.1"
FT                   /translation="MAKLICNFTETAPSMVAAAVTYSKPRLATFWHYAKVELVPPTPGE
FT                   IPTAIQSVKKKTIQSAKTGSFKHLTVKEAVLNGLVATEVWMWFYIGEIIGKRGIVGYDV
FT                   "
FT   gene            complement(651788..706789)
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /note="gene_id=mCG1450.2"
FT   mRNA            complement(join(651788..652710,674602..674766,
FT                   675698..675761,681253..681375,682185..682396,
FT                   685731..685889,690466..690679,692360..692475,
FT                   706584..706789))
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, transcript
FT                   variant mCT172682"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT172682.0 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(652568..652710,674602..674766,
FT                   675698..675761,681253..681375,682185..682396,
FT                   685731..685889,690466..690679,692360..692475,
FT                   706584..706638))
FT                   /codon_start=1
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, isoform CRA_a"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT172682.0
FT                   protein_id=mCP95602.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8C5K0"
FT                   /db_xref="InterPro:IPR002000"
FT                   /db_xref="InterPro:IPR018134"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C5K0"
FT                   /protein_id="EDL29015.1"
FT                   /translation="MCLSPVKGAKLILIFLFLGAVQSNALIVNLTDSKGTCLYAEWEMN
FT                   FTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASH
FT                   YSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQK
FT                   YWGIHLQAFVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPT
FT                   PTVGNYSIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNN
FT                   SQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQ
FT                   VLSVSRAFQINTFNLKVQPFNVTKGQYSTAEECAADSDLNFLIPVAVGVALGFLIIAVF
FT                   ISYMIGRRKSRTGYQSV"
FT   mRNA            complement(join(655493..656000,674602..674766,
FT                   675698..675761,681253..681375,682185..682396,
FT                   685731..685889,690466..690679,692360..692475,
FT                   706584..706714))
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, transcript
FT                   variant mCT7869"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT7869.1 created on
FT                   04-SEP-2002"
FT   mRNA            complement(join(655506..656000,674602..674766,
FT                   675698..675761,681253..681375,682185..682248,
FT                   692398..692475,706584..706745))
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, transcript
FT                   variant mCT172684"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT172684.0 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(655861..656000,674602..674766,
FT                   675698..675761,681253..681375,682185..682396,
FT                   685731..685889,690466..690679,692360..692475,
FT                   706584..706638))
FT                   /codon_start=1
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, isoform CRA_d"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT7869.1
FT                   protein_id=mCP2638.2 isoform=CRA_d"
FT                   /db_xref="GOA:P17047"
FT                   /db_xref="InterPro:IPR002000"
FT                   /db_xref="InterPro:IPR018134"
FT                   /db_xref="MGI:MGI:96748"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17047"
FT                   /protein_id="EDL29018.1"
FT                   /translation="MCLSPVKGAKLILIFLFLGAVQSNALIVNLTDSKGTCLYAEWEMN
FT                   FTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASH
FT                   YSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQK
FT                   YWGIHLQAFVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPT
FT                   PTVGNYSIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNN
FT                   SQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQ
FT                   VLSVSRAFQINTFNLKVQPFNVTKGQYSTAQDCSADEDNFLVPIAVGAALGGVLILVLL
FT                   AYFIGLKRHHTGYEQF"
FT   CDS             complement(join(655861..656000,674602..674766,
FT                   675698..675761,681253..681375,682185..682248,
FT                   692398..692408))
FT                   /codon_start=1
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, isoform CRA_c"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT172684.0
FT                   protein_id=mCP95603.0 isoform=CRA_c"
FT                   /protein_id="EDL29017.1"
FT                   /translation="MGDENGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQP
FT                   QSAQLRLNNSQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLG
FT                   SSYMCNKEQVLSVSRAFQINTFNLKVQPFNVTKGQYSTAQDCSADEDNFLVPIAVGAAL
FT                   GGVLILVLLAYFIGLKRHHTGYEQF"
FT   gap             664346..664688
FT                   /estimated_length=343
FT   mRNA            complement(join(671454..672186,674602..674766,
FT                   675698..675761,681253..681375,682185..682396,
FT                   685731..685889,690466..690679,692360..692475,
FT                   706584..706755))
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, transcript
FT                   variant mCT172683"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT172683.0 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(672047..672186,674602..674766,
FT                   675698..675761,681253..681375,682185..682396,
FT                   685731..685889,690466..690679,692360..692475,
FT                   706584..706638))
FT                   /codon_start=1
FT                   /gene="Lamp2"
FT                   /locus_tag="mCG_1450"
FT                   /product="lysosomal membrane glycoprotein 2, isoform CRA_b"
FT                   /note="gene_id=mCG1450.2 transcript_id=mCT172683.0
FT                   protein_id=mCP95601.0 isoform=CRA_b"
FT                   /db_xref="GOA:P17047"
FT                   /db_xref="InterPro:IPR002000"
FT                   /db_xref="InterPro:IPR018134"
FT                   /db_xref="MGI:MGI:96748"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17047"
FT                   /protein_id="EDL29016.1"
FT                   /translation="MCLSPVKGAKLILIFLFLGAVQSNALIVNLTDSKGTCLYAEWEMN
FT                   FTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASH
FT                   YSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQK
FT                   YWGIHLQAFVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPT
FT                   PTVGNYSIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNN
FT                   SQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQ
FT                   VLSVSRAFQINTFNLKVQPFNVTKGQYSTAQECSLDDDTILIPIIVGAGLSGLIIVIVI
FT                   AYLIGRRKTYAGYQTL"
FT   gap             748710..748769
FT                   /estimated_length=60
FT   gene            complement(782657..825984)
FT                   /gene="Cul4b"
FT                   /locus_tag="mCG_10889"
FT                   /note="gene_id=mCG10889.2"
FT   mRNA            complement(join(782657..783527,786921..787073,
FT                   788753..788925,789799..789904,790736..790849,
FT                   791850..791957,793131..793216,794548..794658,
FT                   795295..795399,796491..796683,797646..797764,
FT                   798228..798295,799008..799090,799387..799476,
FT                   799636..799798,800665..800738,801453..801522,
FT                   802181..802284,811408..811523,813462..814007,
FT                   814732..814905,822203..822277,825879..825984))
FT                   /gene="Cul4b"
FT                   /locus_tag="mCG_10889"
FT                   /product="cullin 4B"
FT                   /note="gene_id=mCG10889.2 transcript_id=mCT172680.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(783432..783527,786921..787073,
FT                   788753..788925,789799..789904,790736..790849,
FT                   791850..791957,793131..793216,794548..794658,
FT                   795295..795399,796491..796683,797646..797764,
FT                   798228..798295,799008..799090,799387..799476,
FT                   799636..799798,800665..800738,801453..801522,
FT                   802181..802284,811408..811523,813462..814007,
FT                   814732..814905,822203..822263))
FT                   /codon_start=1
FT                   /gene="Cul4b"
FT                   /locus_tag="mCG_10889"
FT                   /product="cullin 4B"
FT                   /note="gene_id=mCG10889.2 transcript_id=mCT172680.0
FT                   protein_id=mCP95599.0"
FT                   /db_xref="GOA:A2A432"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016157"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="MGI:MGI:1919834"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2A432"
FT                   /protein_id="EDL29019.1"
FT                   /translation="MSRSTRSKERRENDTDSEDNSSETSNQERRRCRQGPPRPPYPPLL
FT                   PPVFPPPTPPPQVRRTRGLQDLGAMKSVCPGTSGFSSPNPSAASAAAQEVRSATDGNTS
FT                   TTPPTSAKKRKLNSSSSSSNSSNEREDFDSTSSSSTPPQPRDSASPSTSSFCLGVPVAT
FT                   SSHVPIQKKLRFEDTLEFVGIDTKMAEESSSSSSSSSPTAATSQQQQQQQLKTKSILIS
FT                   SVASVHHANGLAKSSTAVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAV
FT                   EAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDHIKAQIHQFREDSLDSV
FT                   LFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKV
FT                   QTKTIDGILLLIERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEQQFLQETNRLYAAEG
FT                   QKLMQEREVPEYLHHVNKRLEEEADRLITYLDQTTQKSLIASVEKQLLGEHLTAILQKG
FT                   LNSLLDENRIQDLSLLYQLFSRVRGGVQVLLQQWIEYIKAFGSTIVINPEKDKTMVQEL
FT                   LDFKDKVDHIIDTCFLKNEKFINAMKEAFETFINKRPNKPAELIAKYVDSKLRAGNKEA
FT                   TDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHEC
FT                   GAAFTSKLEGMFKDMELSKDIMIQFKQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVH
FT                   LPPEMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTMVLLM
FT                   FNEGEEFSLEEIKHATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDF
FT                   KHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEV
FT                   YNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIA"
FT   gene            850329..863256
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /note="gene_id=mCG1040960.1"
FT   mRNA            join(850329..850577,851151..851196,851728..851880,
FT                   852375..852472,855737..855870,861572..861639,
FT                   862954..863256)
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, transcript
FT                   variant mCT172669"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172669.0
FT                   created on 05-SEP-2002"
FT   mRNA            join(850329..850577,851728..851880,852375..852472,
FT                   855737..855870,861572..861639,862954..863255)
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, transcript
FT                   variant mCT158664"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT158664.1
FT                   created on 05-SEP-2002"
FT   mRNA            join(850329..850577,851728..851880,852375..852472,
FT                   855737..855870,861561..861639,862954..863133)
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, transcript
FT                   variant mCT172670"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172670.0
FT                   created on 05-SEP-2002"
FT   mRNA            join(850377..850577,852375..852472,855737..855870,
FT                   861572..861639,862954..863227)
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, transcript
FT                   variant mCT172668"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172668.0
FT                   created on 05-SEP-2002"
FT   mRNA            join(<850377..850577,855737..855870,861572..861639,
FT                   862954..863227)
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, transcript
FT                   variant mCT172667"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172667.0
FT                   created on 05-SEP-2002"
FT   CDS             join(<850403..850577,855737..855870,861572..861639,
FT                   862954..863035)
FT                   /codon_start=1
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172667.0
FT                   protein_id=mCP95586.0 isoform=CRA_e"
FT                   /protein_id="EDL29024.1"
FT                   /translation="SDFAKGRKADSVFAFRINDSSSDCQCRPSSCWTLPNSISFPFRAL
FT                   PYRRPFHLGSCSRNPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVA
FT                   IMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK"
FT   CDS             join(850567..850577,851728..851880,852375..852472,
FT                   855737..855870,861572..861639,862954..863035)
FT                   /codon_start=1
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT158664.1
FT                   protein_id=mCP87535.1 isoform=CRA_a"
FT                   /protein_id="EDL29020.1"
FT                   /translation="MFKKFDEKENVSNCIQLKTSVIKGIKNQLLEQFPGIEPWLNQIMP
FT                   KKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKF
FT                   VLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIG
FT                   IENIHYLNDGLWHMKTYK"
FT   CDS             join(850567..850577,852375..852472,855737..855870,
FT                   861572..861639,862954..863035)
FT                   /codon_start=1
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172668.0
FT                   protein_id=mCP95587.0 isoform=CRA_b"
FT                   /protein_id="EDL29021.1"
FT                   /translation="MFKNHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQ
FT                   VDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDI
FT                   EKVNKGIGIENIHYLNDGLWHMKTYK"
FT   CDS             join(850567..850577,851728..851880,852375..852472,
FT                   855737..855870,861561..861620)
FT                   /codon_start=1
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172670.0
FT                   protein_id=mCP95588.0 isoform=CRA_d"
FT                   /protein_id="EDL29023.1"
FT                   /translation="MFKKFDEKENVSNCIQLKTSVIKGIKNQLLEQFPGIEPWLNQIMP
FT                   KKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKF
FT                   VLSGANIMCPGLTSPGAKLYPAAVDTIVLVFRQSWQKENNMLYVWVS"
FT   CDS             join(851183..851196,851728..851880,852375..852472,
FT                   855737..855870,861572..861639,862954..863035)
FT                   /codon_start=1
FT                   /gene="Mcts1"
FT                   /locus_tag="mCG_1040960"
FT                   /product="malignant T cell amplified sequence 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1040960.1 transcript_id=mCT172669.0
FT                   protein_id=mCP95589.0 isoform=CRA_c"
FT                   /protein_id="EDL29022.1"
FT                   /translation="MGKGRFDEKENVSNCIQLKTSVIKGIKNQLLEQFPGIEPWLNQIM
FT                   PKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIK
FT                   FVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGI
FT                   GIENIHYLNDGLWHMKTYK"
FT   gap             862100..862119
FT                   /estimated_length=20
FT   gap             865561..865861
FT                   /estimated_length=301
FT   gap             871129..871219
FT                   /estimated_length=91
FT   gap             872837..872856
FT                   /estimated_length=20
FT   gap             874873..874892
FT                   /estimated_length=20
FT   gap             876183..876252
FT                   /estimated_length=70
FT   gene            complement(880341..884661)
FT                   /gene="C1galt1c1"
FT                   /locus_tag="mCG_10888"
FT                   /note="gene_id=mCG10888.2"
FT   mRNA            complement(join(880341..881679,884534..884661))
FT                   /gene="C1galt1c1"
FT                   /locus_tag="mCG_10888"
FT                   /product="C1GALT1-specific chaperone 1"
FT                   /note="gene_id=mCG10888.2 transcript_id=mCT10749.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(880723..881673)
FT                   /codon_start=1
FT                   /gene="C1galt1c1"
FT                   /locus_tag="mCG_10888"
FT                   /product="C1GALT1-specific chaperone 1"
FT                   /note="gene_id=mCG10888.2 transcript_id=mCT10749.2
FT                   protein_id=mCP17345.2"
FT                   /protein_id="EDL29025.1"
FT                   /translation="MLSESSSFLKGVMLGSIFCALITMLGHIRIGNRMHHHEHHHLQAP
FT                   NKDDISKISEAERMELSKSFRVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVK
FT                   VFESINMDTNDMWLMMRKAYKYAYDQYRDQYNWFFLARPTTFAVIENLKYFLLKKDQSQ
FT                   PFYLGHTVKSGDLEYVSVDGGIVLSIESMKRLNSLLSVPEKCPEQGGMIWKISEDKQLA
FT                   VCLKYAGVFAENAEDADGKDVFNTKSVGLFIKEAMTNQPNQVVEGCCSDMAVTFNGLTP
FT                   NQMHVMMYGVYRLRAFGHVFNDALVFLPPNGSEND"
FT   gap             884736..884755
FT                   /estimated_length=20
FT   gap             898090..901026
FT                   /estimated_length=2937
FT   gap             912413..915387
FT                   /estimated_length=2975
FT   gap             926194..926338
FT                   /estimated_length=145
FT   gene            complement(934060..935320)
FT                   /locus_tag="mCG_119348"
FT                   /note="gene_id=mCG119348.1"
FT   mRNA            complement(934060..935320)
FT                   /locus_tag="mCG_119348"
FT                   /product="mCG119348"
FT                   /note="gene_id=mCG119348.1 transcript_id=mCT120520.1
FT                   created on 05-SEP-2002"
FT   CDS             complement(934670..935251)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119348"
FT                   /product="mCG119348"
FT                   /note="gene_id=mCG119348.1 transcript_id=mCT120520.1
FT                   protein_id=mCP87570.1"
FT                   /protein_id="EDL29026.1"
FT                   /translation="MIKAILIFNNHRKPGLSKFYQPYSEDRQQQIIRETFHLVSKRDEN
FT                   VCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENV
FT                   CELDLIFHVEKVHNILTEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVS
FT                   AVKNMNLPEIPRNINIGDISIKVPNLPSFK"
FT   gap             963575..967392
FT                   /estimated_length=3818
FT   gap             1007528..1007547
FT                   /estimated_length=20
FT   gap             1009210..1009880
FT                   /estimated_length=671
FT   gap             1017050..1020154
FT                   /estimated_length=3105
FT   gene            <1021758..1212897
FT                   /gene="6030498E09Rik"
FT                   /locus_tag="mCG_141008"
FT                   /note="gene_id=mCG141008.0"
FT   mRNA            join(<1021758..1021956,1208274..1208684,1209647..1209794,
FT                   1212353..1212897)
FT                   /gene="6030498E09Rik"
FT                   /locus_tag="mCG_141008"
FT                   /product="RIKEN cDNA 6030498E09"
FT                   /note="gene_id=mCG141008.0 transcript_id=mCT172681.1
FT                   created on 26-FEB-2003"
FT   gap             1034660..1039821
FT                   /estimated_length=5162
FT   gap             1052708..1053486
FT                   /estimated_length=779
FT   gap             1058687..1058706
FT                   /estimated_length=20
FT   gap             1060226..1060347
FT                   /estimated_length=122
FT   gap             1071895..1072061
FT                   /estimated_length=167
FT   gap             1073953..1074159
FT                   /estimated_length=207
FT   gap             1081962..1084518
FT                   /estimated_length=2557
FT   gap             1086925..1087544
FT                   /estimated_length=620
FT   gap             1090006..1090025
FT                   /estimated_length=20
FT   gap             1093198..1093476
FT                   /estimated_length=279
FT   gap             1095793..1096123
FT                   /estimated_length=331
FT   gap             1098801..1100773
FT                   /estimated_length=1973
FT   gap             1112877..1113000
FT                   /estimated_length=124
FT   gap             1138943..1138962
FT                   /estimated_length=20
FT   gene            complement(1151806..1153476)
FT                   /pseudo
FT                   /locus_tag="mCG_10959"
FT                   /note="gene_id=mCG10959.1"
FT   mRNA            complement(1151806..1153476)
FT                   /pseudo
FT                   /locus_tag="mCG_10959"
FT                   /note="gene_id=mCG10959.1 transcript_id=mCT10807.1 created
FT                   on 05-SEP-2002"
FT   gap             1164403..1164438
FT                   /estimated_length=36
FT   gap             1165857..1166022
FT                   /estimated_length=166
FT   gap             1169211..1169281
FT                   /estimated_length=71
FT   gap             1171369..1171748
FT                   /estimated_length=380
FT   gap             1175666..1175685
FT                   /estimated_length=20
FT   gap             1180393..1180412
FT                   /estimated_length=20
FT   gap             1186244..1186263
FT                   /estimated_length=20
FT   gap             1195821..1196369
FT                   /estimated_length=549
FT   gap             1202246..1202349
FT                   /estimated_length=104
FT   CDS             join(<1208285..1208684,1209647..1209765)
FT                   /codon_start=1
FT                   /gene="6030498E09Rik"
FT                   /locus_tag="mCG_141008"
FT                   /product="RIKEN cDNA 6030498E09"
FT                   /note="gene_id=mCG141008.0 transcript_id=mCT172681.1
FT                   protein_id=mCP95600.1"
FT                   /protein_id="EDL29027.1"
FT                   /translation="YLIMRSRFYTSNGSGRFPQRRRVRAVSQKSNVPGLCLYTILCFGL
FT                   GLGLGLILGLGLGLGLGLGLNSGFGLSLGLGLGTGLSIRLGRNLDMPQMASLDAVHQVS
FT                   TDNVAIEDDSVGSIMKEMDENIGQISDIRAISKYECDNWEDIHEIAADEIVKEGAEEGG
FT                   QDNHQTKAT"
FT   gene            1219994..1220446
FT                   /locus_tag="mCG_1040972"
FT                   /note="gene_id=mCG1040972.0"
FT   mRNA            1219994..1220446
FT                   /locus_tag="mCG_1040972"
FT                   /product="mCG1040972"
FT                   /note="gene_id=mCG1040972.0 transcript_id=mCT158676.1
FT                   created on 05-SEP-2002"
FT   CDS             1220027..1220203
FT                   /codon_start=1
FT                   /locus_tag="mCG_1040972"
FT                   /product="mCG1040972"
FT                   /note="gene_id=mCG1040972.0 transcript_id=mCT158676.1
FT                   protein_id=mCP87637.1"
FT                   /db_xref="GOA:Q545V5"
FT                   /db_xref="InterPro:IPR006591"
FT                   /db_xref="MGI:MGI:102725"
FT                   /db_xref="UniProtKB/TrEMBL:Q545V5"
FT                   /protein_id="EDL29028.1"
FT                   /translation="MDAQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMY
FT                   KKRTKRLVVFDAR"
FT   gap             1220912..1220931
FT                   /estimated_length=20
FT   gap             1226205..1227426
FT                   /estimated_length=1222
FT   gap             1228961..1231221
FT                   /estimated_length=2261
FT   gap             1238162..1240817
FT                   /estimated_length=2656
FT   gap             1243815..1246054
FT                   /estimated_length=2240
FT   gap             1269335..1269354
FT                   /estimated_length=20
FT   gap             1273533..1273552
FT                   /estimated_length=20
FT   gap             1278742..1278820
FT                   /estimated_length=79
FT   gap             1297969..1297988
FT                   /estimated_length=20
FT   gap             1303637..1303656
FT                   /estimated_length=20
FT   gap             1311313..1311332
FT                   /estimated_length=20
FT   gap             1315901..1318201
FT                   /estimated_length=2301
FT   gap             1319694..1320556
FT                   /estimated_length=863
FT   gap             1355675..1355694
FT                   /estimated_length=20
FT   gap             1366504..1366714
FT                   /estimated_length=211
FT   gap             1372215..1373171
FT                   /estimated_length=957
FT   gap             1375184..1387471
FT                   /estimated_length=12288
FT   gap             1397516..1402825
FT                   /estimated_length=5310
FT   gap             1406252..1406783
FT                   /estimated_length=532
FT   gap             1407855..1408210
FT                   /estimated_length=356
FT   gap             1409354..1409373
FT                   /estimated_length=20
FT   gap             1446592..1452796
FT                   /estimated_length=6205
FT   gap             1454694..1455231
FT                   /estimated_length=538
FT   gap             1457842..1458520
FT                   /estimated_length=679
FT   gap             1463069..1463788
FT                   /estimated_length=720
FT   gap             1472647..1473121
FT                   /estimated_length=475
FT   gap             1485102..1485121
FT                   /estimated_length=20
FT   gap             1487340..1487707
FT                   /estimated_length=368
FT   gap             1488873..1489025
FT                   /estimated_length=153
FT   gap             1499182..1499201
FT                   /estimated_length=20
FT   gap             1501068..1501341
FT                   /estimated_length=274
FT   gap             1504013..1504240
FT                   /estimated_length=228
FT   gap             1572718..1573856
FT                   /estimated_length=1139
FT   gap             1576117..1576683
FT                   /estimated_length=567
FT   gene            1583033..1583726
FT                   /locus_tag="mCG_120069"
FT                   /note="gene_id=mCG120069.1"
FT   mRNA            join(1583033..1583200,1583379..1583726)
FT                   /locus_tag="mCG_120069"
FT                   /product="mCG120069"
FT                   /note="gene_id=mCG120069.1 transcript_id=mCT121250.1
FT                   created on 09-SEP-2002"
FT   CDS             join(1583054..1583200,1583379..1583495)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120069"
FT                   /product="mCG120069"
FT                   /note="gene_id=mCG120069.1 transcript_id=mCT121250.1
FT                   protein_id=mCP87665.1"
FT                   /db_xref="GOA:B1AXS0"
FT                   /db_xref="MGI:MGI:3616461"
FT                   /db_xref="UniProtKB/TrEMBL:B1AXS0"
FT                   /protein_id="EDL29029.1"
FT                   /translation="MAHVVKRTPKPTAYARATSQLKKCKVSCRLKCKYSIKNQHALCYK
FT                   CCDEITGKGKRVFRLASKVKGTIKLRIVKDTCHYAQELTAYQ"
FT   gap             1584724..1584743
FT                   /estimated_length=20
FT   gap             1587945..1587964
FT                   /estimated_length=20
FT   gap             1591895..1602861
FT                   /estimated_length=10967
FT   gap             1613883..1614078
FT                   /estimated_length=196
FT   gap             1617503..1617522
FT                   /estimated_length=20
FT   gap             1621429..1621476
FT                   /estimated_length=48
FT   gap             1622715..1622787
FT                   /estimated_length=73
FT   gap             1655691..1656391
FT                   /estimated_length=701
FT   gap             1672125..1672804
FT                   /estimated_length=680
FT   gap             1674178..1676655
FT                   /estimated_length=2478
FT   gap             1680280..1680299
FT                   /estimated_length=20
FT   gap             1689017..1689036
FT                   /estimated_length=20
FT   gap             1699777..1699796
FT                   /estimated_length=20
FT   gap             1725812..1726377
FT                   /estimated_length=566
FT   gap             1731116..1732026
FT                   /estimated_length=911
FT   gap             1733268..1735398
FT                   /estimated_length=2131
FT   gap             1745860..1745879
FT                   /estimated_length=20
FT   gap             1759554..1760827
FT                   /estimated_length=1274
FT   gap             1769201..1769220
FT                   /estimated_length=20
FT   gap             1775120..1775303
FT                   /estimated_length=184
FT   gap             1788508..1789525
FT                   /estimated_length=1018
FT   gap             1795515..1795639
FT                   /estimated_length=125
FT   gap             1796028..1796313
FT                   /estimated_length=286
FT   gap             1810783..1810950
FT                   /estimated_length=168
FT   gap             1813611..1813879
FT                   /estimated_length=269
FT   gap             1817431..1817450
FT                   /estimated_length=20
FT   gap             1818829..1818988
FT                   /estimated_length=160
FT   gap             1822078..1822303
FT                   /estimated_length=226
FT   gap             1824285..1824447
FT                   /estimated_length=163
FT   gap             1826197..1831121
FT                   /estimated_length=4925
FT   gap             1833879..1834280
FT                   /estimated_length=402
FT   gap             1848208..1848651
FT                   /estimated_length=444
FT   gap             1872003..1872022
FT                   /estimated_length=20
FT   gap             1883277..1883296
FT                   /estimated_length=20
FT   gap             1890778..1899660
FT                   /estimated_length=8883
FT   gap             1901652..1902133
FT                   /estimated_length=482
FT   gap             1903259..1904114
FT                   /estimated_length=856
FT   gap             1911330..1911349
FT                   /estimated_length=20
FT   gap             1914069..1914088
FT                   /estimated_length=20
FT   gap             1925215..1925234
FT                   /estimated_length=20
FT   gap             1930056..1930075
FT                   /estimated_length=20
FT   gap             1957351..1957370
FT                   /estimated_length=20
FT   gap             1959352..1960002
FT                   /estimated_length=651
FT   gap             1969713..1969732
FT                   /estimated_length=20
FT   gap             1976462..1976865
FT                   /estimated_length=404
FT   gap             1994415..1994434
FT                   /estimated_length=20
FT   gap             2005503..2005577
FT                   /estimated_length=75
FT   gap             2011257..2011276
FT                   /estimated_length=20
FT   gene            complement(<2012731..2013116)
FT                   /locus_tag="mCG_141141"
FT                   /note="gene_id=mCG141141.0"
FT   mRNA            complement(join(<2012731..2012845,2012911..2013116))
FT                   /locus_tag="mCG_141141"
FT                   /product="mCG141141"
FT                   /note="gene_id=mCG141141.0 transcript_id=mCT173336.0
FT                   created on 09-SEP-2002"
FT   CDS             complement(join(<2012731..2012845,2012911..2012975))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141141"
FT                   /product="mCG141141"
FT                   /note="gene_id=mCG141141.0 transcript_id=mCT173336.0
FT                   protein_id=mCP96255.0"
FT                   /protein_id="EDL29030.1"
FT                   /translation="MMLIEDFKKGINNSYRRTLLNREEVLKEETQKTLKELQENTTKQK
FT                   MGLNKTIKDQKLDVE"
FT   gene            2014725..2016022
FT                   /pseudo
FT                   /locus_tag="mCG_50745"
FT                   /note="gene_id=mCG50745.2"
FT   mRNA            join(2014725..2014930,2015376..2016022)
FT                   /pseudo
FT                   /locus_tag="mCG_50745"
FT                   /note="gene_id=mCG50745.2 transcript_id=mCT50928.2 created
FT                   on 09-SEP-2002"
FT   gap             2019923..2020342
FT                   /estimated_length=420
FT   gap             2025323..2026816
FT                   /estimated_length=1494
FT   gap             2028252..2029047
FT                   /estimated_length=796
FT   gap             2032268..2032804
FT                   /estimated_length=537
FT   gap             2034344..2035835
FT                   /estimated_length=1492
FT   gap             2039365..2039384
FT                   /estimated_length=20
FT   gap             2060098..2060454
FT                   /estimated_length=357
FT   gap             2061570..2061780
FT                   /estimated_length=211
FT   gap             2080817..2080836
FT                   /estimated_length=20
FT   gene            <2089942..>2682588
FT                   /locus_tag="mCG_145460"
FT                   /note="gene_id=mCG145460.0"
FT   mRNA            join(<2089942..2090032,2285447..2285590,2584016..2584107,
FT                   2585702..2585831,2586750..2586845,2588946..2589036,
FT                   2677176..2677269,2681478..>2682588)
FT                   /locus_tag="mCG_145460"
FT                   /product="mCG145460"
FT                   /note="gene_id=mCG145460.0 transcript_id=mCT184884.0
FT                   created on 05-JUN-2003"
FT   gap             2108944..2108963
FT                   /estimated_length=20
FT   gap             2116120..2116139
FT                   /estimated_length=20
FT   gap             2150619..2150638
FT                   /estimated_length=20
FT   gap             2154249..2159034
FT                   /estimated_length=4786
FT   gap             2160309..2160341
FT                   /estimated_length=33
FT   gap             2163225..2163687
FT                   /estimated_length=463
FT   gap             2166527..2166657
FT                   /estimated_length=131
FT   gap             2176788..2176807
FT                   /estimated_length=20
FT   gap             2184618..2184688
FT                   /estimated_length=71
FT   gap             2185676..2185917
FT                   /estimated_length=242
FT   gap             2188646..2188728
FT                   /estimated_length=83
FT   gap             2194316..2194463
FT                   /estimated_length=148
FT   gap             2208381..2208487
FT                   /estimated_length=107
FT   gene            complement(2218471..2219240)
FT                   /locus_tag="mCG_16956"
FT                   /note="gene_id=mCG16956.1"
FT   mRNA            complement(2218471..2219240)
FT                   /locus_tag="mCG_16956"
FT                   /product="mCG16956"
FT                   /note="gene_id=mCG16956.1 transcript_id=mCT14841.1 created
FT                   on 11-SEP-2002"
FT   CDS             complement(2218662..2218979)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16956"
FT                   /product="mCG16956"
FT                   /note="gene_id=mCG16956.1 transcript_id=mCT14841.1
FT                   protein_id=mCP3068.1"
FT                   /protein_id="EDL29032.1"
FT                   /translation="MAFHVPDPSVSIVDLTSCLEKPSKHDDIKKVVNQASEGPLKGILG
FT                   YTEDQIVSCNFNSNSHLPTLGAGTEIALNDNFVKPMFWYDSEYCYSNRVVDLMADMASN
FT                   E"
FT   gene            complement(2225054..2226432)
FT                   /pseudo
FT                   /locus_tag="mCG_49063"
FT                   /note="gene_id=mCG49063.1"
FT   mRNA            complement(2225054..2226432)
FT                   /pseudo
FT                   /locus_tag="mCG_49063"
FT                   /note="gene_id=mCG49063.1 transcript_id=mCT49246.1 created
FT                   on 11-SEP-2002"
FT   gap             2229413..2229432
FT                   /estimated_length=20
FT   gap             2236019..2236038
FT                   /estimated_length=20
FT   gap             2239128..2239147
FT                   /estimated_length=20
FT   gap             2242137..2244345
FT                   /estimated_length=2209
FT   gap             2245165..2245345
FT                   /estimated_length=181
FT   gap             2253746..2253765
FT                   /estimated_length=20
FT   gap             2259183..2260511
FT                   /estimated_length=1329
FT   gap             2262242..2263486
FT                   /estimated_length=1245
FT   gap             2270429..2270448
FT                   /estimated_length=20
FT   gap             2278262..2278785
FT                   /estimated_length=524
FT   gap             2283776..2283988
FT                   /estimated_length=213
FT   gap             2287123..2287172
FT                   /estimated_length=50
FT   gap             2297660..2297679
FT                   /estimated_length=20
FT   gap             2299350..2299369
FT                   /estimated_length=20
FT   gap             2300490..2300509
FT                   /estimated_length=20
FT   gap             2303817..2304451
FT                   /estimated_length=635
FT   gap             2308562..2309047
FT                   /estimated_length=486
FT   gap             2324836..2324988
FT                   /estimated_length=153
FT   gap             2328588..2328783
FT                   /estimated_length=196
FT   gap             2332042..2336738
FT                   /estimated_length=4697
FT   gap             2339138..2339419
FT                   /estimated_length=282
FT   gap             2341515..2341534
FT                   /estimated_length=20
FT   gap             2345829..2345848
FT                   /estimated_length=20
FT   gene            complement(<2353756..>2354304)
FT                   /locus_tag="mCG_49953"
FT                   /note="gene_id=mCG49953.0"
FT   mRNA            complement(<2353756..>2354304)
FT                   /locus_tag="mCG_49953"
FT                   /product="mCG49953"
FT                   /note="gene_id=mCG49953.0 transcript_id=mCT50136.0 created
FT                   on 11-SEP-2002"
FT   CDS             complement(2353756..2354304)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49953"
FT                   /product="mCG49953"
FT                   /note="gene_id=mCG49953.0 transcript_id=mCT50136.0
FT                   protein_id=mCP36794.0"
FT                   /protein_id="EDL29033.1"
FT                   /translation="MVRYSLDPENPTKSCKSRGSNLRVHFKNTQETVQAIEGMHIPKAT
FT                   KYLKDVTLKKQCVPFRWYNGGVSRWAQAKWWGWTQSRWPKKSVEFLLLKNAESNARLKG
FT                   LEVESLVIEHIQVNKAPKMRRGTYRAHGRINPYMISPCHIEMILTEKEQIVPKPEEELA
FT                   QKKKISQKKLKKQKLMARE"
FT   gap             2360861..2362123
FT                   /estimated_length=1263
FT   gap             2368139..2368158
FT                   /estimated_length=20
FT   gap             2381302..2381370
FT                   /estimated_length=69
FT   gap             2388900..2388919
FT                   /estimated_length=20
FT   gap             2400327..2401706
FT                   /estimated_length=1380
FT   gap             2421579..2421598
FT                   /estimated_length=20
FT   gap             2425692..2425711
FT                   /estimated_length=20
FT   gap             2427765..2428200
FT                   /estimated_length=436
FT   gap             2431743..2431840
FT                   /estimated_length=98
FT   gap             2432790..2432993
FT                   /estimated_length=204
FT   gap             2455070..2456940
FT                   /estimated_length=1871
FT   gap             2463425..2463444
FT                   /estimated_length=20
FT   gap             2470138..2470157
FT                   /estimated_length=20
FT   gap             2482200..2482311
FT                   /estimated_length=112
FT   gap             2489662..2489681
FT                   /estimated_length=20
FT   gap             2496982..2497313
FT                   /estimated_length=332
FT   gap             2503615..2504146
FT                   /estimated_length=532
FT   gap             2508252..2508271
FT                   /estimated_length=20
FT   gap             2509957..2509993
FT                   /estimated_length=37
FT   gene            complement(<2512863..2513669)
FT                   /locus_tag="mCG_141142"
FT                   /note="gene_id=mCG141142.0"
FT   mRNA            complement(join(<2512863..2513545,2513588..2513669))
FT                   /locus_tag="mCG_141142"
FT                   /product="mCG141142"
FT                   /note="gene_id=mCG141142.0 transcript_id=mCT173337.0
FT                   created on 11-SEP-2002"
FT   CDS             complement(<2512863..2513193)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141142"
FT                   /product="mCG141142"
FT                   /note="gene_id=mCG141142.0 transcript_id=mCT173337.0
FT                   protein_id=mCP96256.0"
FT                   /protein_id="EDL29034.1"
FT                   /translation="MLFSPIDPLWVGLIVLVLFVLIYGLCYCLNRETVKTGQKILTEQQ
FT                   ESMSEKEKGLKRKRKKKGNTVLSGGQKGRNKRAEAVEEGELASVPPPYASSAATYRQTF
FT                   CPEIWR"
FT   gap             2514337..2525123
FT                   /estimated_length=10787
FT   gap             2537323..2537568
FT                   /estimated_length=246
FT   gap             2556056..2556369
FT                   /estimated_length=314
FT   gap             2561404..2561469
FT                   /estimated_length=66
FT   gap             2574407..2574896
FT                   /estimated_length=490
FT   gap             2578856..2579752
FT                   /estimated_length=897
FT   gap             2587577..2587635
FT                   /estimated_length=59
FT   gap             2617855..2618212
FT                   /estimated_length=358
FT   gap             2648247..2648325
FT                   /estimated_length=79
FT   gap             2652556..2652575
FT                   /estimated_length=20
FT   gap             2654233..2654345
FT                   /estimated_length=113
FT   gap             2662321..2662376
FT                   /estimated_length=56
FT   gap             2664407..2664426
FT                   /estimated_length=20
FT   CDS             <2682244..>2682588
FT                   /codon_start=1
FT                   /locus_tag="mCG_145460"
FT                   /product="mCG145460"
FT                   /note="gene_id=mCG145460.0 transcript_id=mCT184884.0
FT                   protein_id=mCP105981.0"
FT                   /protein_id="EDL29031.1"
FT                   /translation="ESSHRYWELTPDPPQDWQVLITAAPPLMSHELYFIKIKDVYSLRR
FT                   YVTGSETNTEHVIKVYKIKLKPNTKKAKLNFKLSSNLKISNASCNALLKLKCIVNIPFF
FT                   YKHFSKRIVES"
FT   gap             2686753..2689251
FT                   /estimated_length=2499
FT   gap             2718895..2719261
FT                   /estimated_length=367
FT   gap             2733937..2733956
FT                   /estimated_length=20
FT   gap             2737000..2738875
FT                   /estimated_length=1876
FT   gap             2745805..2746953
FT                   /estimated_length=1149
FT   gap             2757971..2758180
FT                   /estimated_length=210
FT   gap             2759019..2759359
FT                   /estimated_length=341
FT   gap             2768846..2769541
FT                   /estimated_length=696
FT   gap             2790015..2790134
FT                   /estimated_length=120
FT   gap             2796084..2796216
FT                   /estimated_length=133
FT   gap             2801595..2801614
FT                   /estimated_length=20
FT   gap             2808406..2808425
FT                   /estimated_length=20
FT   gap             2817070..2817168
FT                   /estimated_length=99
FT   gap             2820767..2820786
FT                   /estimated_length=20
FT   gap             2832556..2832575
FT                   /estimated_length=20
FT   gap             2834723..2835187
FT                   /estimated_length=465
FT   gap             2836007..2836578
FT                   /estimated_length=572
FT   gap             2838629..2845102
FT                   /estimated_length=6474
FT   gap             2871796..2871837
FT                   /estimated_length=42
FT   gap             2893582..2893601
FT                   /estimated_length=20
FT   gap             2923477..2923496
FT                   /estimated_length=20
FT   gap             2926183..2926202
FT                   /estimated_length=20
FT   gap             2933874..2933893
FT                   /estimated_length=20
FT   gap             2966223..2966861
FT                   /estimated_length=639
FT   gap             2967752..2968173
FT                   /estimated_length=422
FT   gap             2970802..2970868
FT                   /estimated_length=67
FT   gap             2981009..2981033
FT                   /estimated_length=25
FT   gap             2990742..2990927
FT                   /estimated_length=186
FT   gap             2994159..2994178
FT                   /estimated_length=20
FT   gap             3023022..3023157
FT                   /estimated_length=136
FT   gap             3040582..3046599
FT                   /estimated_length=6018
FT   gap             3058439..3058458
FT                   /estimated_length=20
FT   gap             3065169..3065284
FT                   /estimated_length=116
FT   gap             3070123..3070194
FT                   /estimated_length=72
FT   gap             3074376..3077591
FT                   /estimated_length=3216
FT   gap             3079673..3080036
FT                   /estimated_length=364
FT   gap             3086545..3086564
FT                   /estimated_length=20
FT   gap             3099290..3099309
FT                   /estimated_length=20
FT   gap             3113877..3113943
FT                   /estimated_length=67
FT   gap             3124782..3125031
FT                   /estimated_length=250
FT   gap             3130704..3130723
FT                   /estimated_length=20
FT   gene            complement(3132980..3134039)
FT                   /pseudo
FT                   /locus_tag="mCG_1041008"
FT                   /note="gene_id=mCG1041008.1"
FT   mRNA            complement(3132980..3134039)
FT                   /pseudo
FT                   /locus_tag="mCG_1041008"
FT                   /note="gene_id=mCG1041008.1 transcript_id=mCT158712.1
FT                   created on 17-SEP-2002"
FT   gap             3146620..3146639
FT                   /estimated_length=20
FT   gap             3147906..3148067
FT                   /estimated_length=162
FT   gap             3154092..3154111
FT                   /estimated_length=20
FT   gap             3160304..3160323
FT                   /estimated_length=20
FT   gap             3164924..3166212
FT                   /estimated_length=1289
FT   gap             3169629..3169759
FT                   /estimated_length=131
FT   gap             3174547..3174621
FT                   /estimated_length=75
FT   gap             3182130..3182149
FT                   /estimated_length=20
FT   gap             3183716..3183749
FT                   /estimated_length=34
FT   gap             3185156..3185175
FT                   /estimated_length=20
FT   gap             3191525..3197618
FT                   /estimated_length=6094
FT   gap             3202533..3202932
FT                   /estimated_length=400
FT   gap             3210467..3210558
FT                   /estimated_length=92
FT   gap             3224562..3224581
FT                   /estimated_length=20
FT   gap             3228004..3228143
FT                   /estimated_length=140
FT   gap             3228931..3229112
FT                   /estimated_length=182
FT   gap             3242484..3242503
FT                   /estimated_length=20
FT   gap             3243276..3243475
FT                   /estimated_length=200
FT   gap             3245095..3245117
FT                   /estimated_length=23
FT   gap             3287123..3287142
FT                   /estimated_length=20
FT   gap             3290934..3291176
FT                   /estimated_length=243
FT   gap             3295364..3297329
FT                   /estimated_length=1966
FT   gap             3306575..3306768
FT                   /estimated_length=194
FT   gap             3328871..3330119
FT                   /estimated_length=1249
FT   gap             3336088..3336107
FT                   /estimated_length=20
FT   gap             3337689..3337866
FT                   /estimated_length=178
FT   gap             3350993..3351012
FT                   /estimated_length=20
FT   gap             3355748..3355916
FT                   /estimated_length=169
FT   gap             3364057..3364076
FT                   /estimated_length=20
FT   gap             3368739..3369342
FT                   /estimated_length=604
FT   gap             3374812..3378113
FT                   /estimated_length=3302
FT   gap             3381447..3384022
FT                   /estimated_length=2576
FT   gap             3389487..3389506
FT                   /estimated_length=20
FT   gap             3391521..3392073
FT                   /estimated_length=553
FT   gap             3394386..3394405
FT                   /estimated_length=20
FT   gap             3406221..3406240
FT                   /estimated_length=20
FT   gap             3421666..3421685
FT                   /estimated_length=20
FT   gap             3427449..3428882
FT                   /estimated_length=1434
FT   gene            3439022..3440791
FT                   /pseudo
FT                   /locus_tag="mCG_116326"
FT                   /note="gene_id=mCG116326.1"
FT   mRNA            3439022..3440791
FT                   /pseudo
FT                   /locus_tag="mCG_116326"
FT                   /note="gene_id=mCG116326.1 transcript_id=mCT117446.1
FT                   created on 17-SEP-2002"
FT   gap             3440792..3440895
FT                   /estimated_length=104
FT   gap             3459526..3459616
FT                   /estimated_length=91
FT   gap             3479145..3479164
FT                   /estimated_length=20
FT   gap             3480398..3480417
FT                   /estimated_length=20
FT   gap             3494393..3501814
FT                   /estimated_length=7422
FT   gap             3565366..3565385
FT                   /estimated_length=20
FT   gap             3588432..3588538
FT                   /estimated_length=107
FT   gene            3592773..3868032
FT                   /gene="Gria3"
FT                   /locus_tag="mCG_51875"
FT                   /note="gene_id=mCG51875.2"
FT   mRNA            join(3592773..3592945,3594091..3594249,3670035..3670274,
FT                   3731020..3731207,3759810..3759863,3778386..3778547,
FT                   3781634..3781801,3785606..3785710,3786543..3786650,
FT                   3788378..3788584,3799838..3800214,3810710..3810908,
FT                   3843406..3843653,3858987..3859101,3861705..3861952,
FT                   3865778..3868032)
FT                   /gene="Gria3"
FT                   /locus_tag="mCG_51875"
FT                   /product="glutamate receptor, ionotropic, AMPA3 (alpha 3)"
FT                   /note="gene_id=mCG51875.2 transcript_id=mCT52058.2 created
FT                   on 17-SEP-2002"
FT   CDS             join(3592855..3592945,3594091..3594249,3670035..3670274,
FT                   3731020..3731207,3759810..3759863,3778386..3778547,
FT                   3781634..3781801,3785606..3785710,3786543..3786650,
FT                   3788378..3788584,3799838..3800214,3810710..3810908,
FT                   3843406..3843653,3858987..3859101,3861705..3861950)
FT                   /codon_start=1
FT                   /gene="Gria3"
FT                   /locus_tag="mCG_51875"
FT                   /product="glutamate receptor, ionotropic, AMPA3 (alpha 3)"
FT                   /note="gene_id=mCG51875.2 transcript_id=mCT52058.2
FT                   protein_id=mCP30282.2"
FT                   /db_xref="GOA:Q9Z2W9"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:95810"
FT                   /db_xref="PDB:3LSW"
FT                   /db_xref="PDB:3LSX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2W9"
FT                   /protein_id="EDL29035.1"
FT                   /translation="MGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAF
FT                   RFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSM
FT                   NTLTSFCGALHTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGYYKWEKFVYLYDTER
FT                   GFSILQAIMEAAVQNNWQVTARSVGNIKDIQEFRRIIEEMDRRQEKRYLIDCEVERINT
FT                   ILEQVVILGKHSRGYHYMLANLGFTDIVLERVMHGGANITGFQIVNNENPMVQQFIQRW
FT                   VRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAV
FT                   PWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERF
FT                   VPFSDQQISNDSSSSENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAK
FT                   HVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSK
FT                   PFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWH
FT                   LEDNNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFT
FT                   LIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYE
FT                   KMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNL
FT                   DSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSA
FT                   LSLSNVAGVFYILVGGLGLAMMVALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNY
FT                   ATYREGYNVYGTESVKI"
FT   gap             3615157..3615176
FT                   /estimated_length=20
FT   gap             3616644..3616663
FT                   /estimated_length=20
FT   gap             3650996..3651310
FT                   /estimated_length=315
FT   gap             3653096..3653167
FT                   /estimated_length=72
FT   gap             3662223..3662397
FT                   /estimated_length=175
FT   gap             3663628..3664117
FT                   /estimated_length=490
FT   gap             3666500..3667394
FT                   /estimated_length=895
FT   gap             3669982..3670001
FT                   /estimated_length=20
FT   gap             3674944..3679757
FT                   /estimated_length=4814
FT   gap             3681803..3682928
FT                   /estimated_length=1126
FT   gap             3688426..3688523
FT                   /estimated_length=98
FT   gap             3692507..3692648
FT                   /estimated_length=142
FT   gap             3713931..3714026
FT                   /estimated_length=96
FT   gap             3733413..3733783
FT                   /estimated_length=371
FT   gap             3740849..3741498
FT                   /estimated_length=650
FT   gap             3809444..3809463
FT                   /estimated_length=20
FT   gap             3814996..3815015
FT                   /estimated_length=20
FT   gap             3816934..3816953
FT                   /estimated_length=20
FT   gap             3819002..3819422
FT                   /estimated_length=421
FT   gap             3820164..3820296
FT                   /estimated_length=133
FT   gap             3822311..3822656
FT                   /estimated_length=346
FT   gap             3825207..3825494
FT                   /estimated_length=288
FT   gap             3828196..3832553
FT                   /estimated_length=4358
FT   gap             3836424..3837300
FT                   /estimated_length=877
FT   gap             3842080..3842348
FT                   /estimated_length=269
FT   gap             3852186..3852315
FT                   /estimated_length=130
FT   gap             3864140..3864748
FT                   /estimated_length=609
FT   gap             3875659..3875727
FT                   /estimated_length=69
FT   gap             3888384..3894029
FT                   /estimated_length=5646
FT   gap             3898751..3898967
FT                   /estimated_length=217
FT   gap             3900886..3900905
FT                   /estimated_length=20
FT   gap             3913884..3913903
FT                   /estimated_length=20
FT   gap             3926359..3926378
FT                   /estimated_length=20
FT   gap             3930582..3937939
FT                   /estimated_length=7358
FT   gap             3943144..3944195
FT                   /estimated_length=1052
FT   gap             3945280..3945608
FT                   /estimated_length=329
FT   gap             3952715..3952734
FT                   /estimated_length=20
FT   gap             3957291..3957373
FT                   /estimated_length=83
FT   gap             3960531..3963919
FT                   /estimated_length=3389
FT   gap             3970444..3970463
FT                   /estimated_length=20
FT   gap             3977297..3977334
FT                   /estimated_length=38
FT   gene            complement(3983355..4100229)
FT                   /locus_tag="mCG_116904"
FT                   /note="gene_id=mCG116904.1"
FT   mRNA            complement(join(3983355..3986145,3991281..3991326,
FT                   3991790..3991866,3994695..3994855,3994938..3995007,
FT                   3995327..3995464,4000796..4000912,4002287..4002345,
FT                   4002535..4002965,4010805..4010907,4011130..4011308,
FT                   4011799..4011983,4012071..4012202,4012527..4012655,
FT                   4013873..4014030,4014457..4014635,4015596..4015794,
FT                   4019027..4019191,4021642..4021821,4023431..4023548,
FT                   4026456..4026536,4026925..4027018,4027891..4027975,
FT                   4032266..4032367,4032464..4032594,4033003..4033044,
FT                   4045064..4045259,4046394..4046566,4047129..4047284,
FT                   4048455..4048547,4052359..4052525,4060620..4060753,
FT                   4060895..4061016,4062212..4062282,4068216..4068267,
FT                   4070239..4070330,4086120..4086178,4100129..4100229))
FT                   /locus_tag="mCG_116904"
FT                   /product="mCG116904, transcript variant mCT158715"
FT                   /note="gene_id=mCG116904.1 transcript_id=mCT158715.1
FT                   created on 13-AUG-2002"
FT   mRNA            complement(join(3983355..3986145,3991281..3991326,
FT                   3991790..3991866,3994695..3994855,3994938..3995007,
FT                   3995327..3995697))
FT                   /locus_tag="mCG_116904"
FT                   /product="mCG116904, transcript variant mCT117447"
FT                   /note="gene_id=mCG116904.1 transcript_id=mCT117447.1
FT                   created on 13-AUG-2002"
FT   gap             3986425..3986639
FT                   /estimated_length=215
FT   CDS             complement(join(3991299..3991326,3991790..3991866,
FT                   3994695..3994855,3994938..3995007,3995327..3995413))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116904"
FT                   /product="mCG116904, isoform CRA_b"
FT                   /note="gene_id=mCG116904.1 transcript_id=mCT117447.1
FT                   protein_id=mCP87565.1 isoform=CRA_b"
FT                   /protein_id="EDL29037.1"
FT                   /translation="MDKKDLDKSRERSREREKKDEKDRKERKRDHSNNDREVPPDITKR
FT                   RKEENGTMGVSKHKSESPCESQYPNEKDKEKNKSKSSGKEKSSSDSFKSEKMDKISSGG
FT                   KKESRHDKEKIEKKEKRDSSGGKEEKKHHKSSDKHR"
FT   gap             3992145..3992358
FT                   /estimated_length=214
FT   gap             3993859..3994010
FT                   /estimated_length=152
FT   gap             3996821..3996938
FT                   /estimated_length=118
FT   gap             3998820..3999856
FT                   /estimated_length=1037
FT   mRNA            complement(join(4000383..4000831,4002287..4002345,
FT                   4002535..4002965,4010805..4010907,4011130..4011308,
FT                   4011799..4011983,4012071..4012202,4012527..4012655,
FT                   4013873..4014030,4014457..4014635,4015596..4015794,
FT                   4019027..4019191,4021642..4021821,4023431..4023548,
FT                   4026456..4026536,4026925..4027018,4027891..4027975,
FT                   4032266..4032367,4032464..4032594,4033003..4033044,
FT                   4045064..4045259,4046394..4046566,4047129..4047284,
FT                   4048455..4048547,4052359..4052525,4060620..4060753,
FT                   4060895..4061016,4062212..4062282,4068216..4068267,
FT                   4070239..4070330,4086120..4086178,4100129..4100229))
FT                   /locus_tag="mCG_116904"
FT                   /product="mCG116904, transcript variant mCT118032"
FT                   /note="gene_id=mCG116904.1 transcript_id=mCT118032.1
FT                   created on 13-AUG-2002"
FT   gap             4003896..4003935
FT                   /estimated_length=40
FT   gap             4008143..4008272
FT                   /estimated_length=130
FT   gap             4010727..4010765
FT                   /estimated_length=39
FT   gap             4015262..4015575
FT                   /estimated_length=314
FT   CDS             complement(join(4023535..4023548,4026456..4026536,
FT                   4026925..4027018,4027891..4027975,4032266..4032367,
FT                   4032464..4032594,4033003..4033044,4045064..4045259,
FT                   4046394..4046566,4047129..4047284,4048455..4048547,
FT                   4052359..4052525,4060620..4060753,4060895..4061016,
FT                   4062212..4062282,4068216..4068267,4070239..4070330,
FT                   4086120..4086178,4100129..4100199))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116904"
FT                   /product="mCG116904, isoform CRA_a"
FT                   /note="gene_id=mCG116904.1 transcript_id=mCT158715.1
FT                   protein_id=mCP87692.1 isoform=CRA_a"
FT                   /protein_id="EDL29036.1"
FT                   /translation="MAAAAVVVPAEWIKNWEKSGRGEFLHLCRILSENKSHDSSTYRDF
FT                   QQALYELSYHVIKGNLKHEQASSVLNDISEFREDMPSILADVFCILDIETNCLEEKSKR
FT                   DYFTQLVLACLYLVSDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFN
FT                   LLREENEGYAKLIAELGQDLSGNITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRP
FT                   EHDDFFISLLESYMSMCEPQTLCHILGFKFKFYQEPSGETPSSLYRVAAVLLQFNLIDL
FT                   DDLYVHLLPADNCIMDEYKREIVEAKQIVRKLTMVVLSSEKLDERDKEKDKDDEKVEKP
FT                   PDNQKLGLLEALLKVGDWQHAQNIMDQMPPYYAASHKLIALAICKLIHITVEPLYRRVG
FT                   VPKGAKGSPVSALQNKRAPKQVESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKS
FT                   FMKEFQSDGSKQEDKEKTEVILSCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPY
FT                   QHRYRLYGQWKNETYNGHPLLVKVKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNP
FT                   TILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTI
FT                   SSWLQILTY"
FT   CDS             complement(join(4023535..4023548,4026456..4026536,
FT                   4026925..4027018,4027891..4027975,4032266..4032367,
FT                   4032464..4032594,4033003..4033044,4045064..4045259,
FT                   4046394..4046566,4047129..4047284,4048455..4048547,
FT                   4052359..4052525,4060620..4060753,4060895..4061016,
FT                   4062212..4062282,4068216..4068267,4070239..4070330,
FT                   4086120..4086178,4100129..4100199))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116904"
FT                   /product="mCG116904, isoform CRA_a"
FT                   /note="gene_id=mCG116904.1 transcript_id=mCT118032.1
FT                   protein_id=mCP87521.1 isoform=CRA_a"
FT                   /protein_id="EDL29038.1"
FT                   /translation="MAAAAVVVPAEWIKNWEKSGRGEFLHLCRILSENKSHDSSTYRDF
FT                   QQALYELSYHVIKGNLKHEQASSVLNDISEFREDMPSILADVFCILDIETNCLEEKSKR
FT                   DYFTQLVLACLYLVSDTVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFN
FT                   LLREENEGYAKLIAELGQDLSGNITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRP
FT                   EHDDFFISLLESYMSMCEPQTLCHILGFKFKFYQEPSGETPSSLYRVAAVLLQFNLIDL
FT                   DDLYVHLLPADNCIMDEYKREIVEAKQIVRKLTMVVLSSEKLDERDKEKDKDDEKVEKP
FT                   PDNQKLGLLEALLKVGDWQHAQNIMDQMPPYYAASHKLIALAICKLIHITVEPLYRRVG
FT                   VPKGAKGSPVSALQNKRAPKQVESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKS
FT                   FMKEFQSDGSKQEDKEKTEVILSCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPY
FT                   QHRYRLYGQWKNETYNGHPLLVKVKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNP
FT                   TILFDYILSQIQKYDNLITPVVDSLKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTI
FT                   SSWLQILTY"
FT   gap             4024219..4025001
FT                   /estimated_length=783
FT   gap             4028711..4028742
FT                   /estimated_length=32
FT   gap             4039613..4039632
FT                   /estimated_length=20
FT   gap             4127826..4127845
FT                   /estimated_length=20
FT   gap             4193632..4193671
FT                   /estimated_length=40
FT   gap             4204987..4205321
FT                   /estimated_length=335
FT   gap             4206680..4206699
FT                   /estimated_length=20
FT   gap             4208600..4208619
FT                   /estimated_length=20
FT   gap             4211707..4212274
FT                   /estimated_length=568
FT   gap             4213570..4213934
FT                   /estimated_length=365
FT   gap             4218938..4218992
FT                   /estimated_length=55
FT   gap             4222650..4222979
FT                   /estimated_length=330
FT   gap             4230136..4230288
FT                   /estimated_length=153
FT   gap             4238562..4239193
FT                   /estimated_length=632
FT   gap             4244650..4244669
FT                   /estimated_length=20
FT   gap             4247437..4247621
FT                   /estimated_length=185
FT   gap             4248012..4248084
FT                   /estimated_length=73
FT   gene            4250783..4289085
FT                   /gene="Birc4"
FT                   /locus_tag="mCG_116900"
FT                   /note="gene_id=mCG116900.1"
FT   mRNA            join(4250783..4250961,4273779..4274684,4276036..4276135,
FT                   4278227..4278305,4279266..4279308,4281425..4281625,
FT                   4284220..4289085)
FT                   /gene="Birc4"
FT                   /locus_tag="mCG_116900"
FT                   /product="baculoviral IAP repeat-containing 4, transcript
FT                   variant mCT175112"
FT                   /note="gene_id=mCG116900.1 transcript_id=mCT175112.0
FT                   created on 17-OCT-2002"
FT   gap             4264652..4264893
FT                   /estimated_length=242
FT   mRNA            join(4273136..4274684,4276036..4276135,4278227..4278305,
FT                   4279266..4279308,4281425..4281625,4284220..4289085)
FT                   /gene="Birc4"
FT                   /locus_tag="mCG_116900"
FT                   /product="baculoviral IAP repeat-containing 4, transcript
FT                   variant mCT118028"
FT                   /note="gene_id=mCG116900.1 transcript_id=mCT118028.1
FT                   created on 17-OCT-2002"
FT   gap             4273284..4273303
FT                   /estimated_length=20
FT   CDS             join(4273811..4274684,4276036..4276135,4278227..4278305,
FT                   4279266..4279308,4281425..4281625,4284220..4284413)
FT                   /codon_start=1
FT                   /gene="Birc4"
FT                   /locus_tag="mCG_116900"
FT                   /product="baculoviral IAP repeat-containing 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG116900.1 transcript_id=mCT118028.1
FT                   protein_id=mCP87629.1 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q60989"
FT                   /db_xref="InterPro:IPR001370"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="MGI:MGI:107572"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60989"
FT                   /protein_id="EDL29039.1"
FT                   /translation="MTFNSFEGTRTFVLADTNKDEEFVEEFNRLKTFANFPSSSPVSAS
FT                   TLARAGFLYTGEGDTVQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFINGFYFENGAAQ
FT                   STNPGIQNGQYKSENCVGNRNPFAPDRPPETHADYLLRTGQVVDISDTIYPRNPAMCSE
FT                   EARLKSFQNWPDYAHLTPRELASAGLYYTGADDQVQCFCCGGKLKNWEPCDRAWSEHRR
FT                   HFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYEARIVTFGTWTSSVNKE
FT                   QLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINN
FT                   IHLTHSLEESLGRTAEKTPSLTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTS
FT                   GSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIA
FT                   IVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS"
FT   CDS             join(4273811..4274684,4276036..4276135,4278227..4278305,
FT                   4279266..4279308,4281425..4281625,4284220..4284413)
FT                   /codon_start=1
FT                   /gene="Birc4"
FT                   /locus_tag="mCG_116900"
FT                   /product="baculoviral IAP repeat-containing 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG116900.1 transcript_id=mCT175112.0
FT                   protein_id=mCP98031.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q60989"
FT                   /db_xref="InterPro:IPR001370"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="MGI:MGI:107572"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60989"
FT                   /protein_id="EDL29040.1"
FT                   /translation="MTFNSFEGTRTFVLADTNKDEEFVEEFNRLKTFANFPSSSPVSAS
FT                   TLARAGFLYTGEGDTVQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFINGFYFENGAAQ
FT                   STNPGIQNGQYKSENCVGNRNPFAPDRPPETHADYLLRTGQVVDISDTIYPRNPAMCSE
FT                   EARLKSFQNWPDYAHLTPRELASAGLYYTGADDQVQCFCCGGKLKNWEPCDRAWSEHRR
FT                   HFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYEARIVTFGTWTSSVNKE
FT                   QLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINN
FT                   IHLTHSLEESLGRTAEKTPSLTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTS
FT                   GSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIA
FT                   IVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS"
FT   gap             4275459..4275501
FT                   /estimated_length=43
FT   gap             4299672..4299691
FT                   /estimated_length=20
FT   gap             4301753..4301772
FT                   /estimated_length=20
FT   gap             4305006..4305109
FT                   /estimated_length=104
FT   gene            4307289..4310318
FT                   /pseudo
FT                   /locus_tag="mCG_141397"
FT                   /note="gene_id=mCG141397.0"
FT   mRNA            join(4307289..4307487,4307507..4308278,4308324..4308434,
FT                   4308932..4309515,4309730..4309810,4310242..4310318)
FT                   /pseudo
FT                   /locus_tag="mCG_141397"
FT                   /note="gene_id=mCG141397.0 transcript_id=mCT175111.0
FT                   created on 18-OCT-2002"
FT   gap             4326175..4326194
FT                   /estimated_length=20
FT   gap             4328704..4328939
FT                   /estimated_length=236
FT   gene            <4329283..4455900
FT                   /gene="Stag2"
FT                   /locus_tag="mCG_116901"
FT                   /note="gene_id=mCG116901.1"
FT   mRNA            join(<4329283..4329361,4381920..4382059,4386097..4386175,
FT                   4391050..4391214,4397308..4397404,4400951..4401027,
FT                   4403219..4403423,4404901..4405052,4406762..4406835,
FT                   4408184..4408307,4409097..4409195,4409292..4409372,
FT                   4414367..4414478,4416012..4416129,4416674..4416777,
FT                   4425904..4425996,4426117..4426206,4426788..4426991,
FT                   4428943..4428978,4429283..4429370,4429472..4429552,
FT                   4432005..4432097,4432628..4432802,4435806..4435945,
FT                   4436977..4437078,4438306..4438454,4439555..4439683,
FT                   4441610..4441833,4445037..4445226,4448332..4448458,
FT                   4450196..4450273,4453988..4455900)
FT                   /gene="Stag2"
FT                   /locus_tag="mCG_116901"
FT                   /product="stromal antigen 2"
FT                   /note="gene_id=mCG116901.1 transcript_id=mCT118029.1
FT                   created on 18-OCT-2002"
FT   gap             4329450..4330520
FT                   /estimated_length=1071
FT   gap             4335243..4335627
FT                   /estimated_length=385
FT   gap             4340831..4341620
FT                   /estimated_length=790
FT   gap             4360585..4360604
FT                   /estimated_length=20
FT   gap             4363681..4363700
FT                   /estimated_length=20
FT   gap             4384954..4384973
FT                   /estimated_length=20
FT   gap             4386880..4386912
FT                   /estimated_length=33
FT   gap             4411402..4411647
FT                   /estimated_length=246
FT   gap             4413361..4414266
FT                   /estimated_length=906
FT   gap             4418248..4418586
FT                   /estimated_length=339
FT   gap             4428979..4429144
FT                   /estimated_length=166
FT   CDS             join(<4429284..4429370,4429472..4429552,4432005..4432097,
FT                   4432628..4432802,4435806..4435945,4436977..4437078,
FT                   4438306..4438454,4439555..4439683,4441610..4441833,
FT                   4445037..4445226,4448332..4448458,4450196..4450273,
FT                   4453988..4454011)
FT                   /codon_start=1
FT                   /gene="Stag2"
FT                   /locus_tag="mCG_116901"
FT                   /product="stromal antigen 2"
FT                   /note="gene_id=mCG116901.1 transcript_id=mCT118029.1
FT                   protein_id=mCP87633.1"
FT                   /protein_id="EDL29041.1"
FT                   /translation="AHDLSKWDLFACNYKLLKTGIENGDMPEQIVIHALQCAHYVILWQ
FT                   LAKITESTSTKEDLLRLKKQMRVFCQICQHYLTNVNTTVKEQAFTILCDILMIFSHQIM
FT                   SGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDDSNSADGQQEDEASKIEALHKRR
FT                   NLLAAFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDIIKETMSKTRQIDKIQCAKTLIL
FT                   SLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTFGLDQLKTREAIAMLHKDGIEF
FT                   AFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQMSLRREDVWL
FT                   PLMSYRNSLLAGGDDDTMSVISGMSSRGSTVRSKKSKPSTGKRKVVEGMQLALPEESSS
FT                   SDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMSVYPMQAEHHQTPLDYNR
FT                   RGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDLPPSKNRRERTELKPDFFD
FT                   PASIMDESVLGVSMF"
FT   gap             4451049..4451068
FT                   /estimated_length=20
FT   gap             4453174..4453754
FT                   /estimated_length=581
FT   gap             4464160..4464179
FT                   /estimated_length=20
FT   gap             4475874..4476014
FT                   /estimated_length=141
FT   gap             4478923..4483184
FT                   /estimated_length=4262
FT   gap             4495554..4495637
FT                   /estimated_length=84
FT   gap             4499863..4500113
FT                   /estimated_length=251
FT   gap             4508032..4510268
FT                   /estimated_length=2237
FT   gap             4512046..4512065
FT                   /estimated_length=20
FT   gap             4521722..4521741
FT                   /estimated_length=20
FT   gap             4523068..4523469
FT                   /estimated_length=402
FT   gap             4528072..4528441
FT                   /estimated_length=370
FT   gap             4533574..4533593
FT                   /estimated_length=20
FT   gap             4537616..4537635
FT                   /estimated_length=20
FT   gap             4550311..4550330
FT                   /estimated_length=20
FT   gap             4555593..4555708
FT                   /estimated_length=116
FT   gap             4558166..4558185
FT                   /estimated_length=20
FT   gap             4577336..4579094
FT                   /estimated_length=1759
FT   gap             4580135..4580651
FT                   /estimated_length=517
FT   gene            4581671..4583786
FT                   /locus_tag="mCG_147978"
FT                   /note="gene_id=mCG147978.0"
FT   mRNA            join(4581671..4582205,4583210..4583786)
FT                   /locus_tag="mCG_147978"
FT                   /product="mCG147978"
FT                   /note="gene_id=mCG147978.0 transcript_id=mCT188241.0
FT                   created on 13-JAN-2004"
FT   CDS             4581894..4582106
FT                   /codon_start=1
FT                   /locus_tag="mCG_147978"
FT                   /product="mCG147978"
FT                   /note="gene_id=mCG147978.0 transcript_id=mCT188241.0
FT                   protein_id=mCP109516.0"
FT                   /protein_id="EDL29042.1"
FT                   /translation="MKLKSFSKAKILVYRIVLTILFFFHMKLRFVLSRFIKNCVGSLMG
FT                   IALFIIARNWKQPRCPSTEEWIQKM"
FT   gap             4589803..4589822
FT                   /estimated_length=20
FT   gap             4593524..4593714
FT                   /estimated_length=191
FT   gap             4595099..4595118
FT                   /estimated_length=20
FT   gap             4600795..4601441
FT                   /estimated_length=647
FT   gap             4604611..4604792
FT                   /estimated_length=182
FT   gap             4626129..4627079
FT                   /estimated_length=951
FT   gap             4670080..4670240
FT                   /estimated_length=161
FT   gap             4671749..4672166
FT                   /estimated_length=418
FT   gap             4675037..4675217
FT                   /estimated_length=181
FT   gap             4680167..4680323
FT                   /estimated_length=157
FT   gene            <4680324..4699694
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /note="gene_id=mCG17269.2"
FT   mRNA            join(<4680324..4680447,4692884..4692947,4698240..4698381,
FT                   4699312..4699694)
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /product="SH2 domain protein 1A, transcript variant
FT                   mCT192572"
FT                   /note="gene_id=mCG17269.2 transcript_id=mCT192572.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<4680324..4680456,4692884..4692947,4698240..4698381,
FT                   4699312..4699678)
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /product="SH2 domain protein 1A, transcript variant
FT                   mCT17148"
FT                   /note="gene_id=mCG17269.2 transcript_id=mCT17148.1 created
FT                   on 18-OCT-2002"
FT   CDS             join(<4680326..4680456,4692884..4692947,4698240..4698381,
FT                   4699312..4699349)
FT                   /codon_start=1
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /product="SH2 domain protein 1A, isoform CRA_a"
FT                   /note="gene_id=mCG17269.2 transcript_id=mCT17148.1
FT                   protein_id=mCP10375.1 isoform=CRA_a"
FT                   /protein_id="EDL29043.1"
FT                   /translation="AVTVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLY
FT                   QGYIYTYRVSQTETGSWSAETAPGVHKRFFRKVKNLISAFQKPDQGIVTPLQYPVEKSS
FT                   GRGPQAPTGRRDSDICLNAP"
FT   CDS             join(<4680326..4680447,4692884..4692947,4698240..4698381,
FT                   4699312..4699349)
FT                   /codon_start=1
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /product="SH2 domain protein 1A, isoform CRA_c"
FT                   /note="gene_id=mCG17269.2 transcript_id=mCT192572.0
FT                   protein_id=mCP113538.0 isoform=CRA_c"
FT                   /protein_id="EDL29045.1"
FT                   /translation="AVTVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLYQGY
FT                   IYTYRVSQTETGSWSAETAPGVHKRFFRKVKNLISAFQKPDQGIVTPLQYPVEKSSGRG
FT                   PQAPTGRRDSDICLNAP"
FT   mRNA            join(<4680357..4680456,4698240..4698381,4699312..4699694)
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /product="SH2 domain protein 1A, transcript variant
FT                   mCT175114"
FT                   /note="gene_id=mCG17269.2 transcript_id=mCT175114.0 created
FT                   on 18-OCT-2002"
FT   CDS             join(<4680358..4680456,4698240..4698381,4699312..4699349)
FT                   /codon_start=1
FT                   /gene="Sh2d1a"
FT                   /locus_tag="mCG_17269"
FT                   /product="SH2 domain protein 1A, isoform CRA_b"
FT                   /note="gene_id=mCG17269.2 transcript_id=mCT175114.0
FT                   protein_id=mCP98033.0 isoform=CRA_b"
FT                   /protein_id="EDL29044.1"
FT                   /translation="GDRGEALTRYRAGWKLSAARQRECPWRVLPVCFTAPGVHKRFFRK
FT                   VKNLISAFQKPDQGIVTPLQYPVEKSSGRGPQAPTGRRDSDICLNAP"
FT   gene            complement(4710013..5573461)
FT                   /gene="Odz1"
FT                   /locus_tag="mCG_141398"
FT                   /note="gene_id=mCG141398.1"
FT   mRNA            complement(join(4710013..4710816,4712577..4712719,
FT                   4713241..4714461,4715290..4715677,4721562..4721858,
FT                   4733241..4733476,4734510..4734682,4753381..4753891,
FT                   4755296..4755662,4785444..4785598,4819427..4819659,
FT                   4825245..4825265,4834314..4834563,4840992..4841135,
FT                   4860690..4860957,4865602..4865863,4871541..4871660,
FT                   4890871..4891087,4901249..4901395,4903239..4903262,
FT                   4905455..4905640,4979463..4979663,4982881..4983075,
FT                   4986283..4986384,4991473..4991683,4993143..4993342,
FT                   5015088..5015237,5065325..5065563,5103514..5103754,
FT                   5233559..5233615,5235138..5235398,5323680..5323959,
FT                   5419839..5419870,5555033..5555085,5572622..5573461))
FT                   /gene="Odz1"
FT                   /locus_tag="mCG_141398"
FT                   /product="odd Oz/ten-m homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG141398.1 transcript_id=mCT175113.1
FT                   created on 29-JAN-2003"
FT   CDS             complement(join(4710058..4710816,4712577..4712719,
FT                   4713241..4714461,4715290..4715677,4721562..4721858,
FT                   4733241..4733476,4734510..4734682,4753381..4753891,
FT                   4755296..4755662,4785444..4785598,4819427..4819659,
FT                   4825245..4825265,4834314..4834563,4840992..4841135,
FT                   4860690..4860957,4865602..4865863,4871541..4871660,
FT                   4890871..4891087,4901249..4901395,4903239..4903262,
FT                   4905455..4905640,4979463..4979663,4982881..4983075,
FT                   4986283..4986384,4991473..4991683,4993143..4993342,
FT                   5015088..5015237,5065325..5065563,5103514..5103754,
FT                   5233559..5233615,5235138..5235398,5323680..5323896))
FT                   /codon_start=1
FT                   /gene="Odz1"
FT                   /locus_tag="mCG_141398"
FT                   /product="odd Oz/ten-m homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG141398.1 transcript_id=mCT175113.1
FT                   protein_id=mCP98032.0"
FT                   /db_xref="GOA:A2ANM0"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR009471"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR027688"
FT                   /db_xref="InterPro:IPR028916"
FT                   /db_xref="MGI:MGI:1345185"
FT                   /db_xref="UniProtKB/TrEMBL:A2ANM0"
FT                   /protein_id="EDL29046.1"
FT                   /translation="MEQTDCKPYQPLSKVKHEMDLAYTSSSDESEDGRKPRQSFNSRET
FT                   LHEYNQELRRNYNSQSRKRKDVEKSTQEIEFCETPPTLCSGYHTDMHSVSRHGYQLEMG
FT                   SDVDTETEGAASPDHALRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKF
FT                   SPVCCDMEAPADSAQDMQSSPHNQFTFRPLPPPPPPPHACTCARKPPPTVDSLQRRSMT
FT                   TRSQPSPAAPAPPTSTQDSVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYP
FT                   LTSNTVYSPPPRPLPRSTFSRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAV
FT                   HLFGLTWQLQPVGQIYANGISNGNPGTESMDTTYSPIGGRVSDKSEKKVFQKGRAIDTG
FT                   EVDIGAQVMQTIPPGLFWRFQITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDF
FT                   VKLMDGKQLVKQDSKSSDDIQHSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQ
FT                   VFVLTTAIEIMDDCSTNCNGNGECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGH
FT                   CVCRNGWKGPECDVPEEQCIDPTCFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSSH
FT                   GICVKGECHCSTGWGGVNCETPLPICQEQCSGHGTFLLDTGVCSCDPKWTGSDCSTELC
FT                   TMECGSHGVCSRGICQCEEGWVGPTCEERSCHSHCAEHGQCKDGKCECSPGWEGDHCTI
FT                   AHYLDAVRDGCPGLCFGNGRCTLDQNGWHCVCQVGWSGTGCNIVMEMLCGDNLDNDGDG
FT                   LTDCVDPDCCQQSNCYVSPLCQGSPDPLDLIQQSQPLFSQHTSRLFYDRIKFLIGKDST
FT                   HVVPQDISFDSRRACVIRGQVVAVDGTPLVGVNVSFLHHSDYGFTISRQDGSFDLVAIG
FT                   GISVVLIFDRSPFLSEKRTLWLPWNQFIVVEKVIMQRIVADAPSCDISNFISPNPIVLP
FT                   SPLTSFGGSCPERGTIVPELQVVQEEIPIPSSFVRLSYLSSRTPGYKTLLRILLTHSTI
FT                   PVGMIKVHLTVSVEGRLTQKWFPAAINLVYTFAWNKTDIYGQKVWGLAEALVSVGYEYE
FT                   MCPEFILWEQRTVVLQGFEMDASNLGGWSLNKHHIFNPQSGIIHKGNGENMFISQQPPV
FT                   IATIMGNGHQRSVACTNCNGPAHNNKLFAPVALASGPDGSVYVGDFNFVRRIFPSGNSV
FT                   SILELRNRDTRHSTSPAHKYYLAMDPMSESLYLSDTNTRKVYKLKSLVETKDLSKNFEV
FT                   VAGTGDQCLPFDQSHCGDGGKASEASLNSPRGITVDRHGFIYFVDGTMIRRIDENAVIT
FT                   TVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSLYVLDNNIVLQISENRRV
FT                   RIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISVSHSGLLFIAETDERKVNRIQQV
FT                   TTNGEISIIAGAPTDCDCKIDPNCDCFSGDGGYAKDAKMKAPSSLAVSPDGTLYVADLG
FT                   NVRIRTISKNQAHLNDMNLYEIASPADQELYQFTVNGTHLHTMNLITRDYVYNFTYNAE
FT                   GDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKRVSAQGYNLALMT
FT                   YPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGEVSSFHSDLEKLTKVALDTSNR
FT                   ENVLMSTNLTATSTIYILKQENTQSTYRVSPDGSLRVTFASGMEINLSSEPHILAGAVN
FT                   PTLGKCNISLPGEHNANLIEWRQRKEQNKGNVSAFERRLRAHNRNLLSIDFDHMTRTGK
FT                   IYDDHRKFTLRILYDQTGRPILWSPVSRYNEVNITYSPSGLVTFIQRGTWNEKMEYDQS
FT                   GKIISRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQSDCLLSVTMPSMVRHSLQTM
FT                   LSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTLHLGTGRRVLYKYTKQARLSEILYDTT
FT                   QVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEGLVNARFDYSYNN
FT                   FRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHTKIFNA
FT                   NGQVIEVQYEILKAIAYWMTIQYDNMGRMVICDIRVGVDANITRYFYEYDADGQLQTVS
FT                   VNDKIQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQYKMDEDGFLRQRG
FT                   NDIFEYNSNGLLQKAYNKVSGWTVQYYYDGLGRRVASKSSLGQHLQFFYADLANPIRVT
FT                   HLYNHTSAEITSLYYDLQGHLIAMELSSGEEYYVACDNMGTPLAVFSSRGQVIKEILYT
FT                   PYGDIYHDTYPDFEVIIGFHGGLYDFLTKLVHLGQRDYDVVAGRWTTPNHHIWKQLNLL
FT                   PKPFNLYSFENNYPVGKIQDVAKYTTDIGTWLELFGFQLHNVLPGFPKPELENMELTYE
FT                   LLQLQTKTQEWDPGKMILGIQCELQKQLRNFISLDQLPMTPQYNEGRCLEGGKQPRFAA
FT                   VPSVFGKGIKFAIKEGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIEGRDTHYFI
FT                   KLGSLEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNIRY
FT                   GTTVEEEKNHVLEMARQRAVAQAWTQEQRRLQEGEEGTRVWTEGEKQQLLGTGRVQGYD
FT                   GYFVLSVEQYLELSDSANNIHFMRQSEIGRR"
FT   gap             4745085..4747953
FT                   /estimated_length=2869
FT   gap             4811357..4816825
FT                   /estimated_length=5469
FT   gap             4863488..4863511
FT                   /estimated_length=24
FT   gap             4886143..4886162
FT                   /estimated_length=20
FT   gap             4937249..4937268
FT                   /estimated_length=20
FT   gap             5001799..5001818
FT                   /estimated_length=20
FT   gap             5031915..5031934
FT                   /estimated_length=20
FT   gap             5037845..5037864
FT                   /estimated_length=20
FT   gap             5047052..5047129
FT                   /estimated_length=78
FT   gap             5053918..5054056
FT                   /estimated_length=139
FT   gap             5069582..5070612
FT                   /estimated_length=1031
FT   gap             5086201..5086220
FT                   /estimated_length=20
FT   gap             5088126..5091729
FT                   /estimated_length=3604
FT   gap             5186953..5186972
FT                   /estimated_length=20
FT   gap             5221452..5221471
FT                   /estimated_length=20
FT   gap             5240604..5240623
FT                   /estimated_length=20
FT   gap             5248405..5248424
FT                   /estimated_length=20
FT   gap             5300969..5300988
FT                   /estimated_length=20
FT   gap             5332657..5332676
FT                   /estimated_length=20
FT   gap             5365432..5365451
FT                   /estimated_length=20
FT   gap             5376352..5376371
FT                   /estimated_length=20
FT   gap             5458974..5460441
FT                   /estimated_length=1468
FT   gap             5469432..5469451
FT                   /estimated_length=20
FT   gap             5470716..5470735
FT                   /estimated_length=20
FT   gap             5474955..5474974
FT                   /estimated_length=20
FT   gap             5481073..5481092
FT                   /estimated_length=20
FT   gap             5482649..5483404
FT                   /estimated_length=756
FT   gap             5502236..5502347
FT                   /estimated_length=112
FT   gap             5507936..5507955
FT                   /estimated_length=20
FT   gap             5551241..5551334
FT                   /estimated_length=94
FT   gap             5598843..5598862
FT                   /estimated_length=20
FT   gap             5618454..5619413
FT                   /estimated_length=960
FT   gap             5621427..5621446
FT                   /estimated_length=20
FT   gap             5628115..5629289
FT                   /estimated_length=1175
FT   gap             5630457..5630817
FT                   /estimated_length=361
FT   gap             5643137..5643192
FT                   /estimated_length=56
FT   gap             5655623..5655642
FT                   /estimated_length=20
FT   gap             5659460..5659479
FT                   /estimated_length=20
FT   gap             5660242..5661247
FT                   /estimated_length=1006
FT   gap             5662327..5662492
FT                   /estimated_length=166
FT   gap             5666951..5666970
FT                   /estimated_length=20
FT   gap             5696743..5696832
FT                   /estimated_length=90
FT   gap             5701861..5701880
FT                   /estimated_length=20
FT   gap             5704556..5704836
FT                   /estimated_length=281
FT   gap             5710706..5710825
FT                   /estimated_length=120
FT   gap             5735850..5735869
FT                   /estimated_length=20
FT   gap             5737264..5737394
FT                   /estimated_length=131
FT   gap             5738265..5738284
FT                   /estimated_length=20
FT   gap             5740666..5741217
FT                   /estimated_length=552
FT   gap             5767165..5767677
FT                   /estimated_length=513
FT   gap             5770019..5774529
FT                   /estimated_length=4511
FT   gap             5777126..5777365
FT                   /estimated_length=240
FT   gap             5798384..5800631
FT                   /estimated_length=2248
FT   gap             5803308..5804474
FT                   /estimated_length=1167
FT   gap             5816573..5822297
FT                   /estimated_length=5725
FT   gap             5825567..5825586
FT                   /estimated_length=20
FT   gap             5834718..5834737
FT                   /estimated_length=20
FT   gap             5840917..5841452
FT                   /estimated_length=536
FT   gap             5853863..5853882
FT                   /estimated_length=20
FT   gap             5857896..5857915
FT                   /estimated_length=20
FT   gap             5859841..5860539
FT                   /estimated_length=699
FT   gap             5874843..5875370
FT                   /estimated_length=528
FT   gap             5888584..5888622
FT                   /estimated_length=39
FT   gap             5890637..5890656
FT                   /estimated_length=20
FT   gap             5902824..5902998
FT                   /estimated_length=175
FT   gap             5910476..5913142
FT                   /estimated_length=2667
FT   gap             5917262..5917281
FT                   /estimated_length=20
FT   gap             5923908..5924054
FT                   /estimated_length=147
FT   gap             5927230..5927353
FT                   /estimated_length=124
FT   gap             5928774..5928793
FT                   /estimated_length=20
FT   gap             5933236..5933395
FT                   /estimated_length=160
FT   gap             5949631..5949650
FT                   /estimated_length=20
FT   gap             5986368..5986586
FT                   /estimated_length=219
FT   gap             5997850..5997895
FT                   /estimated_length=46
FT   gap             6004129..6004192
FT                   /estimated_length=64
FT   gap             6006552..6006571
FT                   /estimated_length=20
FT   gap             6008189..6008208
FT                   /estimated_length=20
FT   gap             6045173..6045192
FT                   /estimated_length=20
FT   gap             6047714..6048198
FT                   /estimated_length=485
FT   gap             6049445..6049491
FT                   /estimated_length=47
FT   gap             6091796..6092547
FT                   /estimated_length=752
FT   gap             6099402..6099548
FT                   /estimated_length=147
FT   gap             6101581..6102075
FT                   /estimated_length=495
FT   gap             6112231..6112250
FT                   /estimated_length=20
FT   gap             6132220..6132377
FT                   /estimated_length=158
FT   gap             6149807..6153187
FT                   /estimated_length=3381
FT   gap             6154786..6156905
FT                   /estimated_length=2120
FT   gap             6158329..6160343
FT                   /estimated_length=2015
FT   gap             6163355..6163838
FT                   /estimated_length=484
FT   gap             6165018..6165902
FT                   /estimated_length=885
FT   gap             6173073..6173265
FT                   /estimated_length=193
FT   gap             6176966..6177152
FT                   /estimated_length=187
FT   gap             6185507..6190106
FT                   /estimated_length=4600
FT   gap             6191402..6192432
FT                   /estimated_length=1031
FT   gap             6199377..6199449
FT                   /estimated_length=73
FT   gap             6214713..6214732
FT                   /estimated_length=20
FT   gap             6231084..6231103
FT                   /estimated_length=20
FT   gap             6239703..6239729
FT                   /estimated_length=27
FT   gap             6240685..6241180
FT                   /estimated_length=496
FT   gap             6242516..6242610
FT                   /estimated_length=95
FT   gap             6245526..6245966
FT                   /estimated_length=441
FT   gap             6248598..6248617
FT                   /estimated_length=20
FT   gap             6254495..6255252
FT                   /estimated_length=758
FT   gap             6256295..6257066
FT                   /estimated_length=772
FT   gap             6259407..6259426
FT                   /estimated_length=20
FT   gap             6261247..6261266
FT                   /estimated_length=20
FT   gap             6264478..6264497
FT                   /estimated_length=20
FT   gap             6268691..6268842
FT                   /estimated_length=152
FT   gap             6282379..6282464
FT                   /estimated_length=86
FT   gap             6284096..6284115
FT                   /estimated_length=20
FT   gap             6291630..6292756
FT                   /estimated_length=1127
FT   gap             6308243..6308271
FT                   /estimated_length=29
FT   gap             6312104..6312169
FT                   /estimated_length=66
FT   gap             6316990..6317009
FT                   /estimated_length=20
FT   gap             6335588..6341791
FT                   /estimated_length=6204
FT   gap             6342533..6342816
FT                   /estimated_length=284
FT   gap             6345381..6345400
FT                   /estimated_length=20
FT   gap             6356834..6356853
FT                   /estimated_length=20
FT   gap             6374319..6378987
FT                   /estimated_length=4669
FT   gap             6385997..6388596
FT                   /estimated_length=2600
FT   gap             6401302..6401677
FT                   /estimated_length=376
FT   gap             6402682..6404209
FT                   /estimated_length=1528
FT   gap             6405794..6406847
FT                   /estimated_length=1054
FT   gap             6412943..6413131
FT                   /estimated_length=189
FT   gap             6416768..6417767
FT                   /estimated_length=1000
FT   gap             6424669..6427244
FT                   /estimated_length=2576
FT   gap             6429117..6429136
FT                   /estimated_length=20
FT   gap             6434009..6434028
FT                   /estimated_length=20
FT   gap             6436588..6436946
FT                   /estimated_length=359
FT   gap             6437784..6437882
FT                   /estimated_length=99
FT   gap             6458925..6458944
FT                   /estimated_length=20
FT   gap             6483326..6483345
FT                   /estimated_length=20
FT   gene            complement(6503891..6506898)
FT                   /locus_tag="mCG_1050349"
FT                   /note="gene_id=mCG1050349.0"
FT   mRNA            complement(6503891..6506898)
FT                   /locus_tag="mCG_1050349"
FT                   /product="mCG1050349"
FT                   /note="gene_id=mCG1050349.0 transcript_id=mCT194355.0
FT                   created on 26-APR-2004"
FT   CDS             complement(6505155..6506564)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050349"
FT                   /product="mCG1050349"
FT                   /note="gene_id=mCG1050349.0 transcript_id=mCT194355.0
FT                   protein_id=mCP115384.0"
FT                   /protein_id="EDL29047.1"
FT                   /translation="MAPQQTGSRKRKASEVEQGAGTSSLPGRAAAAAGTGQADGPLLLA
FT                   KRPRRPVARRSLVHYLKGRALGADGHPGVAGFEGDLRSYGVLRLPELLRERQLTLGPLN
FT                   KVFASQWLNARQVVCGTKCNTLFVVDVQTGRITRIPLMRDRGPGQTRAQPTCGIHAIQL
FT                   NPSKTLLATGGENPNSLAVYQLPTLDPVCLGDRQGHRDWIFAIAWMSDTVAVSGSRDGT
FT                   VALWRVDSDMFNGSIPWHNNSGIPRYSHIRPRDMEAIPRATTNPGNRKVRALAFSGRNQ
FT                   ELGAVSLDGYFHLWKARSSLSRLLSLRLPYCRENVCLTYCDELSLYAVGSQSHVSFLDP
FT                   RQRQQNIKPLCSREGGTGVRSLSFYQHIITVGTGHGSLLFYDIRAQKFLEERASASPDS
FT                   FLGRTGRKLKLTCGRGWLNQDELWVNYFGGTEEFPNALYTHCYNWPEMKLFVGGGPLPS
FT                   GLHGNYAGLWS"
FT   gap             6521741..6521891
FT                   /estimated_length=151
FT   gap             6526690..6531700
FT                   /estimated_length=5011
FT   gap             6544519..6545169
FT                   /estimated_length=651
FT   gap             6547841..6547860
FT                   /estimated_length=20
FT   gap             6560942..6561617
FT                   /estimated_length=676
FT   gap             6564964..6565100
FT                   /estimated_length=137
FT   gap             6572183..6572278
FT                   /estimated_length=96
FT   gap             6575201..6577165
FT                   /estimated_length=1965
FT   gap             6599171..6599755
FT                   /estimated_length=585
FT   gap             6610668..6611614
FT                   /estimated_length=947
FT   gap             6614119..6614138
FT                   /estimated_length=20
FT   gap             6615222..6620548
FT                   /estimated_length=5327
FT   gap             6625866..6625991
FT                   /estimated_length=126
FT   gap             6634490..6638592
FT                   /estimated_length=4103
FT   gap             6644118..6644137
FT                   /estimated_length=20
FT   gap             6645483..6645502
FT                   /estimated_length=20
FT   gap             6647470..6647489
FT                   /estimated_length=20
FT   gap             6649040..6649148
FT                   /estimated_length=109
FT   gap             6654616..6654635
FT                   /estimated_length=20
FT   gap             6659262..6664646
FT                   /estimated_length=5385
FT   gap             6668318..6668337
FT                   /estimated_length=20
FT   gap             6675811..6675830
FT                   /estimated_length=20
FT   gap             6687397..6687416
FT                   /estimated_length=20
FT   gap             6705356..6706939
FT                   /estimated_length=1584
FT   gap             6711938..6712454
FT                   /estimated_length=517
FT   gap             6713886..6713905
FT                   /estimated_length=20
FT   gap             6716278..6716297
FT                   /estimated_length=20
FT   gap             6723552..6723583
FT                   /estimated_length=32
FT   gap             6724884..6724903
FT                   /estimated_length=20
FT   gap             6731578..6731621
FT                   /estimated_length=44
FT   gap             6733985..6734004
FT                   /estimated_length=20
FT   gap             6735594..6738384
FT                   /estimated_length=2791
FT   gap             6746083..6746102
FT                   /estimated_length=20
FT   gap             6753774..6754227
FT                   /estimated_length=454
FT   gap             6759644..6759710
FT                   /estimated_length=67
FT   gap             6774423..6775659
FT                   /estimated_length=1237
FT   gap             6779800..6779819
FT                   /estimated_length=20
FT   gap             6780901..6781546
FT                   /estimated_length=646
FT   gap             6782854..6782990
FT                   /estimated_length=137
FT   gap             6786459..6786606
FT                   /estimated_length=148
FT   gap             6797299..6807317
FT                   /estimated_length=10019
FT   gap             6830937..6830962
FT                   /estimated_length=26
FT   gap             6849945..6849964
FT                   /estimated_length=20
FT   gap             6856218..6856237
FT                   /estimated_length=20
FT   gap             6873051..6873070
FT                   /estimated_length=20
FT   gap             6874439..6881024
FT                   /estimated_length=6586
FT   gap             6912522..6912751
FT                   /estimated_length=230
FT   gap             6923843..6924628
FT                   /estimated_length=786
FT   gap             6934859..6935260
FT                   /estimated_length=402
FT   gap             6939121..6939459
FT                   /estimated_length=339
FT   gap             6943970..6944336
FT                   /estimated_length=367
FT   gap             6957299..6957318
FT                   /estimated_length=20
FT   gap             6965975..6966178
FT                   /estimated_length=204
FT   gap             6972672..6973852
FT                   /estimated_length=1181
FT   gap             6985501..6985527
FT                   /estimated_length=27
FT   gap             7008326..7008477
FT                   /estimated_length=152
FT   gap             7010867..7011259
FT                   /estimated_length=393
FT   gap             7013338..7014247
FT                   /estimated_length=910
FT   gap             7024819..7024838
FT                   /estimated_length=20
FT   gap             7061261..7061509
FT                   /estimated_length=249
FT   gap             7065712..7066246
FT                   /estimated_length=535
FT   gap             7071509..7071528
FT                   /estimated_length=20
FT   gap             7072554..7072671
FT                   /estimated_length=118
FT   gap             7080092..7080166
FT                   /estimated_length=75
FT   gap             7088716..7088735
FT                   /estimated_length=20
FT   gap             7099791..7099810
FT                   /estimated_length=20
FT   gap             7103744..7103763
FT                   /estimated_length=20
FT   gap             7135676..7136105
FT                   /estimated_length=430
FT   gap             7139963..7139982
FT                   /estimated_length=20
FT   gap             7152907..7159878
FT                   /estimated_length=6972
FT   gap             7162932..7162966
FT                   /estimated_length=35
FT   gap             7176806..7177066
FT                   /estimated_length=261
FT   gap             7191720..7192275
FT                   /estimated_length=556
FT   gap             7201273..7201292
FT                   /estimated_length=20
FT   gap             7202538..7202557
FT                   /estimated_length=20
FT   gap             7204002..7204021
FT                   /estimated_length=20
FT   gap             7222479..7222498
FT                   /estimated_length=20
FT   gap             7223560..7223642
FT                   /estimated_length=83
FT   gene            7232170..7234013
FT                   /locus_tag="mCG_55068"
FT                   /note="gene_id=mCG55068.2"
FT   mRNA            join(7232170..7232256,7233035..7234013)
FT                   /locus_tag="mCG_55068"
FT                   /product="mCG55068"
FT                   /note="gene_id=mCG55068.2 transcript_id=mCT55251.2 created
FT                   on 05-FEB-2003"
FT   CDS             join(7232237..7232256,7233035..7233869)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55068"
FT                   /product="mCG55068"
FT                   /note="gene_id=mCG55068.2 transcript_id=mCT55251.2
FT                   protein_id=mCP34974.2"
FT                   /protein_id="EDL29048.1"
FT                   /translation="MACTENGLAGHSHSPIIVPVDKNRSKETCHNVQLRSLSSMLKDDE
FT                   DDADVWTRPPVSLRPPFNVPRTGARIPQNPRAPRHPLTLTPAIEEESLATAEINSSEGL
FT                   ESQSQKGHDSINMSQEFSGSPMALMIGGPRVGSRVLERSGNNSKPYIPVPRSQGFFPPR
FT                   GSQSRGPPYIPTLRSGIMMEVTPGNARMANRGNMAHVSFPLGSPRHPMDNWQQSPSLPL
FT                   SPSITGLPCSSAHCFLPPQAPAFNPFPVMPTAFASPLRFGPPLLPYVFHYNTGAMYPPP
FT                   YLN"
FT   gap             7244763..7244965
FT                   /estimated_length=203
FT   gap             7246671..7247789
FT                   /estimated_length=1119
FT   gap             7259828..7260234
FT                   /estimated_length=407
FT   gap             7263136..7263155
FT                   /estimated_length=20
FT   gap             7264560..7264579
FT                   /estimated_length=20
FT   gap             7271683..7271995
FT                   /estimated_length=313
FT   gap             7272654..7272673
FT                   /estimated_length=20
FT   gap             7286677..7286696
FT                   /estimated_length=20
FT   gap             7307685..7308699
FT                   /estimated_length=1015
FT   gap             7319782..7319801
FT                   /estimated_length=20
FT   gap             7322297..7322416
FT                   /estimated_length=120
FT   gap             7343604..7343623
FT                   /estimated_length=20
FT   gap             7345737..7345813
FT                   /estimated_length=77
FT   gap             7346861..7347143
FT                   /estimated_length=283
FT   gap             7350816..7350993
FT                   /estimated_length=178
FT   gap             7353074..7353621
FT                   /estimated_length=548
FT   gap             7356564..7357417
FT                   /estimated_length=854
FT   gap             7360153..7360331
FT                   /estimated_length=179
FT   gap             7366819..7383706
FT                   /estimated_length=16888
FT   gap             7392246..7399363
FT                   /estimated_length=7118
FT   gap             7401452..7401471
FT                   /estimated_length=20
FT   gap             7414513..7414532
FT                   /estimated_length=20
FT   gap             7447863..7447882
FT                   /estimated_length=20
FT   gap             7450686..7450855
FT                   /estimated_length=170
FT   gap             7455100..7455153
FT                   /estimated_length=54
FT   gap             7464455..7464484
FT                   /estimated_length=30
FT   gap             7484175..7484194
FT                   /estimated_length=20
FT   gap             7500831..7500858
FT                   /estimated_length=28
FT   gap             7511910..7518548
FT                   /estimated_length=6639
FT   gap             7521024..7521145
FT                   /estimated_length=122
FT   gap             7522131..7522343
FT                   /estimated_length=213
FT   gap             7547003..7547111
FT                   /estimated_length=109
FT   gap             7566408..7566427
FT                   /estimated_length=20
FT   gap             7589550..7589710
FT                   /estimated_length=161
FT   gap             7606172..7606788
FT                   /estimated_length=617
FT   gap             7609770..7609789
FT                   /estimated_length=20
FT   gap             7623239..7623379
FT                   /estimated_length=141
FT   gap             7625158..7625177
FT                   /estimated_length=20
FT   gap             7639038..7639079
FT                   /estimated_length=42
FT   gap             7642459..7643239
FT                   /estimated_length=781
FT   gap             7646631..7647353
FT                   /estimated_length=723
FT   gap             7648646..7648665
FT                   /estimated_length=20
FT   gap             7656565..7656739
FT                   /estimated_length=175
FT   gap             7662361..7662380
FT                   /estimated_length=20
FT   gap             7667225..7667266
FT                   /estimated_length=42
FT   gap             7669480..7670243
FT                   /estimated_length=764
FT   gap             7672571..7673818
FT                   /estimated_length=1248
FT   gap             7697189..7697208
FT                   /estimated_length=20
FT   gap             7703357..7703549
FT                   /estimated_length=193
FT   gap             7737401..7737420
FT                   /estimated_length=20
FT   gap             7739858..7739951
FT                   /estimated_length=94
FT   gap             7759403..7764093
FT                   /estimated_length=4691
FT   gap             7772760..7772825
FT                   /estimated_length=66
FT   gap             7774174..7774524
FT                   /estimated_length=351
FT   gap             7776663..7783006
FT                   /estimated_length=6344
FT   gap             7789530..7789549
FT                   /estimated_length=20
FT   gap             7791595..7791614
FT                   /estimated_length=20
FT   gap             7794233..7794252
FT                   /estimated_length=20
FT   gap             7796555..7796985
FT                   /estimated_length=431
FT   gap             7798510..7801557
FT                   /estimated_length=3048
FT   gap             7803971..7804466
FT                   /estimated_length=496
FT   gap             7825499..7825518
FT                   /estimated_length=20
FT   gap             7830077..7830185
FT                   /estimated_length=109
FT   gap             7832153..7832363
FT                   /estimated_length=211
FT   gap             7837855..7837874
FT                   /estimated_length=20
FT   gap             7839448..7839520
FT                   /estimated_length=73
FT   gap             7849687..7849706
FT                   /estimated_length=20
FT   gap             7851649..7851791
FT                   /estimated_length=143
FT   gap             7852338..7852357
FT                   /estimated_length=20
FT   gap             7892133..7892308
FT                   /estimated_length=176
FT   gap             7899718..7899737
FT                   /estimated_length=20
FT   gap             7915806..7915825
FT                   /estimated_length=20
FT   gap             7922821..7922840
FT                   /estimated_length=20
FT   gap             7935219..7935238
FT                   /estimated_length=20
FT   gap             7951460..7951479
FT                   /estimated_length=20
FT   gap             7958895..7959619
FT                   /estimated_length=725
FT   gap             7967603..7967622
FT                   /estimated_length=20
FT   gap             7968521..7969395
FT                   /estimated_length=875
FT   gap             7976607..7976814
FT                   /estimated_length=208
FT   gap             8000821..8000840
FT                   /estimated_length=20
FT   gap             8013151..8013357
FT                   /estimated_length=207
FT   gap             8014579..8014598
FT                   /estimated_length=20
FT   gap             8017933..8017952
FT                   /estimated_length=20
FT   gap             8024818..8024837
FT                   /estimated_length=20
FT   gap             8041940..8041959
FT                   /estimated_length=20
FT   gap             8049690..8049709
FT                   /estimated_length=20
FT   gap             8053744..8053901
FT                   /estimated_length=158
FT   gap             8057295..8058582
FT                   /estimated_length=1288
FT   gap             8067424..8067611
FT                   /estimated_length=188
FT   gap             8070974..8070993
FT                   /estimated_length=20
FT   gap             8090804..8091014
FT                   /estimated_length=211
FT   gap             8092324..8092343
FT                   /estimated_length=20
FT   gap             8094641..8094660
FT                   /estimated_length=20
FT   gap             8098201..8098220
FT                   /estimated_length=20
FT   gap             8099267..8099286
FT                   /estimated_length=20
FT   gap             8100793..8103603
FT                   /estimated_length=2811
FT   gap             8107798..8107885
FT                   /estimated_length=88
FT   gap             8137254..8138274
FT                   /estimated_length=1021
FT   gap             8146760..8146779
FT                   /estimated_length=20
FT   gap             8148311..8150208
FT                   /estimated_length=1898
FT   gap             8152085..8152129
FT                   /estimated_length=45
FT   gap             8165842..8166061
FT                   /estimated_length=220
FT   gap             8175599..8175618
FT                   /estimated_length=20
FT   gap             8189464..8189483
FT                   /estimated_length=20
FT   gap             8192148..8192223
FT                   /estimated_length=76
FT   gap             8212549..8212568
FT                   /estimated_length=20
FT   gap             8223399..8223418
FT                   /estimated_length=20
FT   gap             8241236..8241571
FT                   /estimated_length=336
FT   gap             8242919..8242938
FT                   /estimated_length=20
FT   gap             8256817..8256836
FT                   /estimated_length=20
FT   gap             8267755..8267774
FT                   /estimated_length=20
FT   gap             8270971..8271303
FT                   /estimated_length=333
FT   gap             8278831..8278850
FT                   /estimated_length=20
FT   gap             8301889..8301947
FT                   /estimated_length=59
FT   gap             8309468..8309650
FT                   /estimated_length=183
FT   gap             8328234..8328341
FT                   /estimated_length=108
FT   gap             8339148..8339176
FT                   /estimated_length=29
FT   gap             8343867..8343958
FT                   /estimated_length=92
FT   gap             8347906..8347925
FT                   /estimated_length=20
FT   gap             8349957..8350738
FT                   /estimated_length=782
FT   gap             8351864..8359996
FT                   /estimated_length=8133
FT   gap             8383207..8383226
FT                   /estimated_length=20
FT   gene            complement(8397846..>8458838)
FT                   /locus_tag="mCG_145461"
FT                   /note="gene_id=mCG145461.0"
FT   mRNA            complement(join(8397846..8398397,8457571..8457686,
FT                   8458737..>8458838))
FT                   /locus_tag="mCG_145461"
FT                   /product="mCG145461"
FT                   /note="gene_id=mCG145461.0 transcript_id=mCT184885.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(8398370..8398397,8457571..8457686,
FT                   8458737..>8458799))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145461"
FT                   /product="mCG145461"
FT                   /note="gene_id=mCG145461.0 transcript_id=mCT184885.0
FT                   protein_id=mCP105979.0"
FT                   /protein_id="EDL29049.1"
FT                   /translation="ANTIHLEKDEKLHTSHLTSQLLLPTFLFLQNHPPPFLLQKTSGLS
FT                   EMTARLVKTIYSKTRNLVDGCDP"
FT   gap             8403818..8408855
FT                   /estimated_length=5038
FT   gap             8419200..8419629
FT                   /estimated_length=430
FT   gap             8423608..8423840
FT                   /estimated_length=233
FT   gap             8440239..8443472
FT                   /estimated_length=3234
FT   gap             8445373..8445839
FT                   /estimated_length=467
FT   gap             8448948..8448967
FT                   /estimated_length=20
FT   gap             8458094..8458317
FT                   /estimated_length=224
FT   gene            8458932..8460273
FT                   /gene="Actrt1"
FT                   /locus_tag="mCG_10944"
FT                   /note="gene_id=mCG10944.1"
FT   mRNA            8458932..8460273
FT                   /gene="Actrt1"
FT                   /locus_tag="mCG_10944"
FT                   /product="actin-related protein T1"
FT                   /note="gene_id=mCG10944.1 transcript_id=mCT10805.1 created
FT                   on 16-DEC-2002"
FT   CDS             8459036..8460166
FT                   /codon_start=1
FT                   /gene="Actrt1"
FT                   /locus_tag="mCG_10944"
FT                   /product="actin-related protein T1"
FT                   /note="gene_id=mCG10944.1 transcript_id=mCT10805.1
FT                   protein_id=mCP18082.2"
FT                   /protein_id="EDL29050.1"
FT                   /translation="MLDPARLDNPAVIFDNGSGLCKVGISGEIEPRHVINSVVGHPKFN
FT                   IPSARSNRKRYFVGEEAQCMYDGLYLHYPIERGLVTRWDDMEKLWKDLFEWELGVKPNE
FT                   QPVFMTEPSLNPQETREKTTEIMFEKFNVPALYLCNHAVGALCASACITGLVLDSGDGV
FT                   TCTVPVYEGYSLPHAITKLYVAGRDITEHLTRLLLAKGYTFPCILNKAVVDDIKEKLCT
FT                   VSLGYKDTEKNCQQFLRKYTLPDGNTIQMSDHLCQVPEVLFTPDHLGIHDLGISKMVCN
FT                   SIMNCDTDIQENLFAEIVLSGGTTMFPGLQDRLLKELEDLAFEGTPIKITASSDRCYSA
FT                   WIGGSVMTSMTTFKQMWVTAEDFKEYGAFVVQRKCF"
FT   gap             8463900..8464035
FT                   /estimated_length=136
FT   gap             8493131..8493150
FT                   /estimated_length=20
FT   gap             8499839..8499858
FT                   /estimated_length=20
FT   gap             8507347..8507366
FT                   /estimated_length=20
FT   gap             8514704..8514723
FT                   /estimated_length=20
FT   gap             8569281..8569300
FT                   /estimated_length=20
FT   gene            complement(<8586454..>8586861)
FT                   /locus_tag="mCG_49690"
FT                   /note="gene_id=mCG49690.0"
FT   mRNA            complement(<8586454..>8586861)
FT                   /locus_tag="mCG_49690"
FT                   /product="mCG49690"
FT                   /note="gene_id=mCG49690.0 transcript_id=mCT49873.0 created
FT                   on 20-FEB-2003"
FT   CDS             complement(8586454..8586861)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49690"
FT                   /product="mCG49690"
FT                   /note="gene_id=mCG49690.0 transcript_id=mCT49873.0
FT                   protein_id=mCP38685.0"
FT                   /db_xref="GOA:A2AD25"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="MGI:MGI:3647751"
FT                   /db_xref="UniProtKB/TrEMBL:A2AD25"
FT                   /protein_id="EDL29051.1"
FT                   /translation="MAALRPLVKPKIVKKRTKKFIRHQSDRYVKIKQNWWKPRGIYNRV
FT                   RRRFKGEILMPNISYRSNKKTKHMLPSSFCKFLVHDVKELEVLLMCNKSYCAEIAHNVS
FT                   SKNREAIVERAAQLAIRVSNPNARLRSEENE"
FT   gap             8587972..8592110
FT                   /estimated_length=4139
FT   gap             8595563..8595582
FT                   /estimated_length=20
FT   gap             8615721..8615740
FT                   /estimated_length=20
FT   gap             8623398..8623417
FT                   /estimated_length=20
FT   gap             8628425..8628469
FT                   /estimated_length=45
FT   gap             8633096..8633115
FT                   /estimated_length=20
FT   gap             8653954..8655504
FT                   /estimated_length=1551
FT   gap             8658126..8660696
FT                   /estimated_length=2571
FT   gap             8662611..8662630
FT                   /estimated_length=20
FT   gap             8665854..8665873
FT                   /estimated_length=20
FT   gene            complement(8666943..>8667584)
FT                   /locus_tag="mCG_50437"
FT                   /note="gene_id=mCG50437.2"
FT   mRNA            complement(8666943..>8667584)
FT                   /locus_tag="mCG_50437"
FT                   /product="mCG50437"
FT                   /note="gene_id=mCG50437.2 transcript_id=mCT50620.2 created
FT                   on 06-JAN-2003"
FT   CDS             complement(8666952..>8667299)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50437"
FT                   /product="mCG50437"
FT                   /note="gene_id=mCG50437.2 transcript_id=mCT50620.2
FT                   protein_id=mCP43008.2"
FT                   /protein_id="EDL29052.1"
FT                   /translation="DYSVGLVWWMLAREVLCMRGTISRGHPWEVIPDLYFYRDPEEIEK
FT                   VEQAAAEKAVTKEEFQGEWSAPASEFTAAQPEVADWSEGVQVPSVLIQQFPTEDWSAQP
FT                   ATEDWTAAPPV"
FT   gap             8673098..8673117
FT                   /estimated_length=20
FT   gap             8674293..8674312
FT                   /estimated_length=20
FT   gap             8687221..8687550
FT                   /estimated_length=330
FT   gap             8695751..8695770
FT                   /estimated_length=20
FT   gap             8697192..8697211
FT                   /estimated_length=20
FT   gap             8701895..8701990
FT                   /estimated_length=96
FT   gap             8703454..8703473
FT                   /estimated_length=20
FT   gap             8743405..8743524
FT                   /estimated_length=120
FT   gap             8750177..8750196
FT                   /estimated_length=20
FT   gap             8756119..8756301
FT                   /estimated_length=183
FT   gap             8757151..8759856
FT                   /estimated_length=2706
FT   gap             8761192..8761292
FT                   /estimated_length=101
FT   gap             8769838..8769857
FT                   /estimated_length=20
FT   gap             8773370..8773511
FT                   /estimated_length=142
FT   gap             8789960..8790033
FT                   /estimated_length=74
FT   gap             8794936..8794955
FT                   /estimated_length=20
FT   gap             8807341..8807360
FT                   /estimated_length=20
FT   gap             8807983..8808376
FT                   /estimated_length=394
FT   gap             8815411..8815430
FT                   /estimated_length=20
FT   gap             8819496..8819515
FT                   /estimated_length=20
FT   gap             8827150..8828247
FT                   /estimated_length=1098
FT   gap             8847583..8847783
FT                   /estimated_length=201
FT   gap             8873097..8873116
FT                   /estimated_length=20
FT   gap             8881537..8881556
FT                   /estimated_length=20
FT   gap             8887340..8887359
FT                   /estimated_length=20
FT   gap             8893473..8893535
FT                   /estimated_length=63
FT   gap             8899021..8899040
FT                   /estimated_length=20
FT   gap             8901468..8901487
FT                   /estimated_length=20
FT   gap             8911197..8913133
FT                   /estimated_length=1937
FT   gap             8913942..8914037
FT                   /estimated_length=96
FT   gap             8922478..8922497
FT                   /estimated_length=20
FT   gap             8924102..8924121
FT                   /estimated_length=20
FT   gap             8931366..8935456
FT                   /estimated_length=4091
FT   gap             8948625..8949033
FT                   /estimated_length=409
FT   gap             8950443..8952316
FT                   /estimated_length=1874
FT   gap             8960017..8960036
FT                   /estimated_length=20
FT   gap             8979966..8979985
FT                   /estimated_length=20
FT   gap             8981217..8981236
FT                   /estimated_length=20
FT   gap             9044920..9044939
FT                   /estimated_length=20
FT   gap             9049866..9049885
FT                   /estimated_length=20
FT   gap             9051589..9051608
FT                   /estimated_length=20
FT   gap             9053522..9054186
FT                   /estimated_length=665
FT   gap             9056105..9056498
FT                   /estimated_length=394
FT   gap             9068417..9069110
FT                   /estimated_length=694
FT   gap             9083628..9083647
FT                   /estimated_length=20
FT   gap             9099999..9100018
FT                   /estimated_length=20
FT   gap             9109043..9114048
FT                   /estimated_length=5006
FT   gap             9121006..9122039
FT                   /estimated_length=1034
FT   gap             9124982..9125873
FT                   /estimated_length=892
FT   gap             9126739..9126892
FT                   /estimated_length=154
FT   gap             9129564..9129583
FT                   /estimated_length=20
FT   gap             9147064..9147083
FT                   /estimated_length=20
FT   gap             9159427..9159473
FT                   /estimated_length=47
FT   gap             9164534..9164952
FT                   /estimated_length=419
FT   gap             9173024..9173043
FT                   /estimated_length=20
FT   gap             9183374..9183393
FT                   /estimated_length=20
FT   gap             9189291..9189310
FT                   /estimated_length=20
FT   gap             9203169..9203282
FT                   /estimated_length=114
FT   gap             9207291..9207310
FT                   /estimated_length=20
FT   gap             9212465..9212484
FT                   /estimated_length=20
FT   gap             9217918..9217937
FT                   /estimated_length=20
FT   gap             9223249..9223495
FT                   /estimated_length=247
FT   gap             9229287..9229306
FT                   /estimated_length=20
FT   gap             9245208..9247366
FT                   /estimated_length=2159
FT   gap             9248516..9249246
FT                   /estimated_length=731
FT   gap             9258153..9258172
FT                   /estimated_length=20
FT   gap             9261402..9268097
FT                   /estimated_length=6696
FT   gap             9271460..9271636
FT                   /estimated_length=177
FT   gap             9279360..9279502
FT                   /estimated_length=143
FT   gap             9283364..9283383
FT                   /estimated_length=20
FT   gap             9285685..9285704
FT                   /estimated_length=20
FT   gap             9293551..9293646
FT                   /estimated_length=96
FT   gap             9322032..9322220
FT                   /estimated_length=189
FT   gap             9324773..9325596
FT                   /estimated_length=824
FT   gap             9329664..9330478
FT                   /estimated_length=815
FT   gap             9339385..9339404
FT                   /estimated_length=20
FT   gap             9364999..9365018
FT                   /estimated_length=20
FT   gap             9400170..9400394
FT                   /estimated_length=225
FT   gap             9406073..9406105
FT                   /estimated_length=33
FT   gap             9407007..9407432
FT                   /estimated_length=426
FT   gap             9413181..9413595
FT                   /estimated_length=415
FT   gap             9423301..9423359
FT                   /estimated_length=59
FT   gap             9467040..9467161
FT                   /estimated_length=122
FT   gap             9473518..9473537
FT                   /estimated_length=20
FT   gap             9475832..9475857
FT                   /estimated_length=26
FT   gap             9478776..9478795
FT                   /estimated_length=20
FT   gap             9481230..9481651
FT                   /estimated_length=422
FT   gap             9484525..9490686
FT                   /estimated_length=6162
FT   gap             9505080..9505099
FT                   /estimated_length=20
FT   gap             9524492..9524668
FT                   /estimated_length=177
FT   gap             9539548..9539994
FT                   /estimated_length=447
FT   gap             9540833..9540852
FT                   /estimated_length=20
FT   gap             9542055..9542690
FT                   /estimated_length=636
FT   gap             9545518..9545537
FT                   /estimated_length=20
FT   gap             9547791..9548305
FT                   /estimated_length=515
FT   gap             9549108..9552308
FT                   /estimated_length=3201
FT   gap             9561080..9561498
FT                   /estimated_length=419
FT   gene            complement(9561737..9564443)
FT                   /locus_tag="mCG_147979"
FT                   /note="gene_id=mCG147979.0"
FT   mRNA            complement(9561737..9564443)
FT                   /locus_tag="mCG_147979"
FT                   /product="mCG147979"
FT                   /note="gene_id=mCG147979.0 transcript_id=mCT188242.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(9562578..9562799)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147979"
FT                   /product="mCG147979"
FT                   /note="gene_id=mCG147979.0 transcript_id=mCT188242.0
FT                   protein_id=mCP109517.0"
FT                   /protein_id="EDL29053.1"
FT                   /translation="MPVLTQSRRDRIVESGSLDSQPTILFIEVILLEMLSAFSATHLFS
FT                   LFWVTKSMVGWKVNVEAKLSWLVFFQSE"
FT   gap             9564444..9564463
FT                   /estimated_length=20
FT   gap             9573406..9573425
FT                   /estimated_length=20
FT   gap             9576465..9576484
FT                   /estimated_length=20
FT   gap             9616505..9616524
FT                   /estimated_length=20
FT   gap             9629916..9629935
FT                   /estimated_length=20
FT   gap             9631448..9631467
FT                   /estimated_length=20
FT   gap             9645738..9646236
FT                   /estimated_length=499
FT   gap             9650753..9650846
FT                   /estimated_length=94
FT   gap             9664236..9664255
FT                   /estimated_length=20
FT   gap             9670932..9670951
FT                   /estimated_length=20
FT   gap             9672623..9672777
FT                   /estimated_length=155
FT   gap             9674316..9675390
FT                   /estimated_length=1075
FT   gap             9677020..9677616
FT                   /estimated_length=597
FT   gap             9679891..9679910
FT                   /estimated_length=20
FT   gap             9683159..9683178
FT                   /estimated_length=20
FT   gap             9695533..9695552
FT                   /estimated_length=20
FT   gap             9702156..9702175
FT                   /estimated_length=20
FT   gap             9707006..9707101
FT                   /estimated_length=96
FT   gap             9712496..9712859
FT                   /estimated_length=364
FT   gap             9743031..9743109
FT                   /estimated_length=79
FT   gap             9748750..9749136
FT                   /estimated_length=387
FT   gap             9753508..9753527
FT                   /estimated_length=20
FT   gap             9768553..9768572
FT                   /estimated_length=20
FT   gap             9777482..9777501
FT                   /estimated_length=20
FT   gap             9782347..9782789
FT                   /estimated_length=443
FT   gap             9810020..9810039
FT                   /estimated_length=20
FT   gap             9812362..9812868
FT                   /estimated_length=507
FT   gene            9844283..9845717
FT                   /locus_tag="mCG_49158"
FT                   /note="gene_id=mCG49158.2"
FT   mRNA            join(9844283..9844551,9844821..9845035,9845302..9845717)
FT                   /locus_tag="mCG_49158"
FT                   /product="mCG49158"
FT                   /note="gene_id=mCG49158.2 transcript_id=mCT49341.2 created
FT                   on 11-MAR-2003"
FT   CDS             join(9844286..9844551,9844821..9845035,9845302..9845699)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49158"
FT                   /product="mCG49158"
FT                   /note="gene_id=mCG49158.2 transcript_id=mCT49341.2
FT                   protein_id=mCP28887.2"
FT                   /protein_id="EDL29054.1"
FT                   /translation="MEEVLAEELEEEEQLVRWHQKKKKELQAKIQGIKNAVPKNDKKRR
FT                   KQLKEDVAKLEREMEQKHREELEQLKLTFKDSKADSVVLTFQTWVLVSSHFFSTYRVAD
FT                   LFSSLDTFSSSSIGGPVIHPIADCEHSLLCLLGPSLVSQETAISGSFQQNLASVCNVLE
FT                   DQLREQDSALTVAALRRQAAEYMQSHSDDFMPFLTNLSTGDMYTPEEFGKYCDDIVNTV
FT                   AWGGQLELRAPSHILQTPTEILQADVPPTIVGEEYPRNPLVLVYMRHAYSLGEHYNSVT
FT                   QLVNSATENCN"
FT   gap             9849205..9849324
FT                   /estimated_length=120
FT   gap             9856735..9856754
FT                   /estimated_length=20
FT   gap             9857938..9858189
FT                   /estimated_length=252
FT   gap             9860314..9860626
FT                   /estimated_length=313
FT   gap             9880504..9882644
FT                   /estimated_length=2141
FT   gap             9887857..9887876
FT                   /estimated_length=20
FT   gap             9902964..9906739
FT                   /estimated_length=3776
FT   gene            complement(9921972..9998744)
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /note="gene_id=mCG114900.2"
FT   mRNA            complement(join(9921972..9922722,9923729..9923870,
FT                   9935967..9936179,9936292..9936410,9939095..9939227,
FT                   9941435..9941557,9954115..9954228,9954487..9954597,
FT                   9962386..9962505,9964120..9964268,9965070..9965202,
FT                   9967041..9967193,9970723..9970844,9972889..9973115,
FT                   9973747..9973856,9979365..9979433,9980374..9980505,
FT                   9981595..9981750,9984656..9984835,9988951..9989051,
FT                   9989180..9989280,9989641..9989807,9992701..9992802,
FT                   9997818..>9998111))
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a, member 1,
FT                   transcript variant mCT192576"
FT                   /note="gene_id=mCG114900.2 transcript_id=mCT192576.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(9922302..9922722,9923760..9923870,
FT                   9935967..9936179,9936292..9936410,9939095..9939227,
FT                   9941435..9941557,9954115..9954228,9954487..9954597,
FT                   9962386..9962505,9964120..9964268,9965070..9965202,
FT                   9967041..9967193,9970723..9970844,9972889..9973115,
FT                   9973747..9973856,9979365..9979433,9980374..9980505,
FT                   9981595..9981750,9984656..9984835,9988951..9989051,
FT                   9989180..9989280,9989641..9989807,9992701..9992802,
FT                   9997818..9998041,9998635..9998744))
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a, member 1,
FT                   transcript variant mCT115994"
FT                   /note="gene_id=mCG114900.2 transcript_id=mCT115994.1
FT                   created on 16-DEC-2002"
FT   mRNA            complement(join(9922302..9922722,9923760..9923870,
FT                   9935967..9936179,9936292..9936410,9939095..9939227,
FT                   9941435..9941557,9954115..9954228,9954487..9954597,
FT                   9962386..9962505,9964120..9964268,9965070..9965202,
FT                   9967041..9967193,9970723..9970844,9972889..9973115,
FT                   9973747..9973856,9979365..9979433,9980374..9980505,
FT                   9981595..9981750,9984656..9984835,9988951..9989051,
FT                   9989180..9989280,9989641..9989807,9992701..9992802,
FT                   9997818..>9998134))
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a, member 1,
FT                   transcript variant mCT192575"
FT                   /note="gene_id=mCG114900.2 transcript_id=mCT192575.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(9922651..9922722,9923760..9923870,
FT                   9935967..9936179,9936292..9936410,9939095..9939227,
FT                   9941435..9941557,9954115..9954228,9954487..9954597,
FT                   9962386..9962505,9964120..9964268,9965070..9965202,
FT                   9967041..9967193,9970723..9970844,9972889..9973115,
FT                   9973747..9973856,9979365..9979433,9980374..9980505,
FT                   9981595..9981750,9984656..9984835,9988951..9989051,
FT                   9989180..9989280,9989641..9989807,9992701..9992802,
FT                   9997818..9998041,9998635..9998704))
FT                   /codon_start=1
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a, member 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG114900.2 transcript_id=mCT115994.1
FT                   protein_id=mCP87590.1 isoform=CRA_a"
FT                   /protein_id="EDL29055.1"
FT                   /translation="MQRKTNSTHKQRSSLCKKGRAPQGTSLLPFLVPPRLSRSNAMEPD
FT                   TATEAATVAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITSPF
FT                   QLKLAAKASKSEKEMDPEYEEKMVNMPLKADRAKRFEFLLKQTELFAHFIQPSAQKSPT
FT                   SPLNMKLARPRVKKDDKQSLISVGDYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSY
FT                   VKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHM
FT                   VLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVTSYEMVIK
FT                   EKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALL
FT                   NFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEI
FT                   KIYLGLSKMQREWYTKILMKDIDVLNSSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPG
FT                   PPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYSR
FT                   LDGQTPHEEREEAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDL
FT                   QAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLA
FT                   KEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKKTAEMNERMQKMGESSLRNFRM
FT                   DLEQSLYKFEGEDYREKQKLGTVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPR
FT                   PPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPEIPNPAIAQREEQKKIDGA
FT                   EPLTPQETEEKDKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVME
FT                   YSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGT
FT                   SKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRR
FT                   CNTLISLIEKENMEIEERERAEKKKRATKTPMSQKRKAESATESSGRKDVKKVKS"
FT   CDS             complement(join(9922651..9922722,9923760..9923870,
FT                   9935967..9936179,9936292..9936410,9939095..9939227,
FT                   9941435..9941557,9954115..9954228,9954487..9954597,
FT                   9962386..9962505,9964120..9964268,9965070..9965202,
FT                   9967041..9967193,9970723..9970844,9972889..9973115,
FT                   9973747..9973856,9979365..9979433,9980374..9980505,
FT                   9981595..9981750,9984656..9984835,9988951..9989051,
FT                   9989180..9989280,9989641..9989807,9992701..9992802,
FT                   9997818..>9998132))
FT                   /codon_start=1
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a, member 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG114900.2 transcript_id=mCT192575.0
FT                   protein_id=mCP113528.0 isoform=CRA_b"
FT                   /protein_id="EDL29056.1"
FT                   /translation="KVGGERRGWKLVFSTPALASSFQRSHRCRTGTSLLPFLVPPRLSR
FT                   SNAMEPDTATEAATVAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKK
FT                   EKITSPFQLKLAAKASKSEKEMDPEYEEKMVNMPLKADRAKRFEFLLKQTELFAHFIQP
FT                   SAQKSPTSPLNMKLARPRVKKDDKQSLISVGDYRHRRTEQEEDEELLSESRKTSNVCVR
FT                   FEVSPSYVKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYR
FT                   NIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVT
FT                   SYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNL
FT                   HELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKS
FT                   LPPKKEIKIYLGLSKMQREWYTKILMKDIDVLNSSGKMDKMRLLNILMQLRKCCNHPYL
FT                   FDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMW
FT                   RGYEYSRLDGQTPHEEREEAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSD
FT                   WNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLID
FT                   QQSNKLAKEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKKTAEMNERMQKMGES
FT                   SLRNFRMDLEQSLYKFEGEDYREKQKLGTVEWIEPPKRERKANYAVDAYFREALRVSEP
FT                   KIPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPEIPNPAIAQREE
FT                   QKKIDGAEPLTPQETEEKDKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGK
FT                   SPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQ
FT                   LRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRT
FT                   AMEFQRRCNTLISLIEKENMEIEERERAEKKKRATKTPMSQKRKAESATESSGRKDVKK
FT                   VKS"
FT   CDS             complement(join(9923736..9923870,9935967..9936179,
FT                   9936292..9936410,9939095..9939227,9941435..9941557,
FT                   9954115..9954228,9954487..9954597,9962386..9962505,
FT                   9964120..9964268,9965070..9965202,9967041..9967193,
FT                   9970723..9970844,9972889..9973115,9973747..9973856,
FT                   9979365..9979433,9980374..9980505,9981595..9981750,
FT                   9984656..9984835,9988951..9989051,9989180..9989280,
FT                   9989641..9989807,9992701..9992802,9997818..>9998111))
FT                   /codon_start=1
FT                   /gene="Smarca1"
FT                   /locus_tag="mCG_114900"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a, member 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG114900.2 transcript_id=mCT192576.0
FT                   protein_id=mCP113529.0 isoform=CRA_c"
FT                   /protein_id="EDL29057.1"
FT                   /translation="GWKLVFSTPALASSFQRSHRCRTGTSLLPFLVPPRLSRSNAMEPD
FT                   TATEAATVAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITSPF
FT                   QLKLAAKASKSEKEMDPEYEEKMVNMPLKADRAKRFEFLLKQTELFAHFIQPSAQKSPT
FT                   SPLNMKLARPRVKKDDKQSLISVGDYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSY
FT                   VKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHM
FT                   VLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVTSYEMVIK
FT                   EKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALL
FT                   NFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEI
FT                   KIYLGLSKMQREWYTKILMKDIDVLNSSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPG
FT                   PPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYSR
FT                   LDGQTPHEEREEAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDL
FT                   QAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLA
FT                   KEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKKTAEMNERMQKMGESSLRNFRM
FT                   DLEQSLYKFEGEDYREKQKLGTVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPR
FT                   PPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPEIPNPAIAQREEQKKIDGA
FT                   EPLTPQETEEKDKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVME
FT                   YSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGT
FT                   SKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRR
FT                   CNTLISLIEKENMEIEERERAEKKKRATKTPMVKFSAFS"
FT   gap             9940433..9940452
FT                   /estimated_length=20
FT   gap             9961250..9961430
FT                   /estimated_length=181
FT   gap             9974960..9975447
FT                   /estimated_length=488
FT   gap             9977374..9977393
FT                   /estimated_length=20
FT   gap             9987864..9988387
FT                   /estimated_length=524
FT   gap             9998152..9998328
FT                   /estimated_length=177
FT   gene            10006086..10006646
FT                   /locus_tag="mCG_18971"
FT                   /note="gene_id=mCG18971.0"
FT   mRNA            10006086..10006646
FT                   /locus_tag="mCG_18971"
FT                   /product="mCG18971"
FT                   /note="gene_id=mCG18971.0 transcript_id=mCT16480.0 created
FT                   on 06-JAN-2003"
FT   CDS             10006117..10006599
FT                   /codon_start=1
FT                   /locus_tag="mCG_18971"
FT                   /product="mCG18971"
FT                   /note="gene_id=mCG18971.0 transcript_id=mCT16480.0
FT                   protein_id=mCP6377.1"
FT                   /db_xref="GOA:Q9CQM8"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="MGI:MGI:1278340"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CQM8"
FT                   /protein_id="EDL29058.1"
FT                   /translation="MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGM
FT                   GTVQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVRIEHIKHSKSRDS
FT                   FLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPELLEPIPYEFMA"
FT   gap             10016642..10017380
FT                   /estimated_length=739
FT   gene            10017922..10071021
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /note="gene_id=mCG18974.3"
FT   mRNA            join(10017922..10018173,10021861..10021940,
FT                   10025571..10025609,10035805..10035915,10036332..10036418,
FT                   10037010..10037130,10037218..10037379,10038808..10038909,
FT                   10040279..10040393,10041524..10041640,10041735..10041922,
FT                   10043733..10043844,10046543..10046652,10048940..10049075,
FT                   10052437..10052547,10053141..10053306,10053559..10053794,
FT                   10061368..10062233)
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /product="oculocerebrorenal syndrome of Lowe, transcript
FT                   variant mCT181827"
FT                   /note="gene_id=mCG18974.3 transcript_id=mCT181827.0 created
FT                   on 07-APR-2003"
FT   mRNA            join(10017925..10018173,10021862..10021940,
FT                   10025571..10025609,10035805..10035915,10036332..10036418,
FT                   10037010..10037130,10037218..10037379,10038808..10038909,
FT                   10040279..10040393,10041524..10041640,10041735..10041922,
FT                   10043733..10043844,10046543..10046652,10048940..10049075,
FT                   10052437..10052547,10053141..10053306,10053559..10053794,
FT                   10065611..10065727,10066535..10066619,10067238..10067365,
FT                   10068299..10068410,10068618..10071021)
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /product="oculocerebrorenal syndrome of Lowe, transcript
FT                   variant mCT16483"
FT                   /note="gene_id=mCG18974.3 transcript_id=mCT16483.3 created
FT                   on 07-APR-2003"
FT   mRNA            join(10017939..10018173,10035805..10035915,
FT                   10036332..10036418,10037010..10037130,10037218..10037379,
FT                   10038808..10038909,10040279..10040393,10041524..10041640,
FT                   10041735..10041922,10043733..10043844,10046543..10046652,
FT                   10048940..10049075,10052437..10052547,10053559..10053794,
FT                   10061368..10062233)
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /product="oculocerebrorenal syndrome of Lowe, transcript
FT                   variant mCT181826"
FT                   /note="gene_id=mCG18974.3 transcript_id=mCT181826.0 created
FT                   on 07-APR-2003"
FT   CDS             join(10018138..10018173,10021862..10021940,
FT                   10025571..10025609,10035805..10035915,10036332..10036418,
FT                   10037010..10037130,10037218..10037379,10038808..10038909,
FT                   10040279..10040393,10041524..10041640,10041735..10041922,
FT                   10043733..10043844,10046543..10046652,10048940..10049075,
FT                   10052437..10052547,10053141..10053306,10053559..10053794,
FT                   10065611..10065727,10066535..10066619,10067238..10067365,
FT                   10068299..10068410,10068618..10068742)
FT                   /codon_start=1
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /product="oculocerebrorenal syndrome of Lowe, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18974.3 transcript_id=mCT16483.3
FT                   protein_id=mCP6380.3 isoform=CRA_a"
FT                   /protein_id="EDL29059.1"
FT                   /translation="MEPRLPIGAQPLLIIQLHGKEQHVQDIIPINSHFRCVQEAEETLL
FT                   IDIASNSGCKIRVQGDWTRERHFEIPDEERCLKFLSEVLEAQEAQSQLLVPEQKDSSSW
FT                   YQKLDTMDKPAYSGLLGFEDNFSSLDLDKKMNTQNPRSGSHREPPPPPSSSTRMLSREK
FT                   EASNKEQPKVTNTMRKLFVPNTQTGQREGLIKHILTKREKEYVNIQSFRFFVGTWNVNG
FT                   QSPDSSLEPWLDCDPNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSLAVERGLPSKAK
FT                   YRKVQLVRLVGMMLLIFARKDQCQYIRDVATETTGTGIMGKMGNKGGVAVRFVFHNTTF
FT                   CIVNSHLAAHVEEFERRNQDYKDICARMTFSVPNQTVPQVNIMKHDVVIWLGDLNYRLC
FT                   MPDASEVKSLINKNELHKLLKFDQLNIQRTQKKAFADFNEGEINFVPTYKYDSKTDRWD
FT                   SSGKCRVPAWCDRILWRGINVNQLHYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKV
FT                   FEDIVRIMDRMENDFLPSLELSRREFFFENVKFRQLQKEKFQISNNGQVPCHFSFIPKL
FT                   NDSQYCKPWLRAEPFEGYLEPNETLDISLDVYVSKDSVTILNSGEDKIEDILVLHLDRG
FT                   KDYFLTIGGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEKSLLQMVPLDEGTSERP
FT                   LQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGNNHSVAEA
FT                   LLIFLEALPEPVICYELYQRCLDSAHDPRICKQVISQLPRCHRNVFRYLMAFLRELLKF
FT                   SDYNNINTNMIATLFSSLLLRPPPNLMTRQTPNDRQHAIQFLLVFLLGNEED"
FT   gap             10018467..10018486
FT                   /estimated_length=20
FT   gap             10024379..10024580
FT                   /estimated_length=202
FT   gap             10030764..10031126
FT                   /estimated_length=363
FT   CDS             join(10036397..10036418,10037010..10037130,
FT                   10037218..10037379,10038808..10038909,10040279..10040393,
FT                   10041524..10041640,10041735..10041922,10043733..10043844,
FT                   10046543..10046652,10048940..10049075,10052437..10052547,
FT                   10053141..10053306,10053559..10053794,10061368..10061439)
FT                   /codon_start=1
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /product="oculocerebrorenal syndrome of Lowe, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG18974.3 transcript_id=mCT181827.0
FT                   protein_id=mCP104749.0 isoform=CRA_c"
FT                   /protein_id="EDL29061.1"
FT                   /translation="MDKPAYSGLLGFEDNFSSLDLDKKMNTQNPRSGSHREPPPPPSSS
FT                   TRMLSREKEASNKEQPKVTNTMRKLFVPNTQTGQREGLIKHILTKREKEYVNIQSFRFF
FT                   VGTWNVNGQSPDSSLEPWLDCDPNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSLAVE
FT                   RGLPSKAKYRKVQLVRLVGMMLLIFARKDQCQYIRDVATETTGTGIMGKMGNKGGVAVR
FT                   FVFHNTTFCIVNSHLAAHVEEFERRNQDYKDICARMTFSVPNQTVPQVNIMKHDVVIWL
FT                   GDLNYRLCMPDASEVKSLINKNELHKLLKFDQLNIQRTQKKAFADFNEGEINFVPTYKY
FT                   DSKTDRWDSSGKCRVPAWCDRILWRGINVNQLHYRSHMELKTSDHKPVSALFHIGVKVV
FT                   DERRYRKVFEDIVRIMDRMENDFLPSLELSRREFFFENVKFRQLQKEKFQISNNGQVPC
FT                   HFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETLDISLDVYVSKDSVTILNSGEDKIEDI
FT                   LVLHLDRGKDYFLTIGGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSYLEKVI
FT                   QSIGGNEGFLVLD"
FT   CDS             join(10036397..10036418,10037010..10037130,
FT                   10037218..10037379,10038808..10038909,10040279..10040393,
FT                   10041524..10041640,10041735..10041922,10043733..10043844,
FT                   10046543..10046652,10048940..10049075,10052437..10052547,
FT                   10053559..10053570)
FT                   /codon_start=1
FT                   /gene="Ocrl"
FT                   /locus_tag="mCG_18974"
FT                   /product="oculocerebrorenal syndrome of Lowe, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18974.3 transcript_id=mCT181826.0
FT                   protein_id=mCP104748.0 isoform=CRA_b"
FT                   /protein_id="EDL29060.1"
FT                   /translation="MDKPAYSGLLGFEDNFSSLDLDKKMNTQNPRSGSHREPPPPPSSS
FT                   TRMLSREKEASNKEQPKVTNTMRKLFVPNTQTGQREGLIKHILTKREKEYVNIQSFRFF
FT                   VGTWNVNGQSPDSSLEPWLDCDPNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSLAVE
FT                   RGLPSKAKYRKVQLVRLVGMMLLIFARKDQCQYIRDVATETTGTGIMGKMGNKGGVAVR
FT                   FVFHNTTFCIVNSHLAAHVEEFERRNQDYKDICARMTFSVPNQTVPQVNIMKHDVVIWL
FT                   GDLNYRLCMPDASEVKSLINKNELHKLLKFDQLNIQRTQKKAFADFNEGEINFVPTYKY
FT                   DSKTDRWDSSGKCRVPAWCDRILWRGINVNQLHYRSHMELKTSDHKPVSALFHIGVKVV
FT                   DERRYRKVFEDIVRIMDRMENDFLPSLELSRRETRP"
FT   gap             10054278..10054297
FT                   /estimated_length=20
FT   gap             10074778..10075422
FT                   /estimated_length=645
FT   gap             10083766..10083785
FT                   /estimated_length=20
FT   gap             10103155..10103419
FT                   /estimated_length=265
FT   gene            10116454..10117572
FT                   /locus_tag="mCG_142398"
FT                   /note="gene_id=mCG142398.0"
FT   mRNA            10116454..10117572
FT                   /locus_tag="mCG_142398"
FT                   /product="mCG142398"
FT                   /note="gene_id=mCG142398.0 transcript_id=mCT180381.0
FT                   created on 03-MAR-2003"
FT   CDS             10116523..10116768
FT                   /codon_start=1
FT                   /locus_tag="mCG_142398"
FT                   /product="mCG142398"
FT                   /note="gene_id=mCG142398.0 transcript_id=mCT180381.0
FT                   protein_id=mCP103303.0"
FT                   /protein_id="EDL29062.1"
FT                   /translation="MADQLTEEQIAEFKDAFSLFDKDGDGKITTKELGTVMRSLGQNPT
FT                   EAELQDMINEVDAASNGTIDFPEFMTMMARTMKDRQ"
FT   gene            complement(10131648..>10141338)
FT                   /gene="Apln"
FT                   /locus_tag="mCG_5047"
FT                   /note="gene_id=mCG5047.2"
FT   mRNA            complement(join(10131648..10134208,10134795..10134966,
FT                   10140944..>10141338))
FT                   /gene="Apln"
FT                   /locus_tag="mCG_5047"
FT                   /product="apelin"
FT                   /note="gene_id=mCG5047.2 transcript_id=mCT4321.2 created on
FT                   16-DEC-2002"
FT   CDS             complement(join(10134800..10134966,10140944..>10141316))
FT                   /codon_start=1
FT                   /gene="Apln"
FT                   /locus_tag="mCG_5047"
FT                   /product="apelin"
FT                   /note="gene_id=mCG5047.2 transcript_id=mCT4321.2
FT                   protein_id=mCP5258.2"
FT                   /protein_id="EDL29063.1"
FT                   /translation="ESRAEQRQPLREFLPPTRSHQGQLRGAAPRRQRRLHQSRGSEQEW
FT                   GRQPAVRLGRSPSRGPGATRAPCPHAPAPARAFLCVRVPCLSAHSPAPLGCRGPSCSMN
FT                   LRLCVQALLLLWLSLTAVCGVPLMLPPDGTGLEEGSMRYLVKPRTSRTGPGAWQGGRRK
FT                   FRRQRPRLSHKGPMPF"
FT   gap             10141453..10141472
FT                   /estimated_length=20
FT   gap             10145999..10146325
FT                   /estimated_length=327
FT   gap             10167293..10167312
FT                   /estimated_length=20
FT   gap             10201765..10202153
FT                   /estimated_length=389
FT   gene            10215142..10243147
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /note="gene_id=mCG5051.2"
FT   mRNA            join(10215142..10215462,10217992..10218065,
FT                   10219937..10220047,10222186..10222249,10223210..10223314,
FT                   10223536..10223622,10224593..10224739,10228059..10228160,
FT                   10228787..10228868,10229146..10229341,10230097..10230186,
FT                   10230874..10230983,10231603..10231680,10233127..10233198,
FT                   10234971..10235031,10236240..10236309,10236872..10236976,
FT                   10237341..10237400,10238091..10238167,10241278..10241367,
FT                   10241901..10243147)
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /product="X-prolyl aminopeptidase (aminopeptidase P) 2,
FT                   membrane-bound, transcript variant mCT4309"
FT                   /note="gene_id=mCG5051.2 transcript_id=mCT4309.2 created on
FT                   16-DEC-2002"
FT   mRNA            join(<10215186..10215462,10217992..10218065,
FT                   10219937..10220047,10222186..10222249,10223210..10223314,
FT                   10223536..10223622,10224593..10224739,10228059..10228160,
FT                   10228787..10228868,10229146..10229341,10230097..10230186,
FT                   10230874..10230983,10231603..10231680,10233127..10233198,
FT                   10234971..10235031,10236240..10236309,10236872..10236976,
FT                   10237341..10237400,10238091..10238167,10239169..10240218)
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /product="X-prolyl aminopeptidase (aminopeptidase P) 2,
FT                   membrane-bound, transcript variant mCT192583"
FT                   /note="gene_id=mCG5051.2 transcript_id=mCT192583.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<10215196..10215462,10217992..10218065,
FT                   10219937..10220047,10222186..10222249,10223210..10223314,
FT                   10223536..10223622,10224593..10224739,10228059..10228361,
FT                   10228787..10228868,10229146..10229341,10230097..10230186,
FT                   10230874..10230983,10231603..10231680,10233127..10233198,
FT                   10234971..10235031,10236240..10236309,10236872..10236976,
FT                   10237341..10237400,10238091..10238167,10241278..10241367,
FT                   10241901..10242836)
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /product="X-prolyl aminopeptidase (aminopeptidase P) 2,
FT                   membrane-bound, transcript variant mCT192584"
FT                   /note="gene_id=mCG5051.2 transcript_id=mCT192584.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<10215258..10215462,10217992..10218065,
FT                   10219937..10220047,10222186..10222249,10223210..10223314,
FT                   10223536..10223622,10224593..10224739,10228059..10228361,
FT                   10228787..10228868,10229146..10229341,10230097..10230186,
FT                   10230874..10230983,10231603..10231680,10233127..10233198,
FT                   10234971..10235031,10236240..10236309,10236872..10236976,
FT                   10237341..10237400,10238091..10238167,10241278..10241367,
FT                   10241901..10242095)
FT                   /codon_start=1
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /product="X-prolyl aminopeptidase (aminopeptidase P) 2,
FT                   membrane-bound, isoform CRA_b"
FT                   /note="gene_id=mCG5051.2 transcript_id=mCT192584.0
FT                   protein_id=mCP113540.0 isoform=CRA_b"
FT                   /protein_id="EDL29065.1"
FT                   /translation="NKRLQKDPHLTSRHSHQPYLLLPRKGLEEEATKQPNPLSSPLIYS
FT                   SPASGDPMAQAYWQCYPWLVLLCACAWSYPEPKYLGREDVRNCSTSPERLPVTAVNTTM
FT                   RLAALRQQMETWNLSAYIIPDTDAHMSEYIGKPDKRREWISGFTGSAGTAVVTMGKAAV
FT                   WTDSRYWTQAERQMDCNWELHKEVSISSIVAWILAEVPDGQNVGFDPFLFSVDSWKNYD
FT                   QGFQDSSRHLLSVTTNLVDVAWGSERPPVPSQPIYALPKEFTGSTWQEKVSAVRSYMEH
FT                   HAKTPTGVLLSALDETACEWGFLNMGQSGSPKLPGPCNIQLFLKQQHIHQLLRAPKIIV
FT                   CGNSEGKRAAVWGYRTRKPGSSKQVGLFNLRSSDIPYNPFFYSYALLTNSSIRLFVNKS
FT                   RFSLETLQYLNTNCTLPMCVQLEDYSQVRDSVKAYASGDVKILIGVSYTTYGVYEVIPK
FT                   EKLVTDTYSPVMLIKAVKNSKEQALLKSSHVRDAVAVIQYLVWLEKNVPKGTVDEFSGA
FT                   EYIDELRRNENFSSGPSFETISASGLNAALAHYSPTKELHRKLSSDEMYLVDSGGQYWD
FT                   GTTDITRTVHWGTPTAFQKEAYTRVLMGNIDLSRLVFPAATSGRVIEAFARRALWEVGL
FT                   NYGHGTGHGIGNFLCVHEWPVGFQYNNIAMAKGMFTSIEPGYYHDGEFGIRLEDVALVV
FT                   EAKTKYPGDYLTFELVSFVPYDRNLIDVRLLSPEQLQYLNRYYQTIRENVGPELQRRQL
FT                   LEEFAWLEQHTEPLSARAPHIISWTSLWVASALAILSWSS"
FT   CDS             join(<10215258..10215462,10217992..10218065,
FT                   10219937..10220047,10222186..10222249,10223210..10223314,
FT                   10223536..10223622,10224593..10224739,10228059..10228160,
FT                   10228787..10228868,10229146..10229341,10230097..10230186,
FT                   10230874..10230983,10231603..10231680,10233127..10233198,
FT                   10234971..10235031,10236240..10236309,10236872..10236976,
FT                   10237341..10237400,10238091..10238167,10239169..10239177)
FT                   /codon_start=1
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /product="X-prolyl aminopeptidase (aminopeptidase P) 2,
FT                   membrane-bound, isoform CRA_a"
FT                   /note="gene_id=mCG5051.2 transcript_id=mCT192583.0
FT                   protein_id=mCP113539.0 isoform=CRA_a"
FT                   /protein_id="EDL29064.1"
FT                   /translation="NKRLQKDPHLTSRHSHQPYLLLPRKGLEEEATKQPNPLSSPLIYS
FT                   SPASGDPMAQAYWQCYPWLVLLCACAWSYPEPKYLGREDVRNCSTSPERLPVTAVNTTM
FT                   RLAALRQQMETWNLSAYIIPDTDAHMSEYIGKPDKRREWISGFTGSAGTAVVTMGKAAV
FT                   WTDSRYWTQAERQMDCNWELHKEVSISSIVAWILAEVPDGQNVGFDPFLFSVDSWKNYD
FT                   QGFQDSSRHLLSVTTNLVDVAWGSERPPVPSQPIYALPKEFTGSTWQEKVSAVRSYMEH
FT                   HAKTPTGVLLSALDETAWLFNLRSSDIPYNPFFYSYALLTNSSIRLFVNKSRFSLETLQ
FT                   YLNTNCTLPMCVQLEDYSQVRDSVKAYASGDVKILIGVSYTTYGVYEVIPKEKLVTDTY
FT                   SPVMLIKAVKNSKEQALLKSSHVRDAVAVIQYLVWLEKNVPKGTVDEFSGAEYIDELRR
FT                   NENFSSGPSFETISASGLNAALAHYSPTKELHRKLSSDEMYLVDSGGQYWDGTTDITRT
FT                   VHWGTPTAFQKEAYTRVLMGNIDLSRLVFPAATSGRVIEAFARRALWEVGLNYGHGTGH
FT                   GIGNFLCVHEWPVGFQYNNIAMAKGMFTSIEPGYYHDGEFGIRLEDVALVVEAKTKMD"
FT   CDS             join(10215414..10215462,10217992..10218065,
FT                   10219937..10220047,10222186..10222249,10223210..10223314,
FT                   10223536..10223622,10224593..10224739,10228059..10228160,
FT                   10228787..10228868,10229146..10229341,10230097..10230186,
FT                   10230874..10230983,10231603..10231680,10233127..10233198,
FT                   10234971..10235031,10236240..10236309,10236872..10236976,
FT                   10237341..10237400,10238091..10238167,10241278..10241367,
FT                   10241901..10242095)
FT                   /codon_start=1
FT                   /gene="Xpnpep2"
FT                   /locus_tag="mCG_5051"
FT                   /product="X-prolyl aminopeptidase (aminopeptidase P) 2,
FT                   membrane-bound, isoform CRA_c"
FT                   /note="gene_id=mCG5051.2 transcript_id=mCT4309.2
FT                   protein_id=mCP5262.2 isoform=CRA_c"
FT                   /db_xref="GOA:B1AVD1"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="MGI:MGI:2180001"
FT                   /db_xref="UniProtKB/TrEMBL:B1AVD1"
FT                   /protein_id="EDL29066.1"
FT                   /translation="MAQAYWQCYPWLVLLCACAWSYPEPKYLGREDVRNCSTSPERLPV
FT                   TAVNTTMRLAALRQQMETWNLSAYIIPDTDAHMSEYIGKPDKRREWISGFTGSAGTAVV
FT                   TMGKAAVWTDSRYWTQAERQMDCNWELHKEVSISSIVAWILAEVPDGQNVGFDPFLFSV
FT                   DSWKNYDQGFQDSSRHLLSVTTNLVDVAWGSERPPVPSQPIYALPKEFTGSTWQEKVSA
FT                   VRSYMEHHAKTPTGVLLSALDETAWLFNLRSSDIPYNPFFYSYALLTNSSIRLFVNKSR
FT                   FSLETLQYLNTNCTLPMCVQLEDYSQVRDSVKAYASGDVKILIGVSYTTYGVYEVIPKE
FT                   KLVTDTYSPVMLIKAVKNSKEQALLKSSHVRDAVAVIQYLVWLEKNVPKGTVDEFSGAE
FT                   YIDELRRNENFSSGPSFETISASGLNAALAHYSPTKELHRKLSSDEMYLVDSGGQYWDG
FT                   TTDITRTVHWGTPTAFQKEAYTRVLMGNIDLSRLVFPAATSGRVIEAFARRALWEVGLN
FT                   YGHGTGHGIGNFLCVHEWPVGFQYNNIAMAKGMFTSIEPGYYHDGEFGIRLEDVALVVE
FT                   AKTKYPGDYLTFELVSFVPYDRNLIDVRLLSPEQLQYLNRYYQTIRENVGPELQRRQLL
FT                   EEFAWLEQHTEPLSARAPHIISWTSLWVASALAILSWSS"
FT   gap             10235493..10235512
FT                   /estimated_length=20
FT   gap             10241627..10241646
FT                   /estimated_length=20
FT   gene            10252677..10267720
FT                   /gene="1200013B08Rik"
FT                   /locus_tag="mCG_5049"
FT                   /note="gene_id=mCG5049.1"
FT   mRNA            join(10252677..10252884,10260684..10260779,
FT                   10261134..10261280,10263577..10263718,10264891..10265039,
FT                   10265198..10265407,10265560..10265710,10266222..10267720)
FT                   /gene="1200013B08Rik"
FT                   /locus_tag="mCG_5049"
FT                   /product="RIKEN cDNA 1200013B08"
FT                   /note="gene_id=mCG5049.1 transcript_id=mCT4316.2 created on
FT                   16-DEC-2002"
FT   CDS             join(10252828..10252884,10260684..10260779,
FT                   10261134..10261280,10263577..10263718,10264891..10265039,
FT                   10265198..10265407,10265560..10265710,10266222..10266412)
FT                   /codon_start=1
FT                   /gene="1200013B08Rik"
FT                   /locus_tag="mCG_5049"
FT                   /product="RIKEN cDNA 1200013B08"
FT                   /note="gene_id=mCG5049.1 transcript_id=mCT4316.2
FT                   protein_id=mCP5260.1"
FT                   /protein_id="EDL29067.1"
FT                   /translation="MLRRKPSNASDKEPTQKKKLSLQRSSSFKDFAKSKPSSPVVSEKE
FT                   FNLDDNIPEDDSGVLTPEDSGKSGKKLGKKWRAVISRTMNRKMGKMMVKALSEEMGDTL
FT                   EEGSASPTSPDCSLDSPGPEKMALAFTEQEEREPPSLSRQTSTGSELCSPGPGSGSFLE
FT                   ESPAPQYTGPFCGRARVHTDFTPSPYDHDSLKLQKGDVIQIVEKPPVGTWLGLLNGKLG
FT                   SFKFIYVDVLPEEAVGPVRPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTL
FT                   EDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSE
FT                   PKVDIPRDSGCFEGSESGRDEAELAGTEEQLQGLSLSGAP"
FT   gap             10254152..10254210
FT                   /estimated_length=59
FT   gap             10269374..10269393
FT                   /estimated_length=20
FT   gap             10278315..10278427
FT                   /estimated_length=113
FT   gene            complement(10278428..10314402)
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /note="gene_id=mCG5054.2"
FT   mRNA            complement(join(10278428..10279584,10283515..10283611,
FT                   10283984..10284087,10286666..10286768,10287518..10287566,
FT                   10288443..10288580,10296743..10296901,10300268..10300428,
FT                   10312386..10312675,10314198..10314402))
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, transcript
FT                   variant mCT4312"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT4312.2 created on
FT                   13-JUN-2003"
FT   CDS             complement(join(10279468..10279584,10283515..10283611,
FT                   10283984..10284087,10286666..10286768,10287518..10287566,
FT                   10288443..10288580,10296743..10296901,10300268..10300428,
FT                   10312386..10312552))
FT                   /codon_start=1
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT4312.2
FT                   protein_id=mCP5265.2 isoform=CRA_d"
FT                   /protein_id="EDL29071.1"
FT                   /translation="MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLI
FT                   LGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAF
FT                   IEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVE
FT                   RFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKET
FT                   PGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVK
FT                   NCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPASTEHMNSNEMAED
FT                   TSIPEEMPPPEPPEPPQEASEAEK"
FT   gap             10286565..10286584
FT                   /estimated_length=20
FT   mRNA            complement(join(10287113..10287566,10288443..10288580,
FT                   10296743..10296901,10300268..10300428,10312386..10312675,
FT                   10314198..10314385))
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, transcript
FT                   variant mCT185585"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT185585.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(10287478..10287566,10288443..10288580,
FT                   10296743..10296901,10300268..10300428,10312386..10312552))
FT                   /codon_start=1
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT185585.0
FT                   protein_id=mCP106844.0 isoform=CRA_c"
FT                   /protein_id="EDL29070.1"
FT                   /translation="MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLI
FT                   LGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAF
FT                   IEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVE
FT                   RFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKET
FT                   PGTYPPLAVRPCEAV"
FT   gap             10288851..10289126
FT                   /estimated_length=276
FT   gap             10290705..10290724
FT                   /estimated_length=20
FT   mRNA            complement(join(10295566..10296901,10300268..10300428,
FT                   10312386..10314321))
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, transcript
FT                   variant mCT185584"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT185584.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(10296735..10296901,10300268..10300428,
FT                   10312386..10312552))
FT                   /codon_start=1
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT185584.0
FT                   protein_id=mCP106842.0 isoform=CRA_a"
FT                   /protein_id="EDL29068.1"
FT                   /translation="MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLI
FT                   LGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAF
FT                   IEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVG
FT                   E"
FT   gap             10297189..10297371
FT                   /estimated_length=183
FT   mRNA            complement(join(10307438..10308043,10312386..10312675,
FT                   10313841..10313953))
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, transcript
FT                   variant mCT185586"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT185586.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(10307983..10308043,10312386..10312552))
FT                   /codon_start=1
FT                   /gene="Zdhhc9"
FT                   /locus_tag="mCG_5054"
FT                   /product="zinc finger, DHHC domain containing 9, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5054.2 transcript_id=mCT185586.0
FT                   protein_id=mCP106843.0 isoform=CRA_b"
FT                   /protein_id="EDL29069.1"
FT                   /translation="MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLI
FT                   LGTCTLFFAFESTVPSLSLSEDFKCKMLQM"
FT   gap             10310092..10310111
FT                   /estimated_length=20
FT   gap             10330307..10330485
FT                   /estimated_length=179
FT   gap             10338319..10338338
FT                   /estimated_length=20
FT   gap             10340537..10340639
FT                   /estimated_length=103
FT   gap             10350410..10350609
FT                   /estimated_length=200
FT   gap             10353334..10353353
FT                   /estimated_length=20
FT   gap             10358774..10358793
FT                   /estimated_length=20
FT   gene            10362881..10387828
FT                   /gene="Utp14a"
FT                   /locus_tag="mCG_5053"
FT                   /note="gene_id=mCG5053.1"
FT   mRNA            join(10362881..10362958,10364330..10364405,
FT                   10365712..10365784,10368702..10368785,10368834..10368891,
FT                   10369331..10369486,10378185..10378304,10378407..10378501,
FT                   10379114..10379237,10379323..10379400,10380225..10380612,
FT                   10382597..10382994,10383742..10383935,10384043..10384142,
FT                   10387438..10387828)
FT                   /gene="Utp14a"
FT                   /locus_tag="mCG_5053"
FT                   /product="UTP14, U3 small nucleolar ribonucleoprotein,
FT                   homolog A (yeast)"
FT                   /note="gene_id=mCG5053.1 transcript_id=mCT4311.2 created on
FT                   06-JAN-2003"
FT   gap             10366405..10366437
FT                   /estimated_length=33
FT   gap             10368791..10368810
FT                   /estimated_length=20
FT   CDS             join(10369460..10369486,10378185..10378304,
FT                   10378407..10378501,10379114..10379237,10379323..10379400,
FT                   10380225..10380612,10382597..10382994,10383742..10383935,
FT                   10384043..10384142,10387438..10387707)
FT                   /codon_start=1
FT                   /gene="Utp14a"
FT                   /locus_tag="mCG_5053"
FT                   /product="UTP14, U3 small nucleolar ribonucleoprotein,
FT                   homolog A (yeast)"
FT                   /note="gene_id=mCG5053.1 transcript_id=mCT4311.2
FT                   protein_id=mCP5264.2"
FT                   /protein_id="EDL29072.1"
FT                   /translation="MEHVFREWKARTPLEQEVFNLLHKNKQPVTDPLLTPVEKASLKAM
FT                   SLEEAKIRRAELQRARALQSYYEARARRMKKIKSKKYHKIVKKGKAKKALKDFEQLRKV
FT                   DPDAALEELEKMEKARMMERMSLKHQNSGKWAKSKAIMAKYDLEARQAMQEQLAKNKEL
FT                   TQKLQVVSESEEEGGADEEEALVPDIVNEVQKTADGPNPWMLRSCSRDAKENEIQADSE
FT                   QLPESAAHEFPENEENDKPVAEEDELLKELEKRRSLRKRSELNQAAEPLGNQETKDSTS
FT                   QEVLSELRALSKKLSKENHLSKKQKKSPAKAVDLVWEEEPAPEEDEPLLLQRPERMRTL
FT                   EELEELGKEDSLPNKERPRPSVEGEQVRRNPQNHSKGKNKKEQMISLQNLLTTRTPSVT
FT                   SLALPTTVEELEDEGARDQKQMIKEAFAGDDVIKEFLKEKREAIQANKPKAVDLTLPGW
FT                   GEWGGMNLKPSARKRRRFLIKAPEGPPRKDKNLPNVIISEKRNIHAAAHQVRVLPYPFT
FT                   HHQQFERTIQNPIGSTWNTQRAFQKLTAPKVVTKPGHIIKPITAEDVDCRSSPRSDVPV
FT                   MQSNPKQHSKHQKQRKKSSIG"
FT   gap             10370896..10371102
FT                   /estimated_length=207
FT   gap             10373584..10373607
FT                   /estimated_length=24
FT   gap             10378727..10378746
FT                   /estimated_length=20
FT   gap             10381902..10381943
FT                   /estimated_length=42
FT   gene            complement(10382167..>10389022)
FT                   /locus_tag="mCG_146275"
FT                   /note="gene_id=mCG146275.0"
FT   mRNA            complement(join(10382167..10383565,10383646..10383816,
FT                   10388940..>10389022))
FT                   /locus_tag="mCG_146275"
FT                   /product="mCG146275"
FT                   /note="gene_id=mCG146275.0 transcript_id=mCT186378.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(10382532..>10382882)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146275"
FT                   /product="mCG146275"
FT                   /note="gene_id=mCG146275.0 transcript_id=mCT186378.0
FT                   protein_id=mCP107650.0"
FT                   /protein_id="EDL29073.1"
FT                   /translation="FCGFLLTCSPSTEGLGRSLFGRLSSLPSSSSSSRVRILSGLCSKR
FT                   GSSSSGAGSSSQTRSTAFAGLFFCFLDRWFSLLSFLDNALNSDNTSWLVESEGRGQKKN
FT                   QAARDETWKFLS"
FT   gap             10389072..10389253
FT                   /estimated_length=182
FT   gap             10390215..10391064
FT                   /estimated_length=850
FT   gap             10393818..10397939
FT                   /estimated_length=4122
FT   gap             10407053..10407404
FT                   /estimated_length=352
FT   gap             10410825..10410844
FT                   /estimated_length=20
FT   gap             10412899..10412918
FT                   /estimated_length=20
FT   gap             10421234..10421399
FT                   /estimated_length=166
FT   gap             10428015..10429129
FT                   /estimated_length=1115
FT   gap             10430868..10431021
FT                   /estimated_length=154
FT   gap             10432185..10432956
FT                   /estimated_length=772
FT   gap             10439463..10440101
FT                   /estimated_length=639
FT   gap             10441215..10442265
FT                   /estimated_length=1051
FT   gap             10446513..10447141
FT                   /estimated_length=629
FT   gene            10447490..10511969
FT                   /locus_tag="mCG_5052"
FT                   /note="gene_id=mCG5052.2"
FT   mRNA            join(10447490..10447678,10448230..10448309,
FT                   10467039..10467069,10467096..10467168,10472923..10473013,
FT                   10473273..10473569,10474537..10476537,10480571..10480736,
FT                   10482293..10482373,10489217..10489440,10494405..10494626,
FT                   10497193..10497458,10498476..10498621,10505889..10505966,
FT                   10507087..10507237,10511182..10511969)
FT                   /locus_tag="mCG_5052"
FT                   /product="mCG5052"
FT                   /note="gene_id=mCG5052.2 transcript_id=mCT4310.2 created on
FT                   06-JAN-2003"
FT   gap             10450585..10451098
FT                   /estimated_length=514
FT   gap             10456922..10456957
FT                   /estimated_length=36
FT   gap             10464701..10465437
FT                   /estimated_length=737
FT   CDS             join(10467146..10467168,10472923..10473013,
FT                   10473273..10473569,10474537..10476537,10480571..10480736,
FT                   10482293..10482373,10489217..10489440,10494405..10494626,
FT                   10497193..10497458,10498476..10498621,10505889..10505966,
FT                   10507087..10507237,10511182..10511464)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5052"
FT                   /product="mCG5052"
FT                   /note="gene_id=mCG5052.2 transcript_id=mCT4310.2
FT                   protein_id=mCP5263.2"
FT                   /protein_id="EDL29074.1"
FT                   /translation="MCGINEERRAPLSDEESTTGGCQHFGSQEFCVSSSFSKVELTAVG
FT                   SGSNARGTNPDGNTTEKLGHRSEDQSDDPQPKMDYVGNPAEAEGLLVPLSSPGDGLKLP
FT                   TPDSTEASHSRANCSWTPLSTQMSKQVDCSPAGDRCLPGVLASPDLRSYPCAFSVARPL
FT                   ASDSKLVSLEVNRLSCTSPSSSTNSQPAPDGVPGPLADTSLTTASAKVLPTSQLLLPAP
FT                   SGSSVPPHPSKMPGGTDQQTEGTSVTFSPLKSPPQLEREMASPPECSEMPLDLSAKSNR
FT                   QKLPLPNQRKTPPMPVLTPVHTSSKALLSTVLSRSQRTTQAAGSNVTSCLGSTSSPFVI
FT                   FPEMVRNGDPSTWVKNSTALISTIPGTYVGVANPVPASLLLNKDPNLGLNRDPRHLPKQ
FT                   EPISIIDQGEPKSTSATCGKKGSQAGAEGQPSTVKSRYTPARIAPGLPGCQTKELSLWK
FT                   PTGLTNMYPRCSINGKPTSTQVLPVGWSPYHQASLLSIGISSAGQLTPSQGVPIRPTSI
FT                   VSEFSGVSPLGSSETVHGLPEGQPRPGGPFAPEQDAVTKNKNCRIAAKPYEEQVNPVLL
FT                   TLSPQSGTLALSVQPSSGDMGVNQGSEESESHLCSDSTPKMEGPQAACGLKLAGDTKPK
FT                   NQVLATYMSHELVLANPQNLCKMPELPLLPHDSHSKELILDVVPSSERGPSTDLSQLGS
FT                   QVDLGRVKMEKADGDVVFNLANCFRADGLPAVPQRGQAEARANAGQARVKRESIGVFTC
FT                   KNSWQPDEETESLPPKKVKCNKEKEIEEEPRQQPPPQPHDKPMVRSSLGSKCRKLPGDP
FT                   QEPTKKSPRGALDSGKEHNGVRGKHKHRKPTKPESQPPGKRTDGHEEGSLEKKAKNSFR
FT                   DFIPVVLSTRTRSQSDSKARKQKTSSQSSEHCLRNRNLLLSSKAQGISDSPNGFLPDNL
FT                   EEPACLENPEKPSGKRKCKTKHMANASEEARSKGRWSQQKTRSSKSPTPVKPTEPCTPS
FT                   KYRSAGPEEASESPTARQIPPEARRLIVNKNAGETLLQRAARLGYKDVVLYCLQKHSED
FT                   VNHRDNAGYTALHEACSRGWTDILNILLQHGANVNCSSQDGTRQEGCSSAKSQTSVQSL
FT                   ASELYSDLDICRMSSCWPVHDAVVNDNLETIWLLLSYGADPTLATYSGQTAMKLASSDN
FT                   MKRFLSDHLSDLQGRAEGDPRASWDFYSSSVLEKKDGFACDLLHNPPGSAEQGDDSEQD
FT                   DFMFELSDKPLLPCYNLQVSVSRGPCNWFLFSDVLKRLKLSSRIFQARFPHLEITTLPK
FT                   AEFYRQVASSQLLSPAERPGSLEDRSPPGSSETVELVQYEPELLRLLGSEVEYQSWSS"
FT   gap             10478796..10478815
FT                   /estimated_length=20
FT   gap             10493967..10493986
FT                   /estimated_length=20
FT   gap             10509931..10509950
FT                   /estimated_length=20
FT   gap             10516405..10516733
FT                   /estimated_length=329
FT   gene            complement(10518492..10529701)
FT                   /gene="Elf4"
FT                   /locus_tag="mCG_5050"
FT                   /note="gene_id=mCG5050.1"
FT   mRNA            complement(join(10518492..10519888,10520094..10520653,
FT                   10521859..10522236,10523083..10523275,10523367..10523450,
FT                   10524220..10524411,10526052..10526223,10529423..10529701))
FT                   /gene="Elf4"
FT                   /locus_tag="mCG_5050"
FT                   /product="E74-like factor 4 (ets domain transcription
FT                   factor)"
FT                   /note="gene_id=mCG5050.1 transcript_id=mCT4324.2 created on
FT                   16-DEC-2002"
FT   CDS             complement(join(10519848..10519888,10520094..10520653,
FT                   10521859..10522236,10523083..10523275,10523367..10523450,
FT                   10524220..10524411,10526052..10526223,10529423..10529494))
FT                   /codon_start=1
FT                   /gene="Elf4"
FT                   /locus_tag="mCG_5050"
FT                   /product="E74-like factor 4 (ets domain transcription
FT                   factor)"
FT                   /note="gene_id=mCG5050.1 transcript_id=mCT4324.2
FT                   protein_id=mCP5261.2"
FT                   /protein_id="EDL29075.1"
FT                   /translation="MAIALQPSDLVFEFASNGMDDIHQLEDPSVFPAVIVEQVPYPELV
FT                   HLCSGLDLDEVHNGIIRDRTLCMTQDQILEGSILLTVSSPEVLSDSNSVQAINLPNFLL
FT                   STPEPDDLKKTSDAGDQKEHSEEEKVSREENLRKMGKARKRNRKTKNNRSTSPVTDPSM
FT                   PIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQ
FT                   KNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLVVIDDEEESPETPEDS
FT                   SQASTSSTPSTSTIRRASSRVGTRASPEDKDSPPWEKPKVQHTGLQPSASLELGLSVDE
FT                   EVPTTSTMLASPLQSQARLTKTVSSSPAPSNIHLGVAPVGPGSTVTLQTIPLTTVLTNG
FT                   PPASTTAPTQLVLQSVPQVSTFKDTFTLQTSFPLNTNLQENQVATQGAPLILSGLPQLL
FT                   AGANPQSNPAPSQVIGAGSAGPSSQPPGTVIAAFIRTSSGTSVPVVKEGPLRSSSYVQG
FT                   VVTGAPVEGLLVPEETLRELLRDQGHLQPLPSQAGQNCEAFSCGLK"
FT   gap             10519889..10520093
FT                   /estimated_length=205
FT   gap             10525218..10525858
FT                   /estimated_length=641
FT   gap             10531936..10531955
FT                   /estimated_length=20
FT   gene            10541025..10543083
FT                   /locus_tag="mCG_147984"
FT                   /note="gene_id=mCG147984.0"
FT   mRNA            join(10541025..10541299,10542092..10543083)
FT                   /locus_tag="mCG_147984"
FT                   /product="mCG147984"
FT                   /note="gene_id=mCG147984.0 transcript_id=mCT188247.0
FT                   created on 13-JAN-2004"
FT   CDS             join(10541199..10541299,10542092..10542266)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147984"
FT                   /product="mCG147984"
FT                   /note="gene_id=mCG147984.0 transcript_id=mCT188247.0
FT                   protein_id=mCP109522.0"
FT                   /protein_id="EDL29076.1"
FT                   /translation="MWARFSSALSDSTSSCFPCFWGERPDGKDYRMTGSGPACPASSSL
FT                   HYPASSQTCGDPLRPLLPACWDYRPAPSTCLTDPLYKLQKSSEEIR"
FT   gap             10551306..10551325
FT                   /estimated_length=20
FT   gap             10553782..10554830
FT                   /estimated_length=1049
FT   gap             10557426..10557445
FT                   /estimated_length=20
FT   gap             10559197..10560380
FT                   /estimated_length=1184
FT   gap             10566177..10566321
FT                   /estimated_length=145
FT   gap             10568754..10568773
FT                   /estimated_length=20
FT   gap             10569548..10570455
FT                   /estimated_length=908
FT   gap             10577552..10579752
FT                   /estimated_length=2201
FT   gene            complement(10580558..10618717)
FT                   /gene="Pdcd8"
FT                   /locus_tag="mCG_5046"
FT                   /note="gene_id=mCG5046.1"
FT   mRNA            complement(join(10580558..10580671,10581046..10581242,
FT                   10583185..10583309,10585612..10585754,10587452..10587592,
FT                   10588209..10588297,10588642..10588749,10590014..10590122,
FT                   10590945..10591021,10591633..10591717,10600122..10600212,
FT                   10602463..10602593,10602717..10602841,10605156..10605255,
FT                   10610178..10610320,10618564..10618717))
FT                   /gene="Pdcd8"
FT                   /locus_tag="mCG_5046"
FT                   /product="programmed cell death 8"
FT                   /note="gene_id=mCG5046.1 transcript_id=mCT4320.1 created on
FT                   16-DEC-2002"
FT   CDS             complement(join(10580600..10580671,10581046..10581242,
FT                   10583185..10583309,10585612..10585754,10587452..10587592,
FT                   10588209..10588297,10588642..10588749,10590014..10590122,
FT                   10590945..10591021,10591633..10591717,10600122..10600212,
FT                   10602463..10602593,10602717..10602841,10605156..10605255,
FT                   10610178..10610320,10618564..10618666))
FT                   /codon_start=1
FT                   /gene="Pdcd8"
FT                   /locus_tag="mCG_5046"
FT                   /product="programmed cell death 8"
FT                   /note="gene_id=mCG5046.1 transcript_id=mCT4320.1
FT                   protein_id=mCP5257.2"
FT                   /protein_id="EDL29077.1"
FT                   /translation="MFRCGGLAGAFKQKLVPLVRTVYVQRPKQRNRLPGNLFQQWRVPL
FT                   ELQMARQMASSGSSGGKMDNSVLVLIVGLSTIGAGAYAYKTIKEDQKRYNERVMGLGLS
FT                   PEEKQRRAIASATEGGSVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSE
FT                   DPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENG
FT                   GVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTT
FT                   LFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMG
FT                   KILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGL
FT                   EPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAV
FT                   VSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPK
FT                   SATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIV
FT                   LWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED"
FT   gap             10591854..10592585
FT                   /estimated_length=732
FT   gap             10598288..10598942
FT                   /estimated_length=655
FT   gap             10599980..10599999
FT                   /estimated_length=20
FT   gap             10612236..10612255
FT                   /estimated_length=20
FT   gap             10619503..10619522
FT                   /estimated_length=20
FT   gap             10623252..10623271
FT                   /estimated_length=20
FT   gene            10624805..10635444
FT                   /gene="Rab33a"
FT                   /locus_tag="mCG_124936"
FT                   /note="gene_id=mCG124936.0"
FT   mRNA            join(10624805..10625193,10634861..10635444)
FT                   /gene="Rab33a"
FT                   /locus_tag="mCG_124936"
FT                   /product="RAB33A, member of RAS oncogene family"
FT                   /note="gene_id=mCG124936.0 transcript_id=mCT126188.0
FT                   created on 16-DEC-2002"
FT   CDS             join(10624936..10625193,10634861..10635316)
FT                   /codon_start=1
FT                   /gene="Rab33a"
FT                   /locus_tag="mCG_124936"
FT                   /product="RAB33A, member of RAS oncogene family"
FT                   /note="gene_id=mCG124936.0 transcript_id=mCT126188.0
FT                   protein_id=mCP87695.1"
FT                   /db_xref="GOA:Q3SXA7"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:109493"
FT                   /db_xref="UniProtKB/TrEMBL:Q3SXA7"
FT                   /protein_id="EDL29078.1"
FT                   /translation="MAQPILGHGSLQPASAAGLASLELDSSMDQYVQIRIFKIIVIGDS
FT                   NVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVE
FT                   HYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPS
FT                   NLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQK
FT                   LEFSQEANGKASCPC"
FT   gap             10631114..10631190
FT                   /estimated_length=77
FT   gap             10632263..10632341
FT                   /estimated_length=79
FT   gap             10634240..10634531
FT                   /estimated_length=292
FT   gap             10635914..10636809
FT                   /estimated_length=896
FT   gap             10642860..10642879
FT                   /estimated_length=20
FT   gene            complement(10646946..10698308)
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /note="gene_id=mCG124943.1"
FT   mRNA            complement(join(10646946..10648608,10648724..10648760,
FT                   10648904..10649022,10652563..10652625,10653834..10653971,
FT                   10655328..10655635,10659225..10659356,10663487..10663633,
FT                   10664261..10664361,10664885..10665042,10669495..10669715,
FT                   10672929..10673038,10673170..10673334,10675171..10675276,
FT                   10678456..10678589,10678920..10678985,10684555..10684704,
FT                   10694871..10694917,10697843..>10697935))
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /product="suppressor of hairy wing homolog 3 (Drosophila),
FT                   transcript variant mCT192578"
FT                   /note="gene_id=mCG124943.1 transcript_id=mCT192578.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(10646946..10648608,10648724..10648760,
FT                   10652563..10652625,10653834..10653971,10655328..10655635,
FT                   10659225..10659356,10663487..10663633,10664261..10664361,
FT                   10664885..10665042,10669495..10669715,10672929..10673038,
FT                   10673170..10673334,10675171..10675276,10678456..10678589,
FT                   10678920..10678985,10684555..10684731,10694871..10694917,
FT                   10697843..>10697935))
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /product="suppressor of hairy wing homolog 3 (Drosophila),
FT                   transcript variant mCT192577"
FT                   /note="gene_id=mCG124943.1 transcript_id=mCT192577.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(10647934..10648608,10648724..10648760,
FT                   10648904..10649022,10652563..10652625,10653834..10653971,
FT                   10655328..10655635,10659225..10659356,10663487..10663633,
FT                   10664261..10664361,10664885..10665042,10669495..10669715,
FT                   10672929..10673038,10673170..10673334,10675171..10675276,
FT                   10678456..10678589,10678920..10678985,10684555..10684731,
FT                   10694871..10694917,10697843..10698308))
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /product="suppressor of hairy wing homolog 3 (Drosophila),
FT                   transcript variant mCT126195"
FT                   /note="gene_id=mCG124943.1 transcript_id=mCT126195.1
FT                   created on 06-JAN-2003"
FT   CDS             complement(join(10648593..10648608,10648724..10648760,
FT                   10648904..10649022,10652563..10652625,10653834..10653971,
FT                   10655328..10655635,10659225..10659356,10663487..10663633,
FT                   10664261..10664361,10664885..10665042,10669495..10669715,
FT                   10672929..10673038,10673170..10673334,10675171..10675276,
FT                   10678456..10678589,10678920..10678985,10684555..10684704,
FT                   10694871..10694917,10697843..>10697865))
FT                   /codon_start=1
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /product="suppressor of hairy wing homolog 3 (Drosophila),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG124943.1 transcript_id=mCT192578.0
FT                   protein_id=mCP113534.0 isoform=CRA_c"
FT                   /protein_id="EDL29081.1"
FT                   /translation="AQSQGPICWFFNLMDKDNSVQEKDNSKMAELFMECEEEELEPWQQ
FT                   KVEESQSKDDDDELIFVGEISSSKPAISNILNRCSPGSSSKGLKNGSFNPAISNIFKPT
FT                   SQHYRNPSSNALVALPSFHPALKSSESSDGQTVSKLDFTKTSPQEDSGACSVSQSDSTQ
FT                   DIPSSNILQPRTGVDQTLGLKHPSTSKVNSVNPKKPKTSASISETRPCSSSSSQTAPSG
FT                   ASSQTVLSNVNTSSVQSAPGSSSLRSCPKCNVKFRLLDPLKCHMKRCCPDMINKFLETL
FT                   KSENSKAVSKATTDSDKEKLIMLVSDFYYGRHEGTIEESQKTHTTFKCFSCTKVLKNNI
FT                   RFMNHMKHHLELEKQNNETWESHTTCQHCYRQYPNPFQLQCHIESTHTPHDFSTICKIC
FT                   ELSFETEHMLLQHMKDTHKPGEMPYICQVCQFRSSIFSDVETHFRSSHENTKNLLCPFC
FT                   LKVSRMATPYMNHYMRHQKKGIYRCPKCRLQFLTSKEKTEHKLEHRTFIKPKELEGLPP
FT                   GTKVIIRASLGSSQSRASSPPSSTIPSTSLQLSVPKSKSTTTKNNSKVSANKATTTSPQ
FT                   TVATTTGKPSASKPGTGTTKSKAKPSYKQKRQRTRKNKFSIDLKNLRCHQGSHMCIECR
FT                   SKIKDFSSHFSTHINCDFCKYTTNCNKAFTNHMSSHNDHPSKQLYIFKKQSRARRGITL
FT                   VCLKCDFLADTSGLDRMAKHLNQRKTHTCQVVIENVTERAVTSESASDGLFK"
FT   CDS             complement(join(10648593..10648608,10648724..10648760,
FT                   10648904..10649022,10652563..10652625,10653834..10653971,
FT                   10655328..10655635,10659225..10659356,10663487..10663633,
FT                   10664261..10664361,10664885..10665042,10669495..10669715,
FT                   10672929..10673038,10673170..10673334,10675171..10675276,
FT                   10678456..10678589,10678920..10678985,10684555..10684731,
FT                   10694871..10694901))
FT                   /codon_start=1
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /product="suppressor of hairy wing homolog 3 (Drosophila),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG124943.1 transcript_id=mCT126195.1
FT                   protein_id=mCP87715.1 isoform=CRA_a"
FT                   /protein_id="EDL29079.1"
FT                   /translation="MDKDNSVQEKGLFLSSWKLDNSKMAELFMECEEEELEPWQQKVEE
FT                   SQSKDDDDELIFVGEISSSKPAISNILNRCSPGSSSKGLKNGSFNPAISNIFKPTSQHY
FT                   RNPSSNALVALPSFHPALKSSESSDGQTVSKLDFTKTSPQEDSGACSVSQSDSTQDIPS
FT                   SNILQPRTGVDQTLGLKHPSTSKVNSVNPKKPKTSASISETRPCSSSSSQTAPSGASSQ
FT                   TVLSNVNTSSVQSAPGSSSLRSCPKCNVKFRLLDPLKCHMKRCCPDMINKFLETLKSEN
FT                   SKAVSKATTDSDKEKLIMLVSDFYYGRHEGTIEESQKTHTTFKCFSCTKVLKNNIRFMN
FT                   HMKHHLELEKQNNETWESHTTCQHCYRQYPNPFQLQCHIESTHTPHDFSTICKICELSF
FT                   ETEHMLLQHMKDTHKPGEMPYICQVCQFRSSIFSDVETHFRSSHENTKNLLCPFCLKVS
FT                   RMATPYMNHYMRHQKKGIYRCPKCRLQFLTSKEKTEHKLEHRTFIKPKELEGLPPGTKV
FT                   IIRASLGSSQSRASSPPSSTIPSTSLQLSVPKSKSTTTKNNSKVSANKATTTSPQTVAT
FT                   TTGKPSASKPGTGTTKSKAKPSYKQKRQRTRKNKFSIDLKNLRCHQGSHMCIECRSKIK
FT                   DFSSHFSTHINCDFCKYTTNCNKAFTNHMSSHNDHPSKQLYIFKKQSRARRGITLVCLK
FT                   CDFLADTSGLDRMAKHLNQRKTHTCQVVIENVTERAVTSESASDGLFK"
FT   CDS             complement(join(10648736..10648760,10652563..10652625,
FT                   10653834..10653971,10655328..10655635,10659225..10659356,
FT                   10663487..10663633,10664261..10664361,10664885..10665042,
FT                   10669495..10669715,10672929..10673038,10673170..10673334,
FT                   10675171..10675276,10678456..10678589,10678920..10678985,
FT                   10684555..10684731,10694871..10694917,10697843..>10697865))
FT                   /codon_start=1
FT                   /gene="Suhw3"
FT                   /locus_tag="mCG_124943"
FT                   /product="suppressor of hairy wing homolog 3 (Drosophila),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG124943.1 transcript_id=mCT192577.0
FT                   protein_id=mCP113533.0 isoform=CRA_b"
FT                   /protein_id="EDL29080.1"
FT                   /translation="AQSQGPICWFFNLMDKDNSVQEKGLFLSSWKLDNSKMAELFMECE
FT                   EEELEPWQQKVEESQSKDDDDELIFVGEISSSKPAISNILNRCSPGSSSKGLKNGSFNP
FT                   AISNIFKPTSQHYRNPSSNALVALPSFHPALKSSESSDGQTVSKLDFTKTSPQEDSGAC
FT                   SVSQSDSTQDIPSSNILQPRTGVDQTLGLKHPSTSKVNSVNPKKPKTSASISETRPCSS
FT                   SSSQTAPSGASSQTVLSNVNTSSVQSAPGSSSLRSCPKCNVKFRLLDPLKCHMKRCCPD
FT                   MINKFLETLKSENSKAVSKATTDSDKEKLIMLVSDFYYGRHEGTIEESQKTHTTFKCFS
FT                   CTKVLKNNIRFMNHMKHHLELEKQNNETWESHTTCQHCYRQYPNPFQLQCHIESTHTPH
FT                   DFSTICKICELSFETEHMLLQHMKDTHKPGEMPYICQVCQFRSSIFSDVETHFRSSHEN
FT                   TKNLLCPFCLKVSRMATPYMNHYMRHQKKGIYRCPKCRLQFLTSKEKTEHKLEHRTFIK
FT                   PKELEGLPPGTKVIIRASLGSSQSRASSPPSSTIPSTSLQLSVPKSKSTTTKNNSKVSA
FT                   NKATTTSPQTVATTTGKPSASKPGTGTTKSKAKPSYKQKRQRTRKNKFSIDLKNLRCHQ
FT                   GSHMCIECRSKIKDFSSHFSTHINCDFCKYTTNCNKAFTNHMSSHNDHPSKQLYIFKKQ
FT                   SRARSYRKSRNF"
FT   gap             10651556..10651575
FT                   /estimated_length=20
FT   gap             10662143..10662259
FT                   /estimated_length=117
FT   gap             10667515..10668263
FT                   /estimated_length=749
FT   gap             10670609..10671090
FT                   /estimated_length=482
FT   gap             10672571..10672590
FT                   /estimated_length=20
FT   gap             10674165..10674962
FT                   /estimated_length=798
FT   gap             10676470..10676791
FT                   /estimated_length=322
FT   gap             10698720..10702396
FT                   /estimated_length=3677
FT   gap             10704715..10705461
FT                   /estimated_length=747
FT   gap             10706908..10707986
FT                   /estimated_length=1079
FT   gap             10709690..10709709
FT                   /estimated_length=20
FT   gap             10713220..10713900
FT                   /estimated_length=681
FT   gap             10715217..10715236
FT                   /estimated_length=20
FT   gap             10719269..10720247
FT                   /estimated_length=979
FT   gap             10725323..10725342
FT                   /estimated_length=20
FT   gene            <10731357..10769853
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /note="gene_id=mCG10759.1"
FT   mRNA            join(<10731357..10731607,10731741..10731985,
FT                   10733378..10733422,10735918..10735965,10737035..10737128,
FT                   10738455..10738602,10742256..10742350,10745042..10745127,
FT                   10747763..10747858,10759442..10759566,10760876..10761011,
FT                   10768250..10768330,10769444..10769853)
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   brain), member 14, transcript variant mCT192573"
FT                   /note="gene_id=mCG10759.1 transcript_id=mCT192573.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<10731357..10731607,10731741..10731976,
FT                   10733378..10733422,10735918..10735965,10737035..10737128,
FT                   10738455..10738602,10742256..10742350,10745042..10745127,
FT                   10747763..10747858,10759442..10759566,10760876..10761011,
FT                   10768250..10768330,10769444..10769853)
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   brain), member 14, transcript variant mCT192574"
FT                   /note="gene_id=mCG10759.1 transcript_id=mCT192574.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(10731357..10731607,10731741..10731976,
FT                   10737035..10737128,10738455..10738602,10742256..10742350,
FT                   10745042..10745127,10747763..10747858,10759442..10759566,
FT                   10760876..10761011,10768250..10768330,10769444..10769853)
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   brain), member 14, transcript variant mCT10594"
FT                   /note="gene_id=mCG10759.1 transcript_id=mCT10594.1 created
FT                   on 16-DEC-2002"
FT   CDS             join(10731911..10731976,10737035..10737128,
FT                   10738455..10738602,10742256..10742350,10745042..10745127,
FT                   10747763..10747858,10759442..10759566,10760876..10761011,
FT                   10768250..10768330,10769444..10769485)
FT                   /codon_start=1
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   brain), member 14, isoform CRA_a"
FT                   /note="gene_id=mCG10759.1 transcript_id=mCT10594.1
FT                   protein_id=mCP19898.1 isoform=CRA_a"
FT                   /protein_id="EDL29082.1"
FT                   /translation="MGIFPGIILIFLRVKFATAAVIHQKSSTLSHEMSGLNWKPFVYGG
FT                   LASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGI
FT                   APALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLK
FT                   IRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHL
FT                   IVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTLDGIL
FT                   KMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI"
FT   CDS             join(<10735942..10735965,10737035..10737128,
FT                   10738455..10738602,10742256..10742350,10745042..10745127,
FT                   10747763..10747858,10759442..10759566,10760876..10761011,
FT                   10768250..10768330,10769444..10769485)
FT                   /codon_start=1
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   brain), member 14, isoform CRA_b"
FT                   /note="gene_id=mCG10759.1 transcript_id=mCT192573.0
FT                   protein_id=mCP113526.0 isoform=CRA_b"
FT                   /protein_id="EDL29083.1"
FT                   /translation="ITFPEPRLHQKSSTLSHEMSGLNWKPFVYGGLASIVAEFGTFPVD
FT                   LTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIK
FT                   IGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSM
FT                   IGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHF
FT                   VSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTLDGILKMWKHEGFFALYKG
FT                   FWPNWLRLGPWNIIFFITYEQLKRLQI"
FT   CDS             join(<10735942..10735965,10737035..10737128,
FT                   10738455..10738602,10742256..10742350,10745042..10745127,
FT                   10747763..10747858,10759442..10759566,10760876..10761011,
FT                   10768250..10768330,10769444..10769485)
FT                   /codon_start=1
FT                   /gene="Slc25a14"
FT                   /locus_tag="mCG_10759"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   brain), member 14, isoform CRA_b"
FT                   /note="gene_id=mCG10759.1 transcript_id=mCT192574.0
FT                   protein_id=mCP113527.0 isoform=CRA_b"
FT                   /protein_id="EDL29084.1"
FT                   /translation="ITFPEPRLHQKSSTLSHEMSGLNWKPFVYGGLASIVAEFGTFPVD
FT                   LTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIK
FT                   IGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSM
FT                   IGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHF
FT                   VSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTLDGILKMWKHEGFFALYKG
FT                   FWPNWLRLGPWNIIFFITYEQLKRLQI"
FT   gap             10737828..10738057
FT                   /estimated_length=230
FT   gap             10742123..10742142
FT                   /estimated_length=20
FT   gap             10743176..10743320
FT                   /estimated_length=145
FT   gap             10746317..10747407
FT                   /estimated_length=1091
FT   gap             10753263..10753367
FT                   /estimated_length=105
FT   gap             10760361..10760540
FT                   /estimated_length=180
FT   gap             10765324..10765343
FT                   /estimated_length=20
FT   gap             10788887..10788906
FT                   /estimated_length=20
FT   gene            10802520..10814966
FT                   /gene="Rbmx2"
FT                   /locus_tag="mCG_124947"
FT                   /note="gene_id=mCG124947.0"
FT   mRNA            join(10802520..10802638,10802838..10802862,
FT                   10804740..10804792,10810555..10810684,10813134..10813317,
FT                   10813820..10814966)
FT                   /gene="Rbmx2"
FT                   /locus_tag="mCG_124947"
FT                   /product="RNA binding motif protein, X-linked 2, transcript
FT                   variant mCT126199"
FT                   /note="gene_id=mCG124947.0 transcript_id=mCT126199.1
FT                   created on 06-JAN-2003"
FT   mRNA            join(<10802521..10802638,10810555..10810684,
FT                   10813134..10813317,10813820..10814963)
FT                   /gene="Rbmx2"
FT                   /locus_tag="mCG_124947"
FT                   /product="RNA binding motif protein, X-linked 2, transcript
FT                   variant mCT192582"
FT                   /note="gene_id=mCG124947.0 transcript_id=mCT192582.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<10802610..10802638,10810555..10810684,
FT                   10813134..10813317,10813820..10814313)
FT                   /codon_start=1
FT                   /gene="Rbmx2"
FT                   /locus_tag="mCG_124947"
FT                   /product="RNA binding motif protein, X-linked 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG124947.0 transcript_id=mCT192582.0
FT                   protein_id=mCP113535.0 isoform=CRA_b"
FT                   /protein_id="EDL29086.1"
FT                   /translation="SEPREDANMKYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTVLA
FT                   VDNFNGIKIKGRTIRVDHVSNYRAPQESEDVDDVTRELQEKGCGVKTPPSSPPEVSEDE
FT                   DAKLTKKHKKDKKEKKKRKKEKTEGQAQAEQPSCSRSATVKEKKDERASRKHSSKTSER
FT                   AQKSEHRESKKSHSGSPDGRSSYHARAEDPECKARKEKPKHEHKSASRREAEEKSRERE
FT                   RGRSSGTHSGRHRGHSDGRSHRSRSRSRSPDKSHRHKKYRHSRERDSYHGSDRRHH"
FT   CDS             join(10802634..10802638,10802838..10802862,
FT                   10804740..10804792,10810555..10810684,10813134..10813317,
FT                   10813820..10814313)
FT                   /codon_start=1
FT                   /gene="Rbmx2"
FT                   /locus_tag="mCG_124947"
FT                   /product="RNA binding motif protein, X-linked 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG124947.0 transcript_id=mCT126199.1
FT                   protein_id=mCP87587.1 isoform=CRA_a"
FT                   /protein_id="EDL29085.1"
FT                   /translation="MNPLTKVKLIGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGK
FT                   SKGFCFLCYEDQRSTVLAVDNFNGIKIKGRTIRVDHVSNYRAPQESEDVDDVTRELQEK
FT                   GCGVKTPPSSPPEVSEDEDAKLTKKHKKDKKEKKKRKKEKTEGQAQAEQPSCSRSATVK
FT                   EKKDERASRKHSSKTSERAQKSEHRESKKSHSGSPDGRSSYHARAEDPECKARKEKPKH
FT                   EHKSASRREAEEKSRERERGRSSGTHSGRHRGHSDGRSHRSRSRSRSPDKSHRHKKYRH
FT                   SRERDSYHGSDRRHH"
FT   gap             10802863..10802899
FT                   /estimated_length=37
FT   gap             10806329..10808373
FT                   /estimated_length=2045
FT   gap             10821151..10821458
FT                   /estimated_length=308
FT   gap             10842530..10868314
FT                   /estimated_length=25785
FT   gap             10869805..10869824
FT                   /estimated_length=20
FT   gap             10870940..10873981
FT                   /estimated_length=3042
FT   gap             10875092..10875111
FT                   /estimated_length=20
FT   gap             10893689..10893878
FT                   /estimated_length=190
FT   gap             10896026..10896387
FT                   /estimated_length=362
FT   gap             10923893..10923912
FT                   /estimated_length=20
FT   gap             10940436..10940965
FT                   /estimated_length=530
FT   gap             10942392..10942432
FT                   /estimated_length=41
FT   gap             10953505..10955224
FT                   /estimated_length=1720
FT   gap             10969132..10969151
FT                   /estimated_length=20
FT   gap             10971638..10972361
FT                   /estimated_length=724
FT   gap             10974519..10974538
FT                   /estimated_length=20
FT   gap             11006263..11006300
FT                   /estimated_length=38
FT   gap             11010599..11010618
FT                   /estimated_length=20
FT   gap             11012871..11012890
FT                   /estimated_length=20
FT   gap             11033759..11034070
FT                   /estimated_length=312
FT   gap             11038132..11038950
FT                   /estimated_length=819
FT   gap             11043352..11043530
FT                   /estimated_length=179
FT   gap             11046997..11047016
FT                   /estimated_length=20
FT   gap             11050276..11050295
FT                   /estimated_length=20
FT   gap             11055218..11056480
FT                   /estimated_length=1263
FT   gap             11057555..11057574
FT                   /estimated_length=20
FT   gap             11059674..11059693
FT                   /estimated_length=20
FT   gap             11064057..11064545
FT                   /estimated_length=489
FT   gap             11065711..11068608
FT                   /estimated_length=2898
FT   gap             11069860..11070088
FT                   /estimated_length=229
FT   gene            complement(11105112..>11384211)
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /note="gene_id=mCG115315.2"
FT   mRNA            complement(join(11105112..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117819..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175447,11264104..11264247,
FT                   11382813..11382872,11384125..>11384211))
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, transcript
FT                   variant mCT192585"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT192585.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(11105607..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117852..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175447,11264104..11264247,
FT                   11382824..11382872,11384069..>11384211))
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, transcript
FT                   variant mCT192586"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT192586.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(11106039..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117819..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175447,11382824..11382872,
FT                   11384069..11384184))
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, transcript
FT                   variant mCT177646"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT177646.0
FT                   created on 16-DEC-2002"
FT   mRNA            complement(join(11106039..11106224,11108087..11108172,
FT                   11113558..11113669,11117819..11117926,11119892..11120073,
FT                   11135155..11135269,11146529..11146635,11148506..11148718,
FT                   11151132..11151365,11156949..11157155,11164346..11164501,
FT                   11175313..11175447,11264104..11264247,11382824..11382872,
FT                   11384069..11384184))
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, transcript
FT                   variant mCT177647"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT177647.0
FT                   created on 16-DEC-2002"
FT   mRNA            complement(join(11106039..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117819..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175447,11264104..11264247,
FT                   11382824..11382872,11384069..11384184))
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, transcript
FT                   variant mCT116417"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT116417.1
FT                   created on 16-DEC-2002"
FT   CDS             complement(join(11106093..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117819..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175447,11264104..11264247,
FT                   11382813..11382872,11384125..>11384155))
FT                   /codon_start=1
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT192585.0
FT                   protein_id=mCP113531.0 isoform=CRA_c"
FT                   /protein_id="EDL29090.1"
FT                   /translation="GHSGSRNFRAGEPDLRSILGEHKEVWWYVPGLNQLPFDPANNNEP
FT                   LQFGSASGPLVPEGLIENGGESSKKRKRTNPPSADNTRTLNVDSAAMTLPVSDPAAWAT
FT                   AMNNLGMAPLGIAGQPILPDFDPALGMMTGIPPITPMMPGLGIVPPPIPPDMPVAKEII
FT                   HCKSCTLFPPNPNLPPPATRERPPGCKTVFVGGLPENGTEQIIVEVFEQCGEIIAIRKS
FT                   KKNFCHIRFAEEYMVDKALYLSGYRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQR
FT                   MLAREERHRRRMEEERMRPPSPPPVVHYSDHECSIVAEKLKDDSKFSEAVQTLLTWIER
FT                   GEVNRRSANHFYSMIQSANSHVRRLVNEKATHEKEMEEAKEKFKQALSGILIQFEQIVA
FT                   VYHSASKQKAWDHFTKAQRKNISVWCKQAEEIRNIHNDELMGIRREEEMEMSDDEIEET
FT                   TETKETEESALVSQAEALKEENDSLRWQLDAYRNEVELLKQEQGKAHREDDPNKEQQLK
FT                   LLQQALQGMQQHLLKVQEEYKKKEAELDRIKDDNLQVEQLLENFHEKQENCGSRLCASS
FT                   QEGEQPLEKTAVSNPVKSEREALLVGIISTFLHVHPFGASIEYICSYLNRLDNKASYQI
FT                   PSKLTTSPLLPISTSDVESLMSRLQHTFRQEMTGVGASLEKRWKFCGFEGLKLT"
FT   CDS             complement(join(11106093..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117852..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175447,11264104..11264247,
FT                   11382824..>11382857))
FT                   /codon_start=1
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT192586.0
FT                   protein_id=mCP113532.0 isoform=CRA_d"
FT                   /protein_id="EDL29091.1"
FT                   /translation="DQFLENTKKCGGLNQLPFDPANNNEPLQFGSASGPLVPEGLIENG
FT                   GESSKKRKRTNPPSADNTRTLNVDSAAMTLPVSDPAAWATAMNNLGMAPLGIAGQPILP
FT                   DFDPALGMMTGIPPITPMMPGLGIVPPPIPPDMPVAKEIIHCKSCTLFPPNPNLPPPAT
FT                   RERPPGCKTVFVGGLPENGTEQIIVEVFEQCGEIIAIRKSKKNFCHIRFAEEYMVDKAL
FT                   YLSGYRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEEERMRP
FT                   PSPPPVVHYSDHECSIVAEKLKDDSKFSEAVQTLLTWIERGEVNRRSANHFYSMIQSAN
FT                   SHVRRLVNEKATHEKEMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDHFTKAQR
FT                   KNISVWCKQAEEIRNIHNDELMGIRREEEMEMSDDEIEETTETKETEESALVSQAEALK
FT                   EENDSLRWQLDAYRNEVELLKQEQGKAHREDDPNKEQQLKLLQQALQGMQQHLLKVQEE
FT                   YKKKEAELDRIKDDNLQQENCGSRLCASSQEGEQPLEKTAVSNPVKSEREALLVGIIST
FT                   FLHVHPFGASIEYICSYLNRLDNKASYQIPSKLTTSPLLPISTSDVESLMSRLQHTFRQ
FT                   EMTGVGASLEKRWKFCGFEGLKLT"
FT   CDS             complement(join(11106093..11106224,11108087..11108172,
FT                   11113558..11113669,11117819..11117926,11119892..11120073,
FT                   11135155..11135269,11146529..11146635,11148506..11148718,
FT                   11151132..11151365,11156949..11157155,11164346..11164501,
FT                   11175313..11175409))
FT                   /codon_start=1
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT177647.0
FT                   protein_id=mCP100568.0 isoform=CRA_b"
FT                   /protein_id="EDL29089.1"
FT                   /translation="MTLPVSDPAAWATAMNNLGMAPLGIAGQPILPDFDPALGMMTGIP
FT                   PITPMMPGLGIVPPPIPPDMPVAKEIIHCKSCTLFPPNPNLPPPATRERPPGCKTVFVG
FT                   GLPENGTEQIIVEVFEQCGEIIAIRKSKKNFCHIRFAEEYMVDKALYLSGYRIRLGSST
FT                   DKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEEERMRPPSPPPVVHYSDHE
FT                   CSIVAEKLKDDSKFSEAVQTLLTWIERGEVNRRSANHFYSMIQSANSHVRRLVNEKATH
FT                   EKEMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDHFTKAQRKNISVWCKQAEEI
FT                   RNIHNDELMGIRREEEMEMSDDEIEETTETKETEESALVSQAEALKEENDSLRWQLDAY
FT                   RNEVELLKQEQGKAHREDDPNKEQQLKLLQQALQGMQQHLLKVQEEYKKKEAELDRIKD
FT                   DNLQVEQLLENFHEKQENCGSRLCASSQEGEQPLEKTAVSNPVKSEREALLVGIISTFL
FT                   HVHPFGASIEYICSYLNRLDNKISTSDVESLMSRLQHTFRQEMTGVGASLEKRWKFCGF
FT                   EGLKLT"
FT   CDS             complement(join(11106093..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117819..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175409))
FT                   /codon_start=1
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT116417.1
FT                   protein_id=mCP87588.1 isoform=CRA_a"
FT                   /protein_id="EDL29087.1"
FT                   /translation="MTLPVSDPAAWATAMNNLGMAPLGIAGQPILPDFDPALGMMTGIP
FT                   PITPMMPGLGIVPPPIPPDMPVAKEIIHCKSCTLFPPNPNLPPPATRERPPGCKTVFVG
FT                   GLPENGTEQIIVEVFEQCGEIIAIRKSKKNFCHIRFAEEYMVDKALYLSGYRIRLGSST
FT                   DKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEEERMRPPSPPPVVHYSDHE
FT                   CSIVAEKLKDDSKFSEAVQTLLTWIERGEVNRRSANHFYSMIQSANSHVRRLVNEKATH
FT                   EKEMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDHFTKAQRKNISVWCKQAEEI
FT                   RNIHNDELMGIRREEEMEMSDDEIEETTETKETEESALVSQAEALKEENDSLRWQLDAY
FT                   RNEVELLKQEQGKAHREDDPNKEQQLKLLQQALQGMQQHLLKVQEEYKKKEAELDRIKD
FT                   DNLQVEQLLENFHEKQENCGSRLCASSQEGEQPLEKTAVSNPVKSEREALLVGIISTFL
FT                   HVHPFGASIEYICSYLNRLDNKASYQIPSKLTTSPLLPISTSDVESLMSRLQHTFRQEM
FT                   TGVGASLEKRWKFCGFEGLKLT"
FT   CDS             complement(join(11106093..11106224,11107723..11107770,
FT                   11108087..11108172,11113558..11113669,11117819..11117926,
FT                   11119892..11120073,11135155..11135269,11146529..11146635,
FT                   11148506..11148718,11151132..11151365,11156949..11157155,
FT                   11164346..11164501,11175313..11175409))
FT                   /codon_start=1
FT                   /gene="Cova1"
FT                   /locus_tag="mCG_115315"
FT                   /product="cytosolic ovarian carcinoma antigen 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG115315.2 transcript_id=mCT177646.0
FT                   protein_id=mCP100569.0 isoform=CRA_a"
FT                   /protein_id="EDL29088.1"
FT                   /translation="MTLPVSDPAAWATAMNNLGMAPLGIAGQPILPDFDPALGMMTGIP
FT                   PITPMMPGLGIVPPPIPPDMPVAKEIIHCKSCTLFPPNPNLPPPATRERPPGCKTVFVG
FT                   GLPENGTEQIIVEVFEQCGEIIAIRKSKKNFCHIRFAEEYMVDKALYLSGYRIRLGSST
FT                   DKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEEERMRPPSPPPVVHYSDHE
FT                   CSIVAEKLKDDSKFSEAVQTLLTWIERGEVNRRSANHFYSMIQSANSHVRRLVNEKATH
FT                   EKEMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDHFTKAQRKNISVWCKQAEEI
FT                   RNIHNDELMGIRREEEMEMSDDEIEETTETKETEESALVSQAEALKEENDSLRWQLDAY
FT                   RNEVELLKQEQGKAHREDDPNKEQQLKLLQQALQGMQQHLLKVQEEYKKKEAELDRIKD
FT                   DNLQVEQLLENFHEKQENCGSRLCASSQEGEQPLEKTAVSNPVKSEREALLVGIISTFL
FT                   HVHPFGASIEYICSYLNRLDNKASYQIPSKLTTSPLLPISTSDVESLMSRLQHTFRQEM
FT                   TGVGASLEKRWKFCGFEGLKLT"
FT   gap             11112664..11112791
FT                   /estimated_length=128
FT   gap             11113933..11114085
FT                   /estimated_length=153
FT   gap             11127621..11127640
FT                   /estimated_length=20
FT   gap             11139251..11139372
FT                   /estimated_length=122
FT   gap             11141171..11141190
FT                   /estimated_length=20
FT   gap             11158541..11158823
FT                   /estimated_length=283
FT   gap             11209407..11209463
FT                   /estimated_length=57
FT   gap             11215253..11215272
FT                   /estimated_length=20
FT   gap             11217390..11217409
FT                   /estimated_length=20
FT   gap             11229652..11229991
FT                   /estimated_length=340
FT   gap             11231228..11232039
FT                   /estimated_length=812
FT   gap             11237770..11237789
FT                   /estimated_length=20
FT   gap             11262943..11262962
FT                   /estimated_length=20
FT   gap             11267181..11267309
FT                   /estimated_length=129
FT   gap             11271812..11271831
FT                   /estimated_length=20
FT   gap             11273638..11273833
FT                   /estimated_length=196
FT   gap             11295460..11295479
FT                   /estimated_length=20
FT   gap             11296493..11296612
FT                   /estimated_length=120
FT   gap             11299864..11299883
FT                   /estimated_length=20
FT   gap             11302655..11304332
FT                   /estimated_length=1678
FT   gap             11337595..11338485
FT                   /estimated_length=891
FT   gap             11343721..11344067
FT                   /estimated_length=347
FT   gap             11373002..11374111
FT                   /estimated_length=1110
FT   gap             11388286..11388305
FT                   /estimated_length=20
FT   gap             11389939..11389966
FT                   /estimated_length=28
FT   gap             11399571..11399973
FT                   /estimated_length=403
FT   gap             11401534..11401553
FT                   /estimated_length=20
FT   gap             11406201..11406220
FT                   /estimated_length=20
FT   gap             11408729..11408748
FT                   /estimated_length=20
FT   gap             11411819..11411922
FT                   /estimated_length=104
FT   gap             11412611..11413159
FT                   /estimated_length=549
FT   gap             11415793..11416614
FT                   /estimated_length=822
FT   gene            complement(11420644..>11516421)
FT                   /locus_tag="mCG_1041086"
FT                   /note="gene_id=mCG1041086.1"
FT   mRNA            complement(join(11420644..11421462,11429313..11429448,
FT                   11436712..11436850,11516262..>11516421))
FT                   /locus_tag="mCG_1041086"
FT                   /product="mCG1041086"
FT                   /note="gene_id=mCG1041086.1 transcript_id=mCT158790.1
FT                   created on 29-JAN-2003"
FT   CDS             complement(11420724..>11420942)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041086"
FT                   /product="mCG1041086"
FT                   /note="gene_id=mCG1041086.1 transcript_id=mCT158790.1
FT                   protein_id=mCP87644.0"
FT                   /protein_id="EDL29092.1"
FT                   /translation="TTNQRVHMEGPSGSSCICSRGLPSRSSMGGKALGPVKVLCLSIGE
FT                   CRGQEAGVGGLGNRGRGEMVGDFWRGN"
FT   gap             11453482..11453501
FT                   /estimated_length=20
FT   gap             11468305..11468324
FT                   /estimated_length=20
FT   gap             11468713..11468732
FT                   /estimated_length=20
FT   gap             11482244..11483236
FT                   /estimated_length=993
FT   gap             11486648..11486676
FT                   /estimated_length=29
FT   gap             11497555..11500215
FT                   /estimated_length=2661
FT   gap             11507131..11507150
FT                   /estimated_length=20
FT   gap             11509030..11509418
FT                   /estimated_length=389
FT   gap             11512610..11512840
FT                   /estimated_length=231
FT   gap             11535545..11535564
FT                   /estimated_length=20
FT   gene            11539097..>11567696
FT                   /locus_tag="mCG_115314"
FT                   /note="gene_id=mCG115314.1"
FT   mRNA            join(11539097..11539201,11562123..11562281,
FT                   11563569..11563634,11564173..11564408,11564603..11564795,
FT                   11565036..11565091,11565379..11565529,11566023..11566181,
FT                   11566321..11566490,11566676..11566773,11566896..11567002,
FT                   11567305..>11567696)
FT                   /locus_tag="mCG_115314"
FT                   /product="mCG115314"
FT                   /note="gene_id=mCG115314.1 transcript_id=mCT116416.1
FT                   created on 07-JAN-2003"
FT   CDS             join(11539144..11539201,11562123..11562281,
FT                   11563569..11563634,11564173..11564408,11564603..11564795,
FT                   11565036..11565091,11565379..11565529,11566023..11566181,
FT                   11566321..11566490,11566676..11566773,11566896..11567002,
FT                   11567305..11567696)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115314"
FT                   /product="mCG115314"
FT                   /note="gene_id=mCG115314.1 transcript_id=mCT116416.1
FT                   protein_id=mCP87585.1"
FT                   /protein_id="EDL29093.1"
FT                   /translation="MAWMLDCLFASAFEPRPRRVSVLGGAPGQNSDRSMDMVSIHSLSE
FT                   LERLKLQETAYHELVARHFLSEFKPDRALPTDRPNTLEKWFLMLRGQDRAASLKTFGIR
FT                   LEEVLVNELTRRKQRELTPTMQVEDINGSTGRRRRGNVVQRMLGRMRRFFSRRRNEPTL
FT                   PREFTRRGRRGAVSADSADELENGALLLQILQLSQLSSPIGQRLLGSKRKMSLNPIAQQ
FT                   IPQIVETCCKFIEKHGLSSVGIFTIEYSLRRVLELRELFDKGLDIVLDDSVNVHDVAEL
FT                   LKEFFREMKDPLLPDDLYMSFLLTATLKPKDQVSALQLLVYLMPPCHSDTLERLLKALH
FT                   KITENCEDSIGIDGQLVKNCNRMTSTNLALVFGTALLKKGKLANKESRKTKLGIDHYVA
FT                   SVNVVRAMIDNWDILFQVPPHIQKEVAKRVWKSSPEALDFIRRRNLRKIQSARIKMEED
FT                   ALLSDPVENSAEAQAAILAQSQPFDEDDLPPLEDILELDEIPELMETPNFEELPYFHVI
FT                   SDPEGAPDVHEVLNDNLNYDFEDESDFEDQDHLDLAEVPYLDVIPNNEDTDSDADEIPG
FT                   NDEAPVIYGMPDNVNAPNNDEPQDSEVVPNLEEIPAAD"
FT   gap             11540507..11540526
FT                   /estimated_length=20
FT   gap             11542062..11542373
FT                   /estimated_length=312
FT   gap             11545786..11545888
FT                   /estimated_length=103
FT   gap             11563351..11563486
FT                   /estimated_length=136
FT   gap             11583176..11583195
FT                   /estimated_length=20
FT   gap             11586344..11587452
FT                   /estimated_length=1109
FT   gap             11589380..11589399
FT                   /estimated_length=20
FT   gap             11605462..11605922
FT                   /estimated_length=461
FT   gap             11625052..11625071
FT                   /estimated_length=20
FT   gap             11635014..11635063
FT                   /estimated_length=50
FT   gap             11643727..11643746
FT                   /estimated_length=20
FT   gap             11650320..11650500
FT                   /estimated_length=181
FT   gap             11688337..11688469
FT                   /estimated_length=133
FT   gap             11695251..11695899
FT                   /estimated_length=649
FT   gap             11704156..11705176
FT                   /estimated_length=1021
FT   gap             11713089..11713108
FT                   /estimated_length=20
FT   gap             11714202..11715795
FT                   /estimated_length=1594
FT   gap             11717563..11717654
FT                   /estimated_length=92
FT   gap             11719377..11719396
FT                   /estimated_length=20
FT   gap             11731369..11731488
FT                   /estimated_length=120
FT   gap             11747687..11758348
FT                   /estimated_length=10662
FT   gap             11759790..11759809
FT                   /estimated_length=20
FT   gap             11771806..11771825
FT                   /estimated_length=20
FT   gap             11784055..11784479
FT                   /estimated_length=425
FT   gap             11787329..11787469
FT                   /estimated_length=141
FT   gap             11789675..11790549
FT                   /estimated_length=875
FT   gap             11792693..11794149
FT                   /estimated_length=1457
FT   gap             11812653..11812749
FT                   /estimated_length=97
FT   gap             11815397..11815443
FT                   /estimated_length=47
FT   gene            complement(11822905..11838112)
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /note="gene_id=mCG8123.4"
FT   mRNA            complement(join(11822905..11823318,11823466..11823589,
FT                   11823978..11824256,11824388..11824675,11824872..11825159,
FT                   11825338..11825625,11826354..11826641,11827225..11827503,
FT                   11827724..11828014,11828399..11828431,11828514..11828584,
FT                   11830456..11830576,11830889..11831140,11831661..11831954,
FT                   11832189..11832473,11834278..11834565,11834866..11835147,
FT                   11835497..11835523,11835653..11835781,11838012..11838112))
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /product="immunoglobulin superfamily, member 1, transcript
FT                   variant mCT192581"
FT                   /note="gene_id=mCG8123.4 transcript_id=mCT192581.1 created
FT                   on 22-APR-2004"
FT   CDS             complement(join(11823183..11823318,11823466..11823589,
FT                   11823978..11824256,11824388..11824675,11824872..11825159,
FT                   11825338..11825625,11826354..11826641,11827225..11827503,
FT                   11827724..11828014,11828399..11828431,11828514..11828584,
FT                   11830456..11830576,11830889..11831140,11831661..11831954,
FT                   11832189..11832473,11834278..11834565,11834866..11835147,
FT                   11835497..11835523,11835653..11835692))
FT                   /codon_start=1
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /product="immunoglobulin superfamily, member 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG8123.4 transcript_id=mCT192581.1
FT                   protein_id=mCP113545.1 isoform=CRA_a"
FT                   /protein_id="EDL29094.1"
FT                   /translation="MMLRTFTLLLLCIWLNPGMTSLAVESQPELWIESNYPQAPWENIT
FT                   LWCKSPSRVSSKFLLLKDNSQMTWIRPPYKTFQVSFFIGALTESNTGLYRCCYWKEKGW
FT                   SKPSKILELEAPGQLPKPIFWIQAETPPLPGCNVNIFCHGWLQDLVFMLFKEGYTEPVD
FT                   YQVPTGTMAIFSIDNLAPENEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTA
FT                   HPGPILAPGESLSLRCQGPIYGMTFALMRLEDLKKSFYHKKPIKNEAYFYFQDLKIQDT
FT                   GHYLCFYYDGSYRGSLLSDILKIWVTDTFPKTWLLVQPSPVIQMGQNVSLRCGGLMDGV
FT                   GLALYKKGEEKPLQFLDASSNTGNNSFFLKNVTYRDAGIYSCHYYLTWKTSIKMATYNT
FT                   VELMVVAWPSSVFKVGKTITLQCRVSHPVLEFSLEWEERTTFQKFSVDGDFLITDIEGQ
FT                   GTGTYSCSYRIEAHPNTWSHRSKPLKLVGPAGFLTWNSILNEAVRVSLTMQLASLLLLV
FT                   VWIRWKCRRLRLREAWLLGTAQGVAMLFILMALLCCGLCNGALTEEIEIVMPTPKPELW
FT                   AETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTHSH
FT                   TGSYHCHSWEEMAVSEPSEALELVGTDILPKPVISASLPIRGQELQIRCKGWLEGLGFA
FT                   LYKKGEQEPVQQLGAVGREAFFTIQRMEDKDEGNYSCRTHTEMQPFKWSEPSEPLELVI
FT                   KEMYPKPFFKTWASPVVTPGSRVTFNCSTSHEHMSFILYKDGNEIASSDLAWGNPGGST
FT                   AHFLIISVGIGDGGNYSCRYYDFSIWSEPSNPVELVVTEFYPKPTLLAQPGPVVLPGKN
FT                   VTLRCQGIFQGMRFALLQEGTHTPLQFQSTSGTSADFLLHTVGAQDFGNYSCVYYETTM
FT                   SNRGSSLSTPLMIWVTDTFPRPWLSAEPSSVVTMGQNVTLWCQGPVRGVGYILHKEGEA
FT                   TSMQLWGSTSNEGAFPIINISGASIGRYSCCYHPDWMSPIKIQPSNTLELIVTGLLPKP
FT                   SLLVQPGPMVAPGENVTLQCQGELPDSTFVLLKEGTRQPLEQQRPSGYRADFWMPVVRD
FT                   QDSGVYSCVYYLDSAPLVASNHSNSLEIWVTDKPPKPSLSAWPSTIFKLGKDITLQCRG
FT                   PLPGVEFVLEHDGEEAPQQFSEDGDFVIDNLEGKGIGNYSCSYRLQAYPDIWSEPSDTL
FT                   ELVGAAGPVAQECTVGNIVRSTLIVVVVVALGIVLAVEWKKWPRLRTRGSETDGRDQTV
FT                   VLEECNQEGEPGTTTNSPSSASQEVSVELTVPI"
FT   mRNA            complement(join(11826715..11826918,11827225..11827503,
FT                   11827724..11828014,11828399..11828431,11828514..11828584,
FT                   11830456..11830576,11830889..11831140,11831661..11831954,
FT                   11832189..11832473,11834278..11834565,11834866..11835147,
FT                   11835497..11835523,11835653..11835781,11838012..11838112))
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /product="immunoglobulin superfamily, member 1, transcript
FT                   variant mCT7741"
FT                   /note="gene_id=mCG8123.4 transcript_id=mCT7741.3 created on
FT                   22-APR-2004"
FT   CDS             complement(join(11826893..11826918,11827225..11827503,
FT                   11827724..11828014,11828399..11828431,11828514..11828584,
FT                   11830456..11830576,11830889..11831140,11831661..11831954,
FT                   11832189..11832473,11834278..11834565,11834866..11835147,
FT                   11835497..11835523,11835653..11835692))
FT                   /codon_start=1
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /product="immunoglobulin superfamily, member 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG8123.4 transcript_id=mCT7741.3
FT                   protein_id=mCP23083.3 isoform=CRA_c"
FT                   /protein_id="EDL29096.1"
FT                   /translation="MMLRTFTLLLLCIWLNPGMTSLAVESQPELWIESNYPQAPWENIT
FT                   LWCKSPSRVSSKFLLLKDNSQMTWIRPPYKTFQVSFFIGALTESNTGLYRCCYWKEKGW
FT                   SKPSKILELEAPGQLPKPIFWIQAETPPLPGCNVNIFCHGWLQDLVFMLFKEGYTEPVD
FT                   YQVPTGTMAIFSIDNLAPENEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTA
FT                   HPGPILAPGESLSLRCQGPIYGMTFALMRLEDLKKSFYHKKPIKNEAYFYFQDLKIQDT
FT                   GHYLCFYYDGSYRGSLLSDILKIWVTDTFPKTWLLVQPSPVIQMGQNVSLRCGGLMDGV
FT                   GLALYKKGEEKPLQFLDASSNTGNNSFFLKNVTYRDAGIYSCHYYLTWKTSIKMATYNT
FT                   VELMVVAWPSSVFKVGKTITLQCRVSHPVLEFSLEWEERTTFQKFSVDGDFLITDIEGQ
FT                   GTGTYSCSYRIEAHPNTWSHRSKPLKLVGPAGFLTWNSILNEAVRVSLTMQLASLLLLV
FT                   VWIRWKCRRLRLREAWLLGTAQGVAMLFILMALLCCGLCNGALTEEIEIVMPTPKPELW
FT                   AETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTHSH
FT                   TGSYHCHSWEEMAVSEPSEALELVGTDILPKPVISASLPIRGQELQIRCKGWLEGLGFA
FT                   LYKKGEQEPVQQLGAVGREAFFTIQRMEDKDEGNYSCRTHTEMQPFKWSEPSEPLELVI
FT                   KDGRTKAQN"
FT   mRNA            complement(join(11833341..11834565,11834866..11835147,
FT                   11835497..11835523,11835653..11835781,11838012..11838112))
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /product="immunoglobulin superfamily, member 1, transcript
FT                   variant mCT194324"
FT                   /note="gene_id=mCG8123.4 transcript_id=mCT194324.0 created
FT                   on 22-APR-2004"
FT   CDS             complement(join(11834216..11834565,11834866..11835147,
FT                   11835497..11835523,11835653..11835692))
FT                   /codon_start=1
FT                   /gene="Igsf1"
FT                   /locus_tag="mCG_8123"
FT                   /product="immunoglobulin superfamily, member 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG8123.4 transcript_id=mCT194324.0
FT                   protein_id=mCP115353.0 isoform=CRA_b"
FT                   /protein_id="EDL29095.1"
FT                   /translation="MMLRTFTLLLLCIWLNPGMTSLAVESQPELWIESNYPQAPWENIT
FT                   LWCKSPSRVSSKFLLLKDNSQMTWIRPPYKTFQVSFFIGALTESNTGLYRCCYWKEKGW
FT                   SKPSKILELEAPGQLPKPIFWIQAETPPLPGCNVNIFCHGWLQDLVFMLFKEGYTEPVD
FT                   YQVPTGTMAIFSIDNLAPENEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGHGCWHL
FT                   TIVIPGIMAG"
FT   gap             11835924..11835943
FT                   /estimated_length=20
FT   gap             11844015..11844558
FT                   /estimated_length=544
FT   gap             11845448..11846342
FT                   /estimated_length=895
FT   gap             11864418..11864437
FT                   /estimated_length=20
FT   gap             11870523..11871210
FT                   /estimated_length=688
FT   gap             11874687..11874760
FT                   /estimated_length=74
FT   gap             11895415..11895434
FT                   /estimated_length=20
FT   gap             11906559..11906578
FT                   /estimated_length=20
FT   gap             11914627..11914646
FT                   /estimated_length=20
FT   gap             11941836..11941930
FT                   /estimated_length=95
FT   gap             11945459..11945739
FT                   /estimated_length=281
FT   gap             11947680..11947777
FT                   /estimated_length=98
FT   gap             11975874..11976056
FT                   /estimated_length=183
FT   gap             11986200..11987125
FT                   /estimated_length=926
FT   gap             11994686..11997169
FT                   /estimated_length=2484
FT   gap             12007070..12009846
FT                   /estimated_length=2777
FT   gap             12013062..12013081
FT                   /estimated_length=20
FT   gap             12015762..12015781
FT                   /estimated_length=20
FT   gap             12021404..12022488
FT                   /estimated_length=1085
FT   gap             12024440..12024783
FT                   /estimated_length=344
FT   gap             12027949..12028101
FT                   /estimated_length=153
FT   gap             12040004..12046466
FT                   /estimated_length=6463
FT   gap             12057739..12057758
FT                   /estimated_length=20
FT   gap             12071328..12071440
FT                   /estimated_length=113
FT   gap             12075984..12076003
FT                   /estimated_length=20
FT   gap             12079845..12080281
FT                   /estimated_length=437
FT   gap             12080920..12081171
FT                   /estimated_length=252
FT   gap             12091322..12091341
FT                   /estimated_length=20
FT   gap             12096784..12098995
FT                   /estimated_length=2212
FT   gap             12100880..12101394
FT                   /estimated_length=515
FT   gap             12103699..12103718
FT                   /estimated_length=20
FT   gap             12105046..12107040
FT                   /estimated_length=1995
FT   gap             12113460..12113479
FT                   /estimated_length=20
FT   gap             12122717..12134684
FT                   /estimated_length=11968
FT   gap             12138164..12138183
FT                   /estimated_length=20
FT   gap             12140691..12140728
FT                   /estimated_length=38
FT   gap             12146736..12147148
FT                   /estimated_length=413
FT   gap             12152187..12152440
FT                   /estimated_length=254
FT   gap             12157401..12157955
FT                   /estimated_length=555
FT   gap             12159787..12159806
FT                   /estimated_length=20
FT   gap             12169519..12169621
FT                   /estimated_length=103
FT   gap             12173323..12173482
FT                   /estimated_length=160
FT   gap             12185043..12185062
FT                   /estimated_length=20
FT   gap             12200478..12205291
FT                   /estimated_length=4814
FT   gap             12212981..12214324
FT                   /estimated_length=1344
FT   gap             12222816..12225700
FT                   /estimated_length=2885
FT   gap             12233445..12233464
FT                   /estimated_length=20
FT   gap             12242674..12242693
FT                   /estimated_length=20
FT   gap             12244907..12246230
FT                   /estimated_length=1324
FT   gap             12247245..12248359
FT                   /estimated_length=1115
FT   gap             12250121..12250140
FT                   /estimated_length=20
FT   gap             12252456..12252475
FT                   /estimated_length=20
FT   gap             12254444..12259163
FT                   /estimated_length=4720
FT   gap             12276304..12276323
FT                   /estimated_length=20
FT   gap             12277719..12278551
FT                   /estimated_length=833
FT   gap             12286044..12286075
FT                   /estimated_length=32
FT   gap             12287495..12287514
FT                   /estimated_length=20
FT   gap             12292714..12293158
FT                   /estimated_length=445
FT   gap             12300985..12302413
FT                   /estimated_length=1429
FT   gap             12304227..12304817
FT                   /estimated_length=591
FT   gap             12312035..12312348
FT                   /estimated_length=314
FT   gap             12315520..12315539
FT                   /estimated_length=20
FT   gap             12320079..12320098
FT                   /estimated_length=20
FT   gap             12361183..12361202
FT                   /estimated_length=20
FT   gap             12367435..12367555
FT                   /estimated_length=121
FT   gap             12379993..12385130
FT                   /estimated_length=5138
FT   gap             12388615..12388634
FT                   /estimated_length=20
FT   gap             12391713..12392585
FT                   /estimated_length=873
FT   gap             12395379..12395398
FT                   /estimated_length=20
FT   gap             12412504..12412659
FT                   /estimated_length=156
FT   gap             12416941..12417002
FT                   /estimated_length=62
FT   gap             12421176..12424848
FT                   /estimated_length=3673
FT   gap             12431414..12431947
FT                   /estimated_length=534
FT   gap             12432446..12433193
FT                   /estimated_length=748
FT   gap             12438428..12438796
FT                   /estimated_length=369
FT   gap             12440711..12443138
FT                   /estimated_length=2428
FT   gap             12443872..12445404
FT                   /estimated_length=1533
FT   gap             12447902..12448016
FT                   /estimated_length=115
FT   gap             12449432..12449451
FT                   /estimated_length=20
FT   gap             12459680..12459699
FT                   /estimated_length=20
FT   gap             12482852..12482871
FT                   /estimated_length=20
FT   gap             12488363..12488382
FT                   /estimated_length=20
FT   gap             12510136..12510173
FT                   /estimated_length=38
FT   gap             12528568..12532390
FT                   /estimated_length=3823
FT   gap             12533250..12533754
FT                   /estimated_length=505
FT   gap             12534920..12535460
FT                   /estimated_length=541
FT   gap             12537235..12537491
FT                   /estimated_length=257
FT   gap             12538997..12539016
FT                   /estimated_length=20
FT   gap             12540673..12544562
FT                   /estimated_length=3890
FT   gap             12546542..12546561
FT                   /estimated_length=20
FT   gap             12552946..12553388
FT                   /estimated_length=443
FT   gap             12558181..12558275
FT                   /estimated_length=95
FT   gap             12562489..12562508
FT                   /estimated_length=20
FT   gap             12574348..12575078
FT                   /estimated_length=731
FT   gap             12578269..12578288
FT                   /estimated_length=20
FT   gene            complement(12582147..>12610093)
FT                   /locus_tag="mCG_66666"
FT                   /note="gene_id=mCG66666.2"
FT   mRNA            complement(join(12582147..12582325,12584631..12584784,
FT                   12589077..12589351,12590783..12590937,12593510..12593663,
FT                   12595247..12595534,12610064..>12610093))
FT                   /locus_tag="mCG_66666"
FT                   /product="mCG66666"
FT                   /note="gene_id=mCG66666.2 transcript_id=mCT66849.2 created
FT                   on 29-JAN-2003"
FT   gap             12590490..12590523
FT                   /estimated_length=34
FT   CDS             complement(join(12590788..12590937,12593510..>12593620))
FT                   /codon_start=1
FT                   /locus_tag="mCG_66666"
FT                   /product="mCG66666"
FT                   /note="gene_id=mCG66666.2 transcript_id=mCT66849.2
FT                   protein_id=mCP33906.1"
FT                   /protein_id="EDL29097.1"
FT                   /translation="DIRSKYWRPVLLDPDGSHAGLDHGLHTLLPRRRGVRKNRPLGFAA
FT                   QDPSSLRHQEQALEAGCCWTQMGAMQDLTMACTHFFPGEGE"
FT   gap             12614615..12614634
FT                   /estimated_length=20
FT   gap             12624334..12624353
FT                   /estimated_length=20
FT   gap             12630173..12630192
FT                   /estimated_length=20
FT   gap             12635406..12635960
FT                   /estimated_length=555
FT   gap             12642186..12642224
FT                   /estimated_length=39
FT   gap             12649021..12651260
FT                   /estimated_length=2240
FT   gap             12664859..12664892
FT                   /estimated_length=34
FT   gap             12665518..12665537
FT                   /estimated_length=20
FT   gap             12672654..12672673
FT                   /estimated_length=20
FT   gap             12673964..12674411
FT                   /estimated_length=448
FT   gap             12678760..12678843
FT                   /estimated_length=84
FT   gap             12683181..12683329
FT                   /estimated_length=149
FT   gap             12688361..12688400
FT                   /estimated_length=40
FT   gap             12691845..12691864
FT                   /estimated_length=20
FT   gap             12710278..12710297
FT                   /estimated_length=20
FT   gap             12752897..12754328
FT                   /estimated_length=1432
FT   gap             12774834..12775157
FT                   /estimated_length=324
FT   gap             12776708..12778290
FT                   /estimated_length=1583
FT   gap             12796778..12796797
FT                   /estimated_length=20
FT   gap             12825685..12825704
FT                   /estimated_length=20
FT   gap             12826944..12827767
FT                   /estimated_length=824
FT   gap             12833405..12833874
FT                   /estimated_length=470
FT   gap             12835613..12839623
FT                   /estimated_length=4011
FT   gap             12857687..12857865
FT                   /estimated_length=179
FT   gap             12862697..12862716
FT                   /estimated_length=20
FT   gene            12862718..12914720
FT                   /gene="2610018G03Rik"
FT                   /locus_tag="mCG_8120"
FT                   /note="gene_id=mCG8120.2"
FT   mRNA            join(12862718..12862843,12862976..12863132,
FT                   12891543..12891763,12901004..12901070,12907114..12907222,
FT                   12907312..12907427,12908270..12908455,12909480..12909628,
FT                   12910635..12910728,12911308..12911370,12911452..12911588,
FT                   12912919..12914720)
FT                   /gene="2610018G03Rik"
FT                   /locus_tag="mCG_8120"
FT                   /product="RIKEN cDNA 2610018G03, transcript variant
FT                   mCT7738"
FT                   /note="gene_id=mCG8120.2 transcript_id=mCT7738.2 created on
FT                   16-DEC-2002"
FT   mRNA            join(12862734..12862844,12862976..12863132,
FT                   12901014..12901070,12907114..12907222,12907312..12907427,
FT                   12908270..12908455,12909480..12909628,12910635..12910728,
FT                   12911308..12911370,12911452..12911588,12912919..12913467)
FT                   /gene="2610018G03Rik"
FT                   /locus_tag="mCG_8120"
FT                   /product="RIKEN cDNA 2610018G03, transcript variant
FT                   mCT177734"
FT                   /note="gene_id=mCG8120.2 transcript_id=mCT177734.0 created
FT                   on 16-DEC-2002"
FT   CDS             join(12863091..12863132,12891543..12891763,
FT                   12901004..12901070,12907114..12907222,12907312..12907427,
FT                   12908270..12908455,12909480..12909628,12910635..12910728,
FT                   12911308..12911370,12911452..12911588,12912919..12912943)
FT                   /codon_start=1
FT                   /gene="2610018G03Rik"
FT                   /locus_tag="mCG_8120"
FT                   /product="RIKEN cDNA 2610018G03, isoform CRA_b"
FT                   /note="gene_id=mCG8120.2 transcript_id=mCT7738.2
FT                   protein_id=mCP20516.2 isoform=CRA_b"
FT                   /protein_id="EDL29099.1"
FT                   /translation="MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNR
FT                   TQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSCLQGSKLWIIMEYLGG
FT                   GSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADF
FT                   GVAGQLTDTQIKRNTFVGTPFWADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNP
FT                   PTLIGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWK
FT                   AEGHSDEESDSEGSDSESSSRESNPHPEWSFTTVRKKPDPKKLQNGEEQDLVQTLSCLS
FT                   MIITPAFAELKQQDENNASRNQAIEELEKSIAVAETACPGITDKMVKKLIEKFQKCSAD
FT                   ESP"
FT   CDS             join(12863091..12863132,12901014..12901070,
FT                   12907114..12907222,12907312..12907427,12908270..12908455,
FT                   12909480..12909628,12910635..12910728,12911308..12911370,
FT                   12911452..12911588,12912919..12912943)
FT                   /codon_start=1
FT                   /gene="2610018G03Rik"
FT                   /locus_tag="mCG_8120"
FT                   /product="RIKEN cDNA 2610018G03, isoform CRA_a"
FT                   /note="gene_id=mCG8120.2 transcript_id=mCT177734.0
FT                   protein_id=mCP100656.0 isoform=CRA_a"
FT                   /protein_id="EDL29098.1"
FT                   /translation="MAHSPVAVQVPGMQGSKLWIIMEYLGGGSALDLLRAGPFDEFQIA
FT                   TMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVG
FT                   TPFWADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLIGDFTKSFKEFIDAC
FT                   LNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDEESDSEGSDSES
FT                   SSRESNPHPEWSFTTVRKKPDPKKLQNGEEQDLVQTLSCLSMIITPAFAELKQQDENNA
FT                   SRNQAIEELEKSIAVAETACPGITDKMVKKLIEKFQKCSADESP"
FT   gap             12882419..12882453
FT                   /estimated_length=35
FT   gap             12887677..12887696
FT                   /estimated_length=20
FT   gap             12891769..12891788
FT                   /estimated_length=20
FT   gap             12892418..12894072
FT                   /estimated_length=1655
FT   gap             12895591..12895610
FT                   /estimated_length=20
FT   gap             12907428..12907579
FT                   /estimated_length=152
FT   gene            complement(12916592..>12931388)
FT                   /locus_tag="mCG_63011"
FT                   /note="gene_id=mCG63011.2"
FT   mRNA            complement(join(12916592..12917863,12919065..12919140,
FT                   12919259..12919327,12920563..12920726,12923243..12923390,
FT                   12923559..12923673,12931367..>12931388))
FT                   /locus_tag="mCG_63011"
FT                   /product="mCG63011"
FT                   /note="gene_id=mCG63011.2 transcript_id=mCT63194.2 created
FT                   on 07-JAN-2003"
FT   CDS             complement(join(12916802..12917863,12919065..12919140,
FT                   12919259..12919327,12920563..12920726,12923243..12923390,
FT                   12923559..12923673,12931367..12931388))
FT                   /codon_start=1
FT                   /locus_tag="mCG_63011"
FT                   /product="mCG63011"
FT                   /note="gene_id=mCG63011.2 transcript_id=mCT63194.2
FT                   protein_id=mCP40681.2"
FT                   /protein_id="EDL29100.1"
FT                   /translation="MVSHILQSELGDFHEETVRKHLVQTQYLPSQASLESKIMQFHQQH
FT                   IGRSPAESDILLLDIARKLDMYGIRPQPASDGEGMQIHLAVAHMGVLVLRVLCKDTLEF
FT                   TMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFRYSGRTQRQLLEYGKK
FT                   GRLKSLPFERKQYPSQYHERQCRSSPDILSDVSKQVEDLRLTYGSSYYRNVNGVHASES
FT                   MLDSRRRNSAVEVTFAAELEHSKPEAEATSLHPSQSSSSFTFIYADPVFNTDPEPIEFF
FT                   EERSPLSSFQTTSKFADSHTSKASPARQLTYTDVPYIPCTSQKVDIMPPQVFFYVDKPP
FT                   QVPRRSLIMAEENMRPDSYVDHSAIKPAKRSPRNMRIKSLQQDLQELQEAMARTSGRSN
FT                   INVEPEEEDPHLDDAFAYNLQEQTPKRSQSQSDMKTIRFPFGSEFRPLGPCPALTRKTD
FT                   LFACTFAEQEFPTVLIDQSSAERYVASESSDSESEIIKPDYYFLYGKGTKSPRARIRLS
FT                   SGSLQLEEEDETISFATPGAEDRTLLKPCNYFLA"
FT   gap             12918564..12918755
FT                   /estimated_length=192
FT   gap             12920227..12920247
FT                   /estimated_length=21
FT   gap             12921943..12922866
FT                   /estimated_length=924
FT   gap             12925079..12925127
FT                   /estimated_length=49
FT   gap             12939442..12940147
FT                   /estimated_length=706
FT   gap             12943500..12943752
FT                   /estimated_length=253
FT   gap             12960864..12960883
FT                   /estimated_length=20
FT   gap             12986659..12986678
FT                   /estimated_length=20
FT   gap             12996196..12996292
FT                   /estimated_length=97
FT   gap             12999457..12999476
FT                   /estimated_length=20
FT   gap             13010709..13010800
FT                   /estimated_length=92
FT   gap             13017278..13017297
FT                   /estimated_length=20
FT   gap             13018801..13020007
FT                   /estimated_length=1207
FT   gap             13027328..13027347
FT                   /estimated_length=20
FT   gene            complement(13027348..13040333)
FT                   /gene="Rap2c"
FT                   /locus_tag="mCG_115837"
FT                   /note="gene_id=mCG115837.1"
FT   mRNA            complement(join(13027348..13028965,13037170..13037482,
FT                   13039824..13040333))
FT                   /gene="Rap2c"
FT                   /locus_tag="mCG_115837"
FT                   /product="RAP2C, member of RAS oncogene family, transcript
FT                   variant mCT116945"
FT                   /note="gene_id=mCG115837.1 transcript_id=mCT116945.1
FT                   created on 16-JUN-2003"
FT   mRNA            complement(join(13027348..13028965,13030501..13030694,
FT                   13037170..13037482,13039824..13040215))
FT                   /gene="Rap2c"
FT                   /locus_tag="mCG_115837"
FT                   /product="RAP2C, member of RAS oncogene family, transcript
FT                   variant mCT185832"
FT                   /note="gene_id=mCG115837.1 transcript_id=mCT185832.0
FT                   created on 16-JUN-2003"
FT   CDS             complement(join(13037204..13037482,13039824..13040096))
FT                   /codon_start=1
FT                   /gene="Rap2c"
FT                   /locus_tag="mCG_115837"
FT                   /product="RAP2C, member of RAS oncogene family, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG115837.1 transcript_id=mCT116945.1
FT                   protein_id=mCP87557.1 isoform=CRA_a"
FT                   /protein_id="EDL29101.1"
FT                   /translation="MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIE
FT                   VDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVK
FT                   RYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQ
FT                   MNYSSLPEKQDQCCTTCVVQ"
FT   CDS             complement(join(13037204..13037482,13039824..13040096))
FT                   /codon_start=1
FT                   /gene="Rap2c"
FT                   /locus_tag="mCG_115837"
FT                   /product="RAP2C, member of RAS oncogene family, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG115837.1 transcript_id=mCT185832.0
FT                   protein_id=mCP107090.0 isoform=CRA_a"
FT                   /protein_id="EDL29102.1"
FT                   /translation="MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIE
FT                   VDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVK
FT                   RYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQ
FT                   MNYSSLPEKQDQCCTTCVVQ"
FT   gap             13040354..13040977
FT                   /estimated_length=624
FT   gap             13044154..13044173
FT                   /estimated_length=20
FT   gap             13052961..13053669
FT                   /estimated_length=709
FT   gap             13059156..13060133
FT                   /estimated_length=978
FT   gap             13063693..13064546
FT                   /estimated_length=854
FT   gap             13072786..13072805
FT                   /estimated_length=20
FT   gap             13076664..13076749
FT                   /estimated_length=86
FT   gap             13083623..13083743
FT                   /estimated_length=121
FT   gap             13087001..13087020
FT                   /estimated_length=20
FT   gap             13088358..13088384
FT                   /estimated_length=27
FT   gap             13091103..13091132
FT                   /estimated_length=30
FT   gap             13100627..13100899
FT                   /estimated_length=273
FT   gap             13101285..13101558
FT                   /estimated_length=274
FT   gap             13107564..13107660
FT                   /estimated_length=97
FT   gap             13113996..13114708
FT                   /estimated_length=713
FT   gap             13116702..13116813
FT                   /estimated_length=112
FT   gap             13128080..13128508
FT                   /estimated_length=429
FT   gene            complement(13136800..13231485)
FT                   /gene="Mbnl3"
FT                   /locus_tag="mCG_17293"
FT                   /note="gene_id=mCG17293.3"
FT   mRNA            complement(join(13136800..13139054,13139106..13143020,
FT                   13143045..13144337,13147136..13147230,13154243..13154393,
FT                   13155427..13155663,13156751..13156942,13164507..13164671,
FT                   13189708..13189954,13231264..13231485))
FT                   /gene="Mbnl3"
FT                   /locus_tag="mCG_17293"
FT                   /product="muscleblind-like 3 (Drosophila), transcript
FT                   variant mCT17185"
FT                   /note="gene_id=mCG17293.3 transcript_id=mCT17185.3 created
FT                   on 14-JUL-2003"
FT   mRNA            complement(join(13136800..13139054,13139106..13143020,
FT                   13143045..13144337,13147136..13150703))
FT                   /gene="Mbnl3"
FT                   /locus_tag="mCG_17293"
FT                   /product="muscleblind-like 3 (Drosophila), transcript
FT                   variant mCT186583"
FT                   /note="gene_id=mCG17293.3 transcript_id=mCT186583.0 created
FT                   on 14-JUL-2003"
FT   gap             13139055..13139105
FT                   /estimated_length=51
FT   gap             13143025..13143044
FT                   /estimated_length=20
FT   CDS             complement(join(13144326..13144337,13147136..13147230,
FT                   13154243..13154393,13155427..13155663,13156751..13156942,
FT                   13164507..13164671,13189708..13189884))
FT                   /codon_start=1
FT                   /gene="Mbnl3"
FT                   /locus_tag="mCG_17293"
FT                   /product="muscleblind-like 3 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG17293.3 transcript_id=mCT17185.3
FT                   protein_id=mCP10622.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q542D8"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="MGI:MGI:2444912"
FT                   /db_xref="UniProtKB/TrEMBL:Q542D8"
FT                   /protein_id="EDL29104.1"
FT                   /translation="MTPVNVALIRDTKWLTLEVCREFQRGTCSRADAECRFAHPPRVCH
FT                   VENGRVVACFDSLKGRCTRENCKYLHPPPHLKSQLEVNGRNNLIQQKTAAAMFAQHMQL
FT                   MLQNAQMSSLASFPMNPSLAANPAMAFNPYMTHPGMGLVPAELLPNGPVLISGNPPLAL
FT                   PGVPGPKPIRTDRLEVCREFQRGNCTRGESECRYAHPTDVSMIEVTDNSVTICMDYIKG
FT                   RCSREKCKYFHPPPHLQAKLRAAHHQMNHSAANAMALPHGALQLIPKRSALDKANGATP
FT                   VFNPSVFHCQQALANMQIPQQAFIPTVPMMHGATPSTVSTATPPASNVPYVPTTTGNQL
FT                   KY"
FT   CDS             complement(join(13144326..13144337,13147136..13147276))
FT                   /codon_start=1
FT                   /gene="Mbnl3"
FT                   /locus_tag="mCG_17293"
FT                   /product="muscleblind-like 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG17293.3 transcript_id=mCT186583.0
FT                   protein_id=mCP107818.0 isoform=CRA_a"
FT                   /protein_id="EDL29103.1"
FT                   /translation="MLHPSMCRFHDFLLQVPMMHGATPSTVSTATPPASNVPYVPTTTG
FT                   NQLKY"
FT   gap             13152152..13152171
FT                   /estimated_length=20
FT   gap             13153769..13153788
FT                   /estimated_length=20
FT   gap             13215533..13216062
FT                   /estimated_length=530
FT   gap             13224754..13224773
FT                   /estimated_length=20
FT   gap             13230190..13230898
FT                   /estimated_length=709
FT   gene            complement(13237951..13238443)
FT                   /pseudo
FT                   /locus_tag="mCG_1040997"
FT                   /note="gene_id=mCG1040997.0"
FT   mRNA            complement(13237951..13238443)
FT                   /pseudo
FT                   /locus_tag="mCG_1040997"
FT                   /note="gene_id=mCG1040997.0 transcript_id=mCT158701.0
FT                   created on 14-JUL-2003"
FT   gene            13240325..13242095
FT                   /locus_tag="mCG_1041092"
FT                   /note="gene_id=mCG1041092.0"
FT   mRNA            join(13240325..13240875,13242020..13242095)
FT                   /locus_tag="mCG_1041092"
FT                   /product="mCG1041092"
FT                   /note="gene_id=mCG1041092.0 transcript_id=mCT158796.0
FT                   created on 14-JUL-2003"
FT   CDS             13240672..13240809
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041092"
FT                   /product="mCG1041092"
FT                   /note="gene_id=mCG1041092.0 transcript_id=mCT158796.0
FT                   protein_id=mCP87511.0"
FT                   /protein_id="EDL29105.1"
FT                   /translation="MYMSCRSHRARGHNTLACDLCYIRLWLSLFLLDFFLQIIISSFTS
FT                   "
FT   gene            complement(13244333..13245504)
FT                   /pseudo
FT                   /locus_tag="mCG_146386"
FT                   /note="gene_id=mCG146386.0"
FT   mRNA            complement(13244333..13245504)
FT                   /pseudo
FT                   /locus_tag="mCG_146386"
FT                   /note="gene_id=mCG146386.0 transcript_id=mCT186593.0
FT                   created on 14-JUL-2003"
FT   gap             13246164..13246222
FT                   /estimated_length=59
FT   gap             13253381..13253400
FT                   /estimated_length=20
FT   gap             13258703..13258830
FT                   /estimated_length=128
FT   gap             13259984..13260090
FT                   /estimated_length=107
FT   gap             13262887..13262906
FT                   /estimated_length=20
FT   gap             13280843..13280862
FT                   /estimated_length=20
FT   gap             13282072..13284426
FT                   /estimated_length=2355
FT   gap             13285175..13288051
FT                   /estimated_length=2877
FT   gap             13290281..13290399
FT                   /estimated_length=119
FT   gap             13295800..13300987
FT                   /estimated_length=5188
FT   gap             13305271..13305420
FT                   /estimated_length=150
FT   gap             13313434..13314250
FT                   /estimated_length=817
FT   gap             13321667..13321760
FT                   /estimated_length=94
FT   gap             13330880..13331005
FT                   /estimated_length=126
FT   gap             13334087..13334146
FT                   /estimated_length=60
FT   gap             13338433..13338825
FT                   /estimated_length=393
FT   gap             13344883..13346567
FT                   /estimated_length=1685
FT   gap             13351159..13351178
FT                   /estimated_length=20
FT   gap             13353087..13353855
FT                   /estimated_length=769
FT   gap             13360013..13360034
FT                   /estimated_length=22
FT   gap             13361628..13361647
FT                   /estimated_length=20
FT   gap             13363601..13363632
FT                   /estimated_length=32
FT   gap             13376448..13377171
FT                   /estimated_length=724
FT   gap             13379330..13381093
FT                   /estimated_length=1764
FT   gap             13383802..13384253
FT                   /estimated_length=452
FT   gap             13384593..13384802
FT                   /estimated_length=210
FT   gap             13387932..13387951
FT                   /estimated_length=20
FT   gap             13402275..13402330
FT                   /estimated_length=56
FT   gap             13404871..13405063
FT                   /estimated_length=193
FT   gene            complement(13411976..13707302)
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /note="gene_id=mCG5423.3"
FT   mRNA            complement(join(13411976..13415124,13453526..13453612,
FT                   13496447..13496479,13705489..13706007,13706774..13707302))
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /product="heparan sulfate 6-O-sulfotransferase 2,
FT                   transcript variant mCT4867"
FT                   /note="gene_id=mCG5423.3 transcript_id=mCT4867.3 created on
FT                   14-JUL-2003"
FT   mRNA            complement(join(13412453..13415124,13453526..13453612,
FT                   13496447..13496479,13705489..>13706063))
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /product="heparan sulfate 6-O-sulfotransferase 2,
FT                   transcript variant mCT192580"
FT                   /note="gene_id=mCG5423.3 transcript_id=mCT192580.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(13414233..13415124,13453526..13453612,
FT                   13496447..13496479,13705489..13706007,13706774..13706910))
FT                   /codon_start=1
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /product="heparan sulfate 6-O-sulfotransferase 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG5423.3 transcript_id=mCT4867.3
FT                   protein_id=mCP2802.3 isoform=CRA_c"
FT                   /protein_id="EDL29108.1"
FT                   /translation="MHDLRRRWDLGSLCRALLTRGLAAVGHSLKHVLSAIFSKIFGPLA
FT                   SVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVPDPYRSEDESS
FT                   ARFVPRYNFSRGDLLRKVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRV
FT                   GQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSCVPAVVDGKRDARLRPSRWRI
FT                   FQILDGTSKDRWGSSNFNSGANSPSSTKPRSTSKSGKNFHYITILRDPVSRYLSEWRHV
FT                   QRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPLKEFMDCPYNLANNRQVRMLSDL
FT                   TLVGCYNLSVMPEKQRNKVLLESAKSNLKHMAFFGLTEFQRKTQYLFEKTFNMNFISPF
FT                   TQYNTTRASSVEINEEIQKRIEGLNFLDMELYSYAKDLFLQRYQFMRQKEHQDARRKRQ
FT                   EQRKFLKGRFLQTHFQSQSQGQSQSQSPGQNLSQNPNPNPNQNLTQNLSHNLTPSSNPN
FT                   STQRENRGSQKQGSGQGQGDSGTSNGTNDYIGSVETWR"
FT   CDS             complement(join(13414233..13415124,13453526..13453612,
FT                   13496447..13496479,13705489..>13706027))
FT                   /codon_start=1
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /product="heparan sulfate 6-O-sulfotransferase 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5423.3 transcript_id=mCT192580.0
FT                   protein_id=mCP113543.0 isoform=CRA_b"
FT                   /protein_id="EDL29107.1"
FT                   /translation="RAWVSPSVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLL
FT                   RLQAFSSPVPDPYRSEDESSARFVPRYNFSRGDLLRKVDFDIKGDDLIVFLHIQKTGGT
FT                   TFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSC
FT                   VPAVVDGKRDARLRPSRWRIFQILDGTSKDRWGSSNFNSGANSPSSTKPRSTSKSGKNF
FT                   HYITILRDPVSRYLSEWRHVQRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPLKE
FT                   FMDCPYNLANNRQVRMLSDLTLVGCYNLSVMPEKQRNKVLLESAKSNLKHMAFFGLTEF
FT                   QRKTQYLFEKTFNMNFISPFTQYNTTRASSVEINEEIQKRIEGLNFLDMELYSYAKDLF
FT                   LQRYQFMRQKEHQDARRKRQEQRKFLKGRFLQTHFQSQSQGQSQSQSPGQNLSQNPNPN
FT                   PNQNLTQNLSHNLTPSSNPNSTQRENRGSQKQGSGQGQGDSGTSNGTNDYIGSVETWR"
FT   gap             13429627..13430060
FT                   /estimated_length=434
FT   gap             13432519..13432702
FT                   /estimated_length=184
FT   gap             13454550..13454569
FT                   /estimated_length=20
FT   gap             13456156..13456175
FT                   /estimated_length=20
FT   gap             13462644..13467546
FT                   /estimated_length=4903
FT   gap             13480232..13480251
FT                   /estimated_length=20
FT   gap             13483480..13483656
FT                   /estimated_length=177
FT   gap             13488172..13488233
FT                   /estimated_length=62
FT   gap             13516813..13517032
FT                   /estimated_length=220
FT   gap             13528675..13528694
FT                   /estimated_length=20
FT   gap             13536129..13536148
FT                   /estimated_length=20
FT   gap             13541655..13541722
FT                   /estimated_length=68
FT   gap             13545656..13545763
FT                   /estimated_length=108
FT   gap             13554712..13555529
FT                   /estimated_length=818
FT   gap             13569555..13569574
FT                   /estimated_length=20
FT   gap             13571355..13571421
FT                   /estimated_length=67
FT   gap             13574048..13574182
FT                   /estimated_length=135
FT   gap             13577387..13577562
FT                   /estimated_length=176
FT   gap             13594383..13597854
FT                   /estimated_length=3472
FT   gap             13645591..13645661
FT                   /estimated_length=71
FT   gap             13679990..13680009
FT                   /estimated_length=20
FT   mRNA            complement(join(13702382..13706007,13706774..13707302))
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /product="heparan sulfate 6-O-sulfotransferase 2,
FT                   transcript variant mCT177733"
FT                   /note="gene_id=mCG5423.3 transcript_id=mCT177733.1 created
FT                   on 14-JUL-2003"
FT   CDS             complement(join(13705485..13706007,13706774..13706910))
FT                   /codon_start=1
FT                   /gene="Hs6st2"
FT                   /locus_tag="mCG_5423"
FT                   /product="heparan sulfate 6-O-sulfotransferase 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5423.3 transcript_id=mCT177733.1
FT                   protein_id=mCP100655.1 isoform=CRA_a"
FT                   /protein_id="EDL29106.1"
FT                   /translation="MHDLRRRWDLGSLCRALLTRGLAAVGHSLKHVLSAIFSKIFGPLA
FT                   SVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVPDPYRSEDESS
FT                   ARFVPRYNFSRGDLLRKVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRV
FT                   GQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSCVPAVVDGKRDARLRPSR"
FT   gap             13732883..13732925
FT                   /estimated_length=43
FT   gap             13755828..13761415
FT                   /estimated_length=5588
FT   gene            complement(13779603..>13826480)
FT                   /gene="Usp26"
FT                   /locus_tag="mCG_65683"
FT                   /note="gene_id=mCG65683.2"
FT   mRNA            complement(join(13779603..13783117,13790791..13790871,
FT                   13818685..13818740,13822264..13822309,13823060..13823162,
FT                   13823831..13823889,13826149..13826264,13826338..>13826480))
FT                   /gene="Usp26"
FT                   /locus_tag="mCG_65683"
FT                   /product="ubiquitin specific peptidase 26"
FT                   /note="gene_id=mCG65683.2 transcript_id=mCT65866.2 created
FT                   on 16-DEC-2002"
FT   CDS             complement(join(13780533..13783117,13790791..>13790809))
FT                   /codon_start=1
FT                   /gene="Usp26"
FT                   /locus_tag="mCG_65683"
FT                   /product="ubiquitin specific peptidase 26"
FT                   /note="gene_id=mCG65683.2 transcript_id=mCT65866.2
FT                   protein_id=mCP25889.1"
FT                   /protein_id="EDL29109.1"
FT                   /translation="HPVPVSGKLGKQIETPRLLISIREFTCKEKRSMEPILINAQVQMW
FT                   SAKAGMSKSRNALIETCVGKREVKLILYFSTGKIKTLQLHDNIKSVVLQTYGEDQNYLH
FT                   LTFKNNDFLFVEKLTTTDARRLKRFLDKTSQGSIRPARSDERCGEPSTSAQELNGSGSS
FT                   CETNSECFESPKESEMCMFRELSLLPSSSTFLHNVGLLENQFIKRKRFFSDLAKNEKQS
FT                   NLKDSIRDFEANLVVCISNEKGKERNVREVDISKPGFGFPFETNYPEDSGVDVRDLNDL
FT                   ITKLFSPVLLETHCIENGLEWHEYMKTYLLYPEKLWQGLPNVGNTCYINVVLQSLCSIP
FT                   LFINDLFNQGFPWIKAPKDDFNMLLMQLLVLKDIYNARFRQKLLIGITKALPIFGEIFA
FT                   VDRQNDAHEFLSLCLVQLKETFQRVTMMWQSENDSGDFYLLKDIFADYATINKMPVCPV
FT                   TNNFEFELLSSIFCKACGLTLFKGEPSRYLSINIPQGGKDMSIQSTLDLFFSAEELEHR
FT                   CEKCLYNKSVSFHRFGRLPRVIIVHLKRYHFNESWVMKKDERPILVSKYLRLSCHCSKS
FT                   TKPPPPLRPGEHVKNLDLLKPLEVLGSEILKLPFNSVRTSRSKGFETINITSNRESEAQ
FT                   SGKRVSEVLSGKVQQENSGKGDTAHIVGSELTKETEKLKKHEEEHRPSDLDSGSIREAQ
FT                   KYQQAEKCNEGRSDKQISLEALTQSRPKPISQEQTENLGKTTLSHTQDSSQSSQSSSDS
FT                   SKSSRCSDDLDKKAKPTRKVDPTKLNKKEDNVYRLVNIINHIGNSPNGGHYINDAFDFK
FT                   RQSWFTYSDLHVTRTQEDFVYRGRSSTGYVFFYMHNDIFEELLAKETQSTSTSKG"
FT   gap             13797056..13797523
FT                   /estimated_length=468
FT   gap             13805118..13805137
FT                   /estimated_length=20
FT   gap             13809856..13810535
FT                   /estimated_length=680
FT   gap             13811720..13811739
FT                   /estimated_length=20
FT   gap             13813959..13814167
FT                   /estimated_length=209
FT   gap             13817349..13817392
FT                   /estimated_length=44
FT   gap             13833102..13833210
FT                   /estimated_length=109
FT   gap             13836272..13836291
FT                   /estimated_length=20
FT   gap             13875348..13875459
FT                   /estimated_length=112
FT   gap             13880341..13880618
FT                   /estimated_length=278
FT   gap             13884960..13884979
FT                   /estimated_length=20
FT   gap             13886411..13886652
FT                   /estimated_length=242
FT   gap             13891297..13891325
FT                   /estimated_length=29
FT   gap             13904893..13905040
FT                   /estimated_length=148
FT   gap             13913127..13913808
FT                   /estimated_length=682
FT   gap             13915736..13915755
FT                   /estimated_length=20
FT   gap             13917283..13917506
FT                   /estimated_length=224
FT   gap             13932641..13932700
FT                   /estimated_length=60
FT   gap             13942177..13944675
FT                   /estimated_length=2499
FT   gap             13947668..13955542
FT                   /estimated_length=7875
FT   gap             13956783..13956802
FT                   /estimated_length=20
FT   gap             13958966..13959142
FT                   /estimated_length=177
FT   gap             13966154..13966173
FT                   /estimated_length=20
FT   gap             13975277..13975296
FT                   /estimated_length=20
FT   gap             13988485..13988765
FT                   /estimated_length=281
FT   gene            complement(13990953..>13994908)
FT                   /locus_tag="mCG_145459"
FT                   /note="gene_id=mCG145459.0"
FT   mRNA            complement(join(13990953..13992127,13992473..13992543,
FT                   13993169..13993334,13994865..>13994908))
FT                   /locus_tag="mCG_145459"
FT                   /product="mCG145459"
FT                   /note="gene_id=mCG145459.0 transcript_id=mCT184883.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(13991211..>13992119)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145459"
FT                   /product="mCG145459"
FT                   /note="gene_id=mCG145459.0 transcript_id=mCT184883.0
FT                   protein_id=mCP105980.0"
FT                   /protein_id="EDL29110.1"
FT                   /translation="VHPCQLHIFLHLFPKKPSMDPPDNSRNVNQDSTHSERETRDLEAG
FT                   EEEASTSGDVLGSSQGAQRASFPSTAGVPSVEASGSQIEFYPDILRQQILNSKTIDLIL
FT                   FLILKYRRKQQTCKAEILYMVIRGYEDHFPAIFTKASECLRLTFGLEIIERNPRVHSYS
FT                   LVNALGLTYDGMLHGFRGVPKIGLLIIVLCIIFIQDNCASEQELWRILNNMGLYAGRDH
FT                   FIYGDPGVLITEHFVQEGYLECRQVPGSDPPTREYLWGPRAHAETTKMKVLKHFASIVK
FT                   QDPRSYPTRYADALKDEIDRT"
FT   gap             13994169..13994232
FT                   /estimated_length=64
FT   gap             13997165..13997578
FT                   /estimated_length=414
FT   gap             14007973..14008139
FT                   /estimated_length=167
FT   gap             14015128..14015147
FT                   /estimated_length=20
FT   gap             14023812..14023831
FT                   /estimated_length=20
FT   gap             14026568..14026963
FT                   /estimated_length=396
FT   gap             14034084..14034146
FT                   /estimated_length=63
FT   gap             14035307..14038741
FT                   /estimated_length=3435
FT   gap             14049955..14049974
FT                   /estimated_length=20
FT   gap             14052877..14052981
FT                   /estimated_length=105
FT   gap             14054771..14056270
FT                   /estimated_length=1500
FT   gap             14057622..14057641
FT                   /estimated_length=20
FT   gap             14061303..14061639
FT                   /estimated_length=337
FT   gap             14062338..14062850
FT                   /estimated_length=513
FT   gap             14067895..14068357
FT                   /estimated_length=463
FT   gene            complement(14069470..14181878)
FT                   /gene="Gpc4"
FT                   /locus_tag="mCG_51834"
FT                   /note="gene_id=mCG51834.1"
FT   mRNA            complement(join(14069470..14069762,14069955..14070433,
FT                   14070524..14070699,14071153..14071237,14073506..14073654,
FT                   14073749..14073879,14079763..14079928,14090726..14091119,
FT                   14108074..14108232,14181242..14181878))
FT                   /gene="Gpc4"
FT                   /locus_tag="mCG_51834"
FT                   /product="glypican 4"
FT                   /note="gene_id=mCG51834.1 transcript_id=mCT52017.1 created
FT                   on 16-DEC-2002"
FT   gap             14069763..14069954
FT                   /estimated_length=192
FT   gap             14071238..14071764
FT                   /estimated_length=527
FT   gap             14073886..14073905
FT                   /estimated_length=20
FT   gap             14075348..14075367
FT                   /estimated_length=20
FT   gap             14082971..14083451
FT                   /estimated_length=481
FT   CDS             complement(join(14090866..14091119,14108074..14108232,
FT                   14181242..14181401))
FT                   /codon_start=1
FT                   /gene="Gpc4"
FT                   /locus_tag="mCG_51834"
FT                   /product="glypican 4"
FT                   /note="gene_id=mCG51834.1 transcript_id=mCT52017.1
FT                   protein_id=mCP25882.2"
FT                   /protein_id="EDL29111.1"
FT                   /translation="MARLGLLALLCTLAALSASLLAAELKSKSCSEVRRLYVSKGFNKN
FT                   DAPLYEINGDHLKICPQDYTCCSQEMEEKYSLQSKDDFKTVVSEQCNHLQAIFASRYKK
FT                   FDEFFKELLENAEKSLNDMFVKTYGHLYMQNSELFKDLFVELKRYYVAGNVNLEEMLND
FT                   FWARLLERMFRLVNSPSTILQMSTWNV"
FT   gap             14110027..14110068
FT                   /estimated_length=42
FT   gap             14111560..14111710
FT                   /estimated_length=151
FT   gap             14122830..14122849
FT                   /estimated_length=20
FT   gap             14125592..14125827
FT                   /estimated_length=236
FT   gap             14132486..14132666
FT                   /estimated_length=181
FT   gap             14153714..14153925
FT                   /estimated_length=212
FT   gap             14178157..14178231
FT                   /estimated_length=75
FT   gap             14182022..14182041
FT                   /estimated_length=20
FT   gap             14199595..14199826
FT                   /estimated_length=232
FT   gap             14201001..14201227
FT                   /estimated_length=227
FT   gap             14203556..14204327
FT                   /estimated_length=772
FT   gap             14208282..14208340
FT                   /estimated_length=59
FT   gap             14209600..14209870
FT                   /estimated_length=271
FT   gap             14226783..14226802
FT                   /estimated_length=20
FT   gap             14229114..14229133
FT                   /estimated_length=20
FT   gap             14242130..14242889
FT                   /estimated_length=760
FT   gap             14245524..14245543
FT                   /estimated_length=20
FT   gap             14246719..14246802
FT                   /estimated_length=84
FT   gap             14252642..14252661
FT                   /estimated_length=20
FT   gap             14254320..14254374
FT                   /estimated_length=55
FT   gap             14265468..14265510
FT                   /estimated_length=43
FT   gap             14275810..14276175
FT                   /estimated_length=366
FT   gap             14283530..14283549
FT                   /estimated_length=20
FT   gene            complement(14288153..14632515)
FT                   /gene="Gpc3"
FT                   /locus_tag="mCG_114967"
FT                   /note="gene_id=mCG114967.1"
FT   mRNA            complement(join(14288153..14288678,14330887..14331046,
FT                   14384496..14384616,14406920..14407045,14415921..14416054,
FT                   14447273..14447967,14601106..14601267,14632234..14632515))
FT                   /gene="Gpc3"
FT                   /locus_tag="mCG_114967"
FT                   /product="glypican 3"
FT                   /note="gene_id=mCG114967.1 transcript_id=mCT116065.1
FT                   created on 17-DEC-2002"
FT   CDS             complement(join(14288509..14288678,14330887..14331046,
FT                   14384496..14384616,14406920..14407045,14415921..14416054,
FT                   14447273..14447967,14601106..14601267,14632234..14632405))
FT                   /codon_start=1
FT                   /gene="Gpc3"
FT                   /locus_tag="mCG_114967"
FT                   /product="glypican 3"
FT                   /note="gene_id=mCG114967.1 transcript_id=mCT116065.1
FT                   protein_id=mCP87668.1"
FT                   /db_xref="GOA:Q3TWB2"
FT                   /db_xref="InterPro:IPR001863"
FT                   /db_xref="InterPro:IPR015501"
FT                   /db_xref="InterPro:IPR019803"
FT                   /db_xref="MGI:MGI:104903"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TWB2"
FT                   /protein_id="EDL29112.1"
FT                   /translation="MAGTVRTACLLVAMLLGLGCLGQAQPPPPPDATCHQVRSFFQRLQ
FT                   PGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLII
FT                   QNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVD
FT                   DMVNELFDSLFPVIYTQMMNPGLPESVLDINECLRGARRDLKVFGSFPKLIMTQVSKSL
FT                   QVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVM
FT                   QGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNGGKL
FT                   TTTIGKLCAHSQQRQYRSAYYPEDLFIDKKILKVAHVEHEETLSSRRRELIQKLKSFIN
FT                   FYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVV
FT                   SQIIDKLKHINQLLRTMSVPKGKVLDKSLDEEGLESGDCGDDEDECIGSSGDGMVKVKN
FT                   QLRFLAELAYDLDVDDAPGNKQHGNQKDNEITTSHSVGNMPSPLKILISVAIYVACFFF
FT                   LVH"
FT   gap             14315675..14316653
FT                   /estimated_length=979
FT   gap             14329535..14329554
FT                   /estimated_length=20
FT   gap             14332638..14332672
FT                   /estimated_length=35
FT   gap             14337017..14337036
FT                   /estimated_length=20
FT   gap             14364032..14364051
FT                   /estimated_length=20
FT   gap             14367752..14370455
FT                   /estimated_length=2704
FT   gap             14374178..14380148
FT                   /estimated_length=5971
FT   gap             14383735..14383936
FT                   /estimated_length=202
FT   gap             14393940..14393959
FT                   /estimated_length=20
FT   gap             14396018..14396037
FT                   /estimated_length=20
FT   gap             14399646..14399840
FT                   /estimated_length=195
FT   gap             14407944..14408533
FT                   /estimated_length=590
FT   gap             14412636..14412789
FT                   /estimated_length=154
FT   gap             14428671..14428690
FT                   /estimated_length=20
FT   gap             14439269..14439784
FT                   /estimated_length=516
FT   gap             14448744..14448889
FT                   /estimated_length=146
FT   gap             14460765..14460784
FT                   /estimated_length=20
FT   gap             14472405..14472424
FT                   /estimated_length=20
FT   gap             14485629..14485761
FT                   /estimated_length=133
FT   gap             14501851..14501870
FT                   /estimated_length=20
FT   gap             14527237..14527316
FT                   /estimated_length=80
FT   gap             14533745..14534575
FT                   /estimated_length=831
FT   gap             14540191..14540210
FT                   /estimated_length=20
FT   gap             14544793..14545403
FT                   /estimated_length=611
FT   gene            14594152..14637110
FT                   /locus_tag="mCG_147983"
FT                   /note="gene_id=mCG147983.0"
FT   mRNA            join(14594152..14594440,14602459..14602525,
FT                   14603984..14604065,14612574..14612699,14636232..14637110)
FT                   /locus_tag="mCG_147983"
FT                   /product="mCG147983"
FT                   /note="gene_id=mCG147983.0 transcript_id=mCT188246.0
FT                   created on 13-JAN-2004"
FT   gap             14601414..14601491
FT                   /estimated_length=78
FT   gap             14614383..14614402
FT                   /estimated_length=20
FT   gap             14618280..14618567
FT                   /estimated_length=288
FT   CDS             14636436..14637086
FT                   /codon_start=1
FT                   /locus_tag="mCG_147983"
FT                   /product="mCG147983"
FT                   /note="gene_id=mCG147983.0 transcript_id=mCT188246.0
FT                   protein_id=mCP109521.0"
FT                   /db_xref="MGI:MGI:2442968"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C9S7"
FT                   /protein_id="EDL29113.1"
FT                   /translation="MAGPPFLLWTPGEGYLAQHAQKNFSSPFAPGLQFERIREFPAVAS
FT                   SYYLAVAGRRVWFHGSKSSINQDFWERVKKGCSTAAAMGGAHTQPCTWPHTHTLFVLGP
FT                   VPLPPRCCSPFSIPLRYTVSSALNLTLELAVREEADKLILSQCIWLIGCNGGCPPRGIS
FT                   ISTGIKALNQRNRALKTLEFQASASGKGVFKLRGNEAFFGAPEITSCRQLLIC"
FT   gap             14637111..14637800
FT                   /estimated_length=690
FT   gap             14649407..14650290
FT                   /estimated_length=884
FT   gap             14653196..14653215
FT                   /estimated_length=20
FT   gap             14667377..14667396
FT                   /estimated_length=20
FT   gap             14671251..14671270
FT                   /estimated_length=20
FT   gap             14677743..14677762
FT                   /estimated_length=20
FT   gap             14690501..14690597
FT                   /estimated_length=97
FT   gap             14713557..14713598
FT                   /estimated_length=42
FT   gap             14719759..14719778
FT                   /estimated_length=20
FT   gap             14727767..14728091
FT                   /estimated_length=325
FT   gap             14729341..14730772
FT                   /estimated_length=1432
FT   gap             14734723..14735728
FT                   /estimated_length=1006
FT   gap             14739353..14739611
FT                   /estimated_length=259
FT   gap             14745640..14745659
FT                   /estimated_length=20
FT   gap             14746609..14746929
FT                   /estimated_length=321
FT   gap             14755014..14755033
FT                   /estimated_length=20
FT   gap             14756196..14756395
FT                   /estimated_length=200
FT   gene            complement(14762480..14764877)
FT                   /locus_tag="mCG_147982"
FT                   /note="gene_id=mCG147982.0"
FT   mRNA            complement(join(14762480..14763835,14764772..14764877))
FT                   /locus_tag="mCG_147982"
FT                   /product="mCG147982"
FT                   /note="gene_id=mCG147982.0 transcript_id=mCT188245.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(14763730..14763835,14764772..14764806))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147982"
FT                   /product="mCG147982"
FT                   /note="gene_id=mCG147982.0 transcript_id=mCT188245.0
FT                   protein_id=mCP109520.0"
FT                   /protein_id="EDL29114.1"
FT                   /translation="MGQALQEPDRTRCLEDLSAWHDWLEHTLRSQEVHRSLLEPLLKMR
FT                   E"
FT   gap             14774845..14774864
FT                   /estimated_length=20
FT   gap             14781120..14781598
FT                   /estimated_length=479
FT   gap             14782919..14782977
FT                   /estimated_length=59
FT   gap             14784767..14785475
FT                   /estimated_length=709
FT   gap             14788915..14789800
FT                   /estimated_length=886
FT   gene            complement(14791425..14791881)
FT                   /locus_tag="mCG_142393"
FT                   /note="gene_id=mCG142393.0"
FT   mRNA            complement(14791425..14791881)
FT                   /locus_tag="mCG_142393"
FT                   /product="mCG142393"
FT                   /note="gene_id=mCG142393.0 transcript_id=mCT180376.0
FT                   created on 10-FEB-2003"
FT   CDS             complement(14791577..14791870)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142393"
FT                   /product="mCG142393"
FT                   /note="gene_id=mCG142393.0 transcript_id=mCT180376.0
FT                   protein_id=mCP103298.0"
FT                   /protein_id="EDL29115.1"
FT                   /translation="MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKK
FT                   LRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEGDH"
FT   gap             14793010..14793029
FT                   /estimated_length=20
FT   gap             14795810..14796026
FT                   /estimated_length=217
FT   gap             14796575..14796594
FT                   /estimated_length=20
FT   gap             14800391..14800468
FT                   /estimated_length=78
FT   gap             14804169..14804395
FT                   /estimated_length=227
FT   gap             14806250..14806269
FT                   /estimated_length=20
FT   gene            14810423..14818711
FT                   /locus_tag="mCG_61513"
FT                   /note="gene_id=mCG61513.1"
FT   mRNA            join(14810423..14810539,14817274..14818711)
FT                   /locus_tag="mCG_61513"
FT                   /product="mCG61513"
FT                   /note="gene_id=mCG61513.1 transcript_id=mCT61696.1 created
FT                   on 07-JAN-2003"
FT   CDS             14817298..14818269
FT                   /codon_start=1
FT                   /locus_tag="mCG_61513"
FT                   /product="mCG61513"
FT                   /note="gene_id=mCG61513.1 transcript_id=mCT61696.1
FT                   protein_id=mCP42633.2"
FT                   /db_xref="GOA:Q3UYG1"
FT                   /db_xref="MGI:MGI:3588225"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3UYG1"
FT                   /protein_id="EDL29116.1"
FT                   /translation="MDARRKHWKDNTFTPFLNEHDFQEAAAPPQPLSEQSSADNHKRMG
FT                   RVSNFSVRNTQEGNKFKRKDYSSQIAEGEQDSNLRERRMNVSKNDANTNSAFWDSLHLD
FT                   DATKESSHRRESASAWNKKKLPAATQVTRKKWTEAMPPKLRLHLLNEELGELSLKCREI
FT                   ERDFENAEKELLNFRKEASVKAVNFQEPGTGASKKDRELQALKNDLSEKATNVKNLTEE
FT                   LQQAKEVMYRLSLENRNLKDAVRKLKHQTELNTALLREEMKLFYELEMEKIRLELGAIK
FT                   NELRVEKTLRVKNSRALEVLGRHVASVVRSSNPADHFTGNIF"
FT   gap             14819047..14819066
FT                   /estimated_length=20
FT   gap             14836193..14836212
FT                   /estimated_length=20
FT   gap             14838314..14838333
FT                   /estimated_length=20
FT   gap             14841572..14843119
FT                   /estimated_length=1548
FT   gap             14846689..14846708
FT                   /estimated_length=20
FT   gap             14850221..14850576
FT                   /estimated_length=356
FT   gap             14856328..14856414
FT                   /estimated_length=87
FT   gap             14859345..14859421
FT                   /estimated_length=77
FT   gap             14868616..14868809
FT                   /estimated_length=194
FT   gap             14869851..14870073
FT                   /estimated_length=223
FT   gap             14879771..14880372
FT                   /estimated_length=602
FT   gap             14881784..14881803
FT                   /estimated_length=20
FT   gap             14895178..14895269
FT                   /estimated_length=92
FT   gap             14900172..14900563
FT                   /estimated_length=392
FT   gap             14908990..14909009
FT                   /estimated_length=20
FT   gap             14910898..14910959
FT                   /estimated_length=62
FT   gap             14913195..14915570
FT                   /estimated_length=2376
FT   gap             14926037..14926056
FT                   /estimated_length=20
FT   gene            14927798..14928747
FT                   /locus_tag="mCG_142391"
FT                   /note="gene_id=mCG142391.0"
FT   mRNA            14927798..14928747
FT                   /locus_tag="mCG_142391"
FT                   /product="mCG142391"
FT                   /note="gene_id=mCG142391.0 transcript_id=mCT180373.0
FT                   created on 10-FEB-2003"
FT   CDS             14927826..14928707
FT                   /codon_start=1
FT                   /locus_tag="mCG_142391"
FT                   /product="mCG142391"
FT                   /note="gene_id=mCG142391.0 transcript_id=mCT180373.0
FT                   protein_id=mCP103295.0"
FT                   /db_xref="GOA:Q58EU3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q58EU3"
FT                   /protein_id="EDL29117.1"
FT                   /translation="MADDAGAAGGPGGPGGPGLGGRGGFRGGFGSGLRGRGRGRGRGRG
FT                   RGRGARGGKAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKD
FT                   EVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIV
FT                   PVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDC
FT                   YTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVS
FT                   VQRTQAPAVATT"
FT   gap             14933489..14933836
FT                   /estimated_length=348
FT   gap             14934768..14934851
FT                   /estimated_length=84
FT   gap             14938827..14938869
FT                   /estimated_length=43
FT   gene            14941685..14983601
FT                   /gene="Phf6"
FT                   /locus_tag="mCG_68204"
FT                   /note="gene_id=mCG68204.1"
FT   mRNA            join(14941685..14941909,14946013..14946196,
FT                   14946626..14946727,14961136..14961269,14961544..14961587,
FT                   14969783..14969949,14970095..14970238,14972090..14972194,
FT                   14975257..14975390,14983049..14983175,14983503..14983601)
FT                   /gene="Phf6"
FT                   /locus_tag="mCG_68204"
FT                   /product="PHD finger protein 6, transcript variant
FT                   mCT68391"
FT                   /note="gene_id=mCG68204.1 transcript_id=mCT68391.1 created
FT                   on 07-JAN-2003"
FT   mRNA            join(<14941766..14941909,14946013..14946196,
FT                   14946626..14946727,14961136..14961269,14961544..14961587,
FT                   14969783..14969949,14970095..14970238,14972090..14972194,
FT                   14975257..14977892)
FT                   /gene="Phf6"
FT                   /locus_tag="mCG_68204"
FT                   /product="PHD finger protein 6, transcript variant
FT                   mCT192588"
FT                   /note="gene_id=mCG68204.1 transcript_id=mCT192588.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<14946023..14946196,14946626..14946727,
FT                   14961136..14961269,14961544..14961587,14969783..14969949,
FT                   14970095..14970238,14972090..14972194,14975257..14975394)
FT                   /codon_start=1
FT                   /gene="Phf6"
FT                   /locus_tag="mCG_68204"
FT                   /product="PHD finger protein 6, isoform CRA_a"
FT                   /note="gene_id=mCG68204.1 transcript_id=mCT192588.0
FT                   protein_id=mCP113544.0 isoform=CRA_a partial"
FT                   /protein_id="EDL29118.1"
FT                   /translation="GLKWQSLNTLKIMSSSIEQKKGSTRQRKCGFCKSNRDKECGQLLI
FT                   SENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATI
FT                   GCDVKTCHRTYHYHCALHDKAQIREKPSQGIYMVYCRKHKKTAHNSEADLEESFNEHEL
FT                   EPSSPKTKKKSRKGRPRKTNLKGLPEDSRSTSSHGTDEMESSSYRDRSPHRSSPNDTRP
FT                   KCGFCHVGEEENEARGKLHIFNAKKAAAHYKCMLFSSGTVQLTTTSRAEFGDFDIKTVL
FT                   QEIKRGKRMKCTLCSQPGATIGCEIKACVKTYHYHCGVQDKAKYIENMSRGIYK"
FT   CDS             join(14946059..14946196,14946626..14946727,
FT                   14961136..14961269,14961544..14961587,14969783..14969949,
FT                   14970095..14970238,14972090..14972194,14975257..14975390,
FT                   14983049..14983175)
FT                   /codon_start=1
FT                   /gene="Phf6"
FT                   /locus_tag="mCG_68204"
FT                   /product="PHD finger protein 6, isoform CRA_b"
FT                   /note="gene_id=mCG68204.1 transcript_id=mCT68391.1
FT                   protein_id=mCP43421.2 isoform=CRA_b"
FT                   /protein_id="EDL29119.1"
FT                   /translation="MSSSIEQKKGSTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKC
FT                   MLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYH
FT                   YHCALHDKAQIREKPSQGIYMVYCRKHKKTAHNSEADLEESFNEHELEPSSPKTKKKSR
FT                   KGRPRKTNLKGLPEDSRSTSSHGTDEMESSSYRDRSPHRSSPNDTRPKCGFCHVGEEEN
FT                   EARGKLHIFNAKKAAAHYKCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCT
FT                   LCSQPGATIGCEIKACVKTYHYHCGVQDKAKYIENMSRGIYKLYCKNHSGNDERDEEDE
FT                   ERESKSRGRVAIDQQLTQQQLNGN"
FT   gap             14949084..14949145
FT                   /estimated_length=62
FT   gap             14951807..14951826
FT                   /estimated_length=20
FT   gap             14970837..14970856
FT                   /estimated_length=20
FT   gap             14973762..14974040
FT                   /estimated_length=279
FT   gap             14975421..14975440
FT                   /estimated_length=20
FT   gap             14978206..14978417
FT                   /estimated_length=212
FT   gap             14979318..14979599
FT                   /estimated_length=282
FT   gap             14992806..14992968
FT                   /estimated_length=163
FT   gap             15006103..15006419
FT                   /estimated_length=317
FT   gap             15010841..15010860
FT                   /estimated_length=20
FT   gap             15013866..15013885
FT                   /estimated_length=20
FT   gap             15014650..15015083
FT                   /estimated_length=434
FT   gene            15017802..15051324
FT                   /gene="Hprt1"
FT                   /locus_tag="mCG_9991"
FT                   /note="gene_id=mCG9991.3"
FT   mRNA            join(15017802..15017962,15026728..15026845,
FT                   15028827..15028933,15031594..15031777,15038048..15038113,
FT                   15041672..15041689,15046012..15046094,15049770..15049816,
FT                   15049988..15050064,15050732..15051324)
FT                   /gene="Hprt1"
FT                   /locus_tag="mCG_9991"
FT                   /product="hypoxanthine guanine phosphoribosyl transferase
FT                   1, transcript variant mCT177735"
FT                   /note="gene_id=mCG9991.3 transcript_id=mCT177735.1 created
FT                   on 16-JUL-2003"
FT   mRNA            join(15017802..15017962,15028827..15028933,
FT                   15031594..15031777,15038048..15038113,15041672..15041689,
FT                   15046012..15046094,15049770..15049816,15049988..15050064,
FT                   15050732..15051324)
FT                   /gene="Hprt1"
FT                   /locus_tag="mCG_9991"
FT                   /product="hypoxanthine guanine phosphoribosyl transferase
FT                   1, transcript variant mCT9786"
FT                   /note="gene_id=mCG9991.3 transcript_id=mCT9786.2 created on
FT                   16-JUL-2003"
FT   CDS             join(15017936..15017962,15028827..15028933,
FT                   15031594..15031777,15038048..15038113,15041672..15041689,
FT                   15046012..15046094,15049770..15049816,15049988..15050064,
FT                   15050732..15050779)
FT                   /codon_start=1
FT                   /gene="Hprt1"
FT                   /locus_tag="mCG_9991"
FT                   /product="hypoxanthine guanine phosphoribosyl transferase
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG9991.3 transcript_id=mCT9786.2
FT                   protein_id=mCP4144.2 isoform=CRA_b"
FT                   /protein_id="EDL29121.1"
FT                   /translation="MPTRSPSVVISDDEPGYDLDLFCIPNHYAEDLEKVFIPHGLIMDR
FT                   TERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKS
FT                   YCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQYSPKMVKVASL
FT                   LVKRTSRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA"
FT   gap             15022730..15022749
FT                   /estimated_length=20
FT   gap             15027648..15027667
FT                   /estimated_length=20
FT   CDS             join(15028926..15028933,15031594..15031777,
FT                   15038048..15038113,15041672..15041689,15046012..15046094,
FT                   15049770..15049816,15049988..15050064,15050732..15050779)
FT                   /codon_start=1
FT                   /gene="Hprt1"
FT                   /locus_tag="mCG_9991"
FT                   /product="hypoxanthine guanine phosphoribosyl transferase
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG9991.3 transcript_id=mCT177735.1
FT                   protein_id=mCP100657.1 isoform=CRA_a"
FT                   /protein_id="EDL29120.1"
FT                   /translation="MDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNR
FT                   NSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTL
FT                   LSLVKQYSPKMVKVASLLVKRTSRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHV
FT                   CVISETGKAKYKA"
FT   gap             15028978..15029855
FT                   /estimated_length=878
FT   gap             15032009..15032410
FT                   /estimated_length=402
FT   gap             15033332..15033351
FT                   /estimated_length=20
FT   gap             15044754..15045342
FT                   /estimated_length=589
FT   gap             15064214..15064233
FT                   /estimated_length=20
FT   gap             15065984..15066122
FT                   /estimated_length=139
FT   gap             15067648..15067667
FT                   /estimated_length=20
FT   gap             15069789..15069808
FT                   /estimated_length=20
FT   gap             15078928..15078961
FT                   /estimated_length=34
FT   gap             15080504..15080523
FT                   /estimated_length=20
FT   gene            complement(15084295..>15086867)
FT                   /locus_tag="mCG_9993"
FT                   /note="gene_id=mCG9993.2"
FT   mRNA            complement(join(15084295..15085186,15085838..15085860,
FT                   15086354..15086465,15086694..>15086867))
FT                   /locus_tag="mCG_9993"
FT                   /product="mCG9993"
FT                   /note="gene_id=mCG9993.2 transcript_id=mCT9788.2 created on
FT                   07-JAN-2003"
FT   CDS             complement(join(15084984..15085186,15085838..15085860,
FT                   15086354..>15086454))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9993"
FT                   /product="mCG9993"
FT                   /note="gene_id=mCG9993.2 transcript_id=mCT9788.2
FT                   protein_id=mCP4143.0"
FT                   /protein_id="EDL29122.1"
FT                   /translation="GAASQENPRNLCKKLTMKFKKFYDFGAIFEWSESIGKVWLEGDHR
FT                   WFFPPQFRVHVKMTCNIAKKRRNFHSNLRSGAVIINGFIYHDLSNAYVSTGSLSVMLGI
FT                   LYLV"
FT   gene            complement(15099686..15143690)
FT                   /gene="Plac1"
FT                   /locus_tag="mCG_9992"
FT                   /note="gene_id=mCG9992.1"
FT   mRNA            complement(join(15099686..15100575,15127980..15128051,
FT                   15143583..15143690))
FT                   /gene="Plac1"
FT                   /locus_tag="mCG_9992"
FT                   /product="placental specific protein 1"
FT                   /note="gene_id=mCG9992.1 transcript_id=mCT9787.1 created on
FT                   17-DEC-2002"
FT   CDS             complement(15099997..15100518)
FT                   /codon_start=1
FT                   /gene="Plac1"
FT                   /locus_tag="mCG_9992"
FT                   /product="placental specific protein 1"
FT                   /note="gene_id=mCG9992.1 transcript_id=mCT9787.1
FT                   protein_id=mCP4145.1"
FT                   /protein_id="EDL29123.1"
FT                   /translation="MNLRKFLGGTVLVAFMLFSYSEQNQVNVLCSTDWFMVTVHPFLLN
FT                   NDVYVHFYEVHLGLGCPPNHVHPHFYQFHYRVTECGIRIKAVSPDVVIYSSEIHYASKG
FT                   SSTKYVIPVSCAAPRRSPWLTKPYSAKAPSNNMGATPKNDTSYHVFTLPEPSEQPNCSC
FT                   PPYVYNQKSM"
FT   gap             15100886..15100957
FT                   /estimated_length=72
FT   gap             15102999..15103150
FT                   /estimated_length=152
FT   gap             15122804..15123399
FT                   /estimated_length=596
FT   gap             15132249..15132278
FT                   /estimated_length=30
FT   gap             15136449..15136468
FT                   /estimated_length=20
FT   gap             15141179..15141565
FT                   /estimated_length=387
FT   gap             15145672..15146308
FT                   /estimated_length=637
FT   gap             15148474..15148739
FT                   /estimated_length=266
FT   gap             15151526..15151545
FT                   /estimated_length=20
FT   gap             15156675..15157428
FT                   /estimated_length=754
FT   gap             15173468..15173487
FT                   /estimated_length=20
FT   gap             15175274..15175456
FT                   /estimated_length=183
FT   gap             15184826..15184845
FT                   /estimated_length=20
FT   gap             15187281..15187300
FT                   /estimated_length=20
FT   gap             15190211..15190329
FT                   /estimated_length=119
FT   gap             15207072..15207091
FT                   /estimated_length=20
FT   gap             15214856..15214875
FT                   /estimated_length=20
FT   gap             15222837..15223185
FT                   /estimated_length=349
FT   gap             15224444..15224549
FT                   /estimated_length=106
FT   gap             15236522..15236541
FT                   /estimated_length=20
FT   gap             15239578..15239597
FT                   /estimated_length=20
FT   gap             15240694..15250114
FT                   /estimated_length=9421
FT   gap             15251511..15252054
FT                   /estimated_length=544
FT   gap             15262358..15262388
FT                   /estimated_length=31
FT   gap             15270564..15271063
FT                   /estimated_length=500
FT   gene            complement(15272162..>15298884)
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /note="gene_id=mCG51547.2"
FT   mRNA            complement(join(15272162..15275019,15283122..15283218,
FT                   15288045..15288109,15288929..15289014,15289283..15289384,
FT                   15289634..15289688,15289778..15289821,15295114..15295192,
FT                   15297952..15298134))
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /product="RIKEN cDNA 4632404H22, transcript variant
FT                   mCT51730"
FT                   /note="gene_id=mCG51547.2 transcript_id=mCT51730.2 created
FT                   on 17-DEC-2002"
FT   mRNA            complement(join(15272475..15274100,15283122..15283218,
FT                   15288045..15288106,15288929..15289014,15289283..15289384,
FT                   15289634..15289688,15289778..15289821,15295114..15295192,
FT                   15297952..>15298875))
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /product="RIKEN cDNA 4632404H22, transcript variant
FT                   mCT192571"
FT                   /note="gene_id=mCG51547.2 transcript_id=mCT192571.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(15273593..15274100,15282942..15283014,
FT                   15283122..15283218,15288045..15288106,15288929..15289014,
FT                   15289283..15289384,15289634..15289688,15289778..15289821,
FT                   15295114..15295192,15297952..>15298884))
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /product="RIKEN cDNA 4632404H22, transcript variant
FT                   mCT192570"
FT                   /note="gene_id=mCG51547.2 transcript_id=mCT192570.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(15274031..15274100,15283122..15283218,
FT                   15288045..15288106,15288929..15289014,15289283..15289384,
FT                   15289634..15289688,15289778..15289821,15295114..15295192,
FT                   15297952..>15298103))
FT                   /codon_start=1
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /product="RIKEN cDNA 4632404H22, isoform CRA_b"
FT                   /note="gene_id=mCG51547.2 transcript_id=mCT192571.0
FT                   protein_id=mCP113542.0 isoform=CRA_b"
FT                   /protein_id="EDL29125.1"
FT                   /translation="QSTRSREHCRLCCLASLRMAQEKMDLDFEADTSEGATLRRSNSAP
FT                   LIHVLSDLSQVFEPYPLRTGRTSTAIMSHHSLEEGLDMMNRETTNEREAQAGMQISQSW
FT                   DESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGKQCLSPSLQMFVSSSGMPPS
FT                   PVLNPRHFSRRSQSPVKCIRPSVLGPLKRKGEMEMESQPKRPFQGTTSMLSTNPAQLSD
FT                   FSSWWCYQGEEIPALTRCVEHLQMNE"
FT   CDS             complement(join(15274875..15275019,15283122..15283218,
FT                   15288045..15288109,15288929..15289014,15289283..15289384,
FT                   15289634..15289688,15289778..15289821,15295114..15295192,
FT                   15297952..15298049))
FT                   /codon_start=1
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /product="RIKEN cDNA 4632404H22, isoform CRA_c"
FT                   /note="gene_id=mCG51547.2 transcript_id=mCT51730.2
FT                   protein_id=mCP24045.2 isoform=CRA_c"
FT                   /protein_id="EDL29126.1"
FT                   /translation="MAQEKMDLDFEADTSEGATLRRSNSAPLIHVLSDLSQVFEPYPLR
FT                   TGRTSTAIMSHHSLEEGLDMMNRETTNEREAQAGMQISQSWDESLSLSDSDFDKPEKLY
FT                   SPKRIDFTPVSPAPSPTRGFGKQCLSPSLQMFVSSSGMPPSPVLNPRHFSSRRSQSPVK
FT                   CIRPSVLGPLKRKGEMEMESQPKRPFQGTTSMLSTNPAQLSDFSSCSDILDGSSISSGL
FT                   SSDSLATGSAPAESPVACSNSCSPFILMDDLSPK"
FT   gap             15278644..15278959
FT                   /estimated_length=316
FT   gap             15282865..15282884
FT                   /estimated_length=20
FT   CDS             complement(join(15282978..15283014,15283122..15283218,
FT                   15288045..15288106,15288929..15289014,15289283..15289384,
FT                   15289634..15289688,15289778..15289821,15295114..15295192,
FT                   15297952..>15298103))
FT                   /codon_start=1
FT                   /gene="4632404H22Rik"
FT                   /locus_tag="mCG_51547"
FT                   /product="RIKEN cDNA 4632404H22, isoform CRA_a"
FT                   /note="gene_id=mCG51547.2 transcript_id=mCT192570.0
FT                   protein_id=mCP113541.0 isoform=CRA_a"
FT                   /protein_id="EDL29124.1"
FT                   /translation="QSTRSREHCRLCCLASLRMAQEKMDLDFEADTSEGATLRRSNSAP
FT                   LIHVLSDLSQVFEPYPLRTGRTSTAIMSHHSLEEGLDMMNRETTNEREAQAGMQISQSW
FT                   DESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGKQCLSPSLQMFVSSSGMPPS
FT                   PVLNPRHFSRRSQSPVKCIRPSVLGPLKRKGEMEMESQPKRPFQGTTSMLSTNPAQLSD
FT                   FSSWGSLHGGVSDFE"
FT   gap             15300938..15300992
FT                   /estimated_length=55
FT   gap             15302078..15302107
FT                   /estimated_length=30
FT   gene            15302438..15360402
FT                   /gene="4930432H15Rik"
FT                   /locus_tag="mCG_3693"
FT                   /note="gene_id=mCG3693.2"
FT   mRNA            join(15302438..15302510,15306627..15306828,
FT                   15311447..15311525,15322722..15322778,15325430..15325474,
FT                   15327688..15327780,15330461..15330516,15357197..15357329,
FT                   15360286..15360402)
FT                   /gene="4930432H15Rik"
FT                   /locus_tag="mCG_3693"
FT                   /product="RIKEN cDNA 4930432H15"
FT                   /note="gene_id=mCG3693.2 transcript_id=mCT3158.2 created on
FT                   17-DEC-2002"
FT   CDS             join(15306644..15306828,15311447..15311525,
FT                   15322722..15322778,15325430..15325474,15327688..15327780,
FT                   15330461..15330490)
FT                   /codon_start=1
FT                   /gene="4930432H15Rik"
FT                   /locus_tag="mCG_3693"
FT                   /product="RIKEN cDNA 4930432H15"
FT                   /note="gene_id=mCG3693.2 transcript_id=mCT3158.2
FT                   protein_id=mCP1155.2"
FT                   /protein_id="EDL29127.1"
FT                   /translation="MSLNEEEPDTLQNFQLGRGFILNTDVIQETMEVDLGLVPASSSVD
FT                   ISYVRRSNSIPSVNGFGDNSQGFQVGPTRMRRNGSPFLNQHGLLFLPSRSRTSANRIFQ
FT                   IKQEEGMDMAIREAMHERNDNNTVKSSTMRNINPNPFSPVASLPKRPRKNPHHDHLTF"
FT   gap             15313020..15313946
FT                   /estimated_length=927
FT   gap             15314995..15315014
FT                   /estimated_length=20
FT   gap             15317258..15317277
FT                   /estimated_length=20
FT   gap             15325504..15325523
FT                   /estimated_length=20
FT   gap             15329131..15329326
FT                   /estimated_length=196
FT   gap             15334457..15334476
FT                   /estimated_length=20
FT   gap             15344040..15344059
FT                   /estimated_length=20
FT   gap             15345565..15345745
FT                   /estimated_length=181
FT   gap             15367660..15373752
FT                   /estimated_length=6093
FT   gene            complement(15377839..15403811)
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /note="gene_id=mCG3692.1"
FT   mRNA            complement(join(15377839..15379231,15380946..15381107,
FT                   15388898..15389115,15390652..15390727,15390816..15391069,
FT                   15403702..15403811))
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /product="motile sperm domain containing 1, transcript
FT                   variant mCT3157"
FT                   /note="gene_id=mCG3692.1 transcript_id=mCT3157.2 created on
FT                   17-DEC-2002"
FT   mRNA            complement(join(15378263..15379231,15380946..15381107,
FT                   15388895..15389115,15390652..15390727,15390816..15391069,
FT                   15403702..15403774))
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /product="motile sperm domain containing 1, transcript
FT                   variant mCT177731"
FT                   /note="gene_id=mCG3692.1 transcript_id=mCT177731.0 created
FT                   on 17-DEC-2002"
FT   mRNA            complement(join(15378263..15379231,15380946..15381107,
FT                   15388895..15389115,15390652..15390727,15390816..15391069,
FT                   15393637..15393711,15403702..15403774))
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /product="motile sperm domain containing 1, transcript
FT                   variant mCT177732"
FT                   /note="gene_id=mCG3692.1 transcript_id=mCT177732.0 created
FT                   on 17-DEC-2002"
FT   CDS             complement(join(15379200..15379231,15380946..15381107,
FT                   15388898..15389115,15390652..15390727,15390816..15390969))
FT                   /codon_start=1
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /product="motile sperm domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG3692.1 transcript_id=mCT3157.2
FT                   protein_id=mCP1154.2 isoform=CRA_b"
FT                   /protein_id="EDL29130.1"
FT                   /translation="MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYE
FT                   FALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQ
FT                   RKALGRKEVIATLLPSAKEQQKEEEEKRIKEHLTESVFFEQSCQPENRAVSSGPSLLTV
FT                   FLGVVCIAALMLPTLGDMESLVPLYLHLSVNQKLVAAYILGLITMAILRT"
FT   CDS             complement(join(15379200..15379231,15380946..15381107,
FT                   15388895..15389115,15390652..15390727,15390816..15390969))
FT                   /codon_start=1
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /product="motile sperm domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG3692.1 transcript_id=mCT177731.0
FT                   protein_id=mCP100654.0 isoform=CRA_a"
FT                   /protein_id="EDL29128.1"
FT                   /translation="MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYE
FT                   FALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQ
FT                   RKALGRKEVIATLLPSAKEQQKEEEEKRIKEHLTESVFFEQSCQPGKNRAVSSGPSLLT
FT                   VFLGVVCIAALMLPTLGDMESLVPLYLHLSVNQKLVAAYILGLITMAILRT"
FT   CDS             complement(join(15379200..15379231,15380946..15381107,
FT                   15388895..15389115,15390652..15390727,15390816..15390969))
FT                   /codon_start=1
FT                   /gene="Mospd1"
FT                   /locus_tag="mCG_3692"
FT                   /product="motile sperm domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG3692.1 transcript_id=mCT177732.0
FT                   protein_id=mCP100653.0 isoform=CRA_a"
FT                   /protein_id="EDL29129.1"
FT                   /translation="MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYE
FT                   FALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQ
FT                   RKALGRKEVIATLLPSAKEQQKEEEEKRIKEHLTESVFFEQSCQPGKNRAVSSGPSLLT
FT                   VFLGVVCIAALMLPTLGDMESLVPLYLHLSVNQKLVAAYILGLITMAILRT"
FT   gap             15401212..15401231
FT                   /estimated_length=20
FT   gap             15403270..15403360
FT                   /estimated_length=91
FT   gap             15415250..15415574
FT                   /estimated_length=325
FT   gap             15423013..15423032
FT                   /estimated_length=20
FT   gap             15426630..15426663
FT                   /estimated_length=34
FT   gap             15437115..15437422
FT                   /estimated_length=308
FT   gap             15441313..15441332
FT                   /estimated_length=20
FT   gap             15445614..15445633
FT                   /estimated_length=20
FT   gap             15450624..15453948
FT                   /estimated_length=3325
FT   gap             15457631..15457650
FT                   /estimated_length=20
FT   gap             15458813..15458885
FT                   /estimated_length=73
FT   gap             15469736..15469755
FT                   /estimated_length=20
FT   gap             15470860..15470950
FT                   /estimated_length=91
FT   gap             15474482..15474501
FT                   /estimated_length=20
FT   gap             15478164..15478351
FT                   /estimated_length=188
FT   gap             15482758..15488865
FT                   /estimated_length=6108
FT   gap             15496022..15496581
FT                   /estimated_length=560
FT   gap             15498426..15499041
FT                   /estimated_length=616
FT   gap             15499837..15500194
FT                   /estimated_length=358
FT   gap             15501376..15501412
FT                   /estimated_length=37
FT   gap             15502673..15512094
FT                   /estimated_length=9422
FT   gene            complement(15513016..15518946)
FT                   /locus_tag="mCG_56763"
FT                   /note="gene_id=mCG56763.1"
FT   mRNA            complement(join(15513016..15513532,15516058..15516179,
FT                   15517079..15517220,15517620..15517804,15518683..15518946))
FT                   /locus_tag="mCG_56763"
FT                   /product="mCG56763"
FT                   /note="gene_id=mCG56763.1 transcript_id=mCT56946.1 created
FT                   on 07-JAN-2003"
FT   CDS             complement(join(15513290..15513532,15516058..15516179,
FT                   15517079..15517220,15517620..15517804,15518683..15518833))
FT                   /codon_start=1
FT                   /locus_tag="mCG_56763"
FT                   /product="mCG56763"
FT                   /note="gene_id=mCG56763.1 transcript_id=mCT56946.1
FT                   protein_id=mCP28172.2"
FT                   /db_xref="InterPro:IPR025223"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D434"
FT                   /protein_id="EDL29131.1"
FT                   /translation="MGVTTSRPSCSCCCCFFNCVGRCLLRLILGVVYYFQWDVPSVERG
FT                   QIHQEGELNTKIVMGTVTSFGNDYGWIEDCIFFSSDAIIGSIPLRTGDKVLAFVEEDPL
FT                   SHELKATEVCVSSEEGVSKDADSKVKDLSVCVSQVKKNFIYIGDEYYFYLDSISKAILG
FT                   FTPREGDWLDIEYSVEQGSPKITVHSVKATQRRQLEEVCVTSIHKRKGMLNHTIFFTLD
FT                   SLNLPLGYTPILGHMVNVVIIQSTQQNYKWRAISMTPISPTVVGIGPRNSSSLLFLYQ"
FT   gap             15514854..15515449
FT                   /estimated_length=596
FT   gap             15520035..15522870
FT                   /estimated_length=2836
FT   gap             15526616..15526681
FT                   /estimated_length=66
FT   gap             15528815..15528834
FT                   /estimated_length=20
FT   gap             15535903..15540287
FT                   /estimated_length=4385
FT   gap             15544451..15547081
FT                   /estimated_length=2631
FT   gap             15550193..15550212
FT                   /estimated_length=20
FT   gap             15573013..15573193
FT                   /estimated_length=181
FT   gap             15578720..15578812
FT                   /estimated_length=93
FT   gene            complement(15581338..15582537)
FT                   /locus_tag="mCG_142390"
FT                   /note="gene_id=mCG142390.0"
FT   mRNA            complement(join(15581338..15581986,15582317..15582537))
FT                   /locus_tag="mCG_142390"
FT                   /product="mCG142390"
FT                   /note="gene_id=mCG142390.0 transcript_id=mCT180372.0
FT                   created on 10-FEB-2003"
FT   CDS             complement(join(15581838..15581986,15582317..15582476))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142390"
FT                   /product="mCG142390"
FT                   /note="gene_id=mCG142390.0 transcript_id=mCT180372.0
FT                   protein_id=mCP103294.0"
FT                   /protein_id="EDL29132.1"
FT                   /translation="MEGQGKVKRPKAYMLRHNRRRRRRNPIPFPELFDGEMDKLPEFIV
FT                   QTGSYMLVVPRPPCLEISHARAPVSSCVLAFVPGIAPQAPAAVPAGPGSGEHKASHC"
FT   gap             15581987..15582316
FT                   /estimated_length=330
FT   gap             15584899..15585093
FT                   /estimated_length=195
FT   gap             15595506..15632853
FT                   /estimated_length=37348
FT   gap             15634609..15634839
FT                   /estimated_length=231
FT   gap             15636444..15636463
FT                   /estimated_length=20
FT   gap             15638099..15638371
FT                   /estimated_length=273
FT   gap             15639881..15639900
FT                   /estimated_length=20
FT   gene            complement(15643221..>15646695)
FT                   /locus_tag="mCG_115122"
FT                   /note="gene_id=mCG115122.0"
FT   mRNA            complement(join(15643221..15643331,15643600..15643764,
FT                   15645174..15645310,15646343..>15646695))
FT                   /locus_tag="mCG_115122"
FT                   /product="mCG115122"
FT                   /note="gene_id=mCG115122.0 transcript_id=mCT116222.1
FT                   created on 07-JAN-2003"
FT   CDS             complement(join(15645273..15645310,15646343..>15646694))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115122"
FT                   /product="mCG115122"
FT                   /note="gene_id=mCG115122.0 transcript_id=mCT116222.1
FT                   protein_id=mCP87620.1"
FT                   /protein_id="EDL29133.1"
FT                   /translation="VAAAAALSGLAVRLSRGAETRSSYGAFCKGLTRTLLTFFDLAWRL
FT                   RVNFPYFYMVASVMLNVRLQCGSSEQTPSATAERAIRAFRAILAAAGRTAGRTVPPDCG
FT                   GESKRHSQGPSILGIGLLGDGSALH"
FT   gap             15646038..15646057
FT                   /estimated_length=20
FT   gap             15653505..15654300
FT                   /estimated_length=796
FT   gene            15654618..15668447
FT                   /locus_tag="mCG_8350"
FT                   /note="gene_id=mCG8350.1"
FT   mRNA            join(15654618..15654843,15657163..15657344,
FT                   15663734..15663866,15666282..15666394,15667673..15668447)
FT                   /locus_tag="mCG_8350"
FT                   /product="mCG8350"
FT                   /note="gene_id=mCG8350.1 transcript_id=mCT7695.1 created on
FT                   07-JAN-2003"
FT   CDS             join(15654753..15654843,15657163..15657344,
FT                   15663734..15663866,15666282..15666394,15667673..15667864)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8350"
FT                   /product="mCG8350"
FT                   /note="gene_id=mCG8350.1 transcript_id=mCT7695.1
FT                   protein_id=mCP8544.2"
FT                   /db_xref="GOA:Q14BQ3"
FT                   /db_xref="MGI:MGI:1922263"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BQ3"
FT                   /protein_id="EDL29134.1"
FT                   /translation="MHRLISRLRAFFQRKADPKEAKEERQKLLEDATSLQNKQGVVAGS
FT                   CSNYDCMTKHTRSSADVETGDNPLKAEPNLPAAVEEQSPRGLNAVTVDNDHDEEPSESH
FT                   MRILLASITSLVGDADYNGHGFSFSLDIACKDFKPYNGDLVEIEFSDEQDTQSRRAILV
FT                   KPLKHCHLNEVRVTRTDGSTGVLEDTIFFTLDSLKLPSGYVPQPDDVVNVVAVQSMQSN
FT                   YFWRAVAMTPVQVL"
FT   gap             15661684..15661901
FT                   /estimated_length=218
FT   gene            complement(15672907..15687658)
FT                   /locus_tag="mCG_8351"
FT                   /note="gene_id=mCG8351.1"
FT   mRNA            complement(join(15672907..15673193,15673338..15673442,
FT                   15675639..15675737,15676928..15677027,15677809..15677926,
FT                   15680000..15680034,15681009..15681072,15681474..15681820,
FT                   15687606..15687658))
FT                   /locus_tag="mCG_8351"
FT                   /product="mCG8351"
FT                   /note="gene_id=mCG8351.1 transcript_id=mCT7696.2 created on
FT                   07-JAN-2003"
FT   CDS             complement(join(15673173..15673193,15673338..15673442,
FT                   15675639..15675737,15676928..15677027,15677809..15677926,
FT                   15680000..15680034,15681009..15681072,15681474..15681807))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8351"
FT                   /product="mCG8351"
FT                   /note="gene_id=mCG8351.1 transcript_id=mCT7696.2
FT                   protein_id=mCP8545.2"
FT                   /db_xref="GOA:Q9DAC5"
FT                   /db_xref="InterPro:IPR006888"
FT                   /db_xref="MGI:MGI:1922764"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DAC5"
FT                   /protein_id="EDL29135.1"
FT                   /translation="MFPRGRRDPEEFKSTPEDPEEPESTTRDPGGLESTPGDPEGFEST
FT                   PGDPEGFESTPGDPKGFESTPGDPEGFESTPGDPVGFESTPTEEEHLAVYSFDDDFQHP
FT                   RVLQRSEELRSTSDSCRERSPVELFTDPGEKVEVMLGRIGVDINRALSAKRQRMETTAR
FT                   QSFEGVEQKMKEVWNSHEDAMAQLNEESAQAFANLFEQWNEDFKKFREQHEKLVNDFKQ
FT                   QEKIFQRTRFVQNQRIRTIKEIHEQFLQKLEDLESKNDDLLTRTQNELKDEINDLQKKI
FT                   LRESEESTLF"
FT   gap             15673227..15673246
FT                   /estimated_length=20
FT   gap             15681249..15681268
FT                   /estimated_length=20
FT   gap             15683198..15683217
FT                   /estimated_length=20
FT   gap             15685797..15686269
FT                   /estimated_length=473
FT   gene            complement(15702528..>15704154)
FT                   /locus_tag="mCG_142536"
FT                   /note="gene_id=mCG142536.0"
FT   mRNA            complement(join(15702528..15702795,15703892..>15704154))
FT                   /locus_tag="mCG_142536"
FT                   /product="mCG142536"
FT                   /note="gene_id=mCG142536.0 transcript_id=mCT180661.0
FT                   created on 20-FEB-2003"
FT   CDS             complement(15703910..>15704152)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142536"
FT                   /product="mCG142536"
FT                   /note="gene_id=mCG142536.0 transcript_id=mCT180661.0
FT                   protein_id=mCP103583.0"
FT                   /protein_id="EDL29136.1"
FT                   /translation="GAAPHFTFQLPDVESESESESLEFDVVTSTLDSLLVSDDEDEDDF
FT                   LRRSSSSSSLNESEFDNTNSSRRLPIFSRFSDSEK"
FT   gene            complement(15706961..15727559)
FT                   /locus_tag="mCG_115120"
FT                   /note="gene_id=mCG115120.2"
FT   mRNA            complement(join(15706961..15708243,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15725982..15726059,15727463..15727547))
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, transcript variant mCT177644"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT177644.1
FT                   created on 10-JUN-2004"
FT   CDS             complement(join(15708166..15708243,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15725982..15726051))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, isoform CRA_b"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT177644.1
FT                   protein_id=mCP100567.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q8BS74"
FT                   /db_xref="InterPro:IPR006888"
FT                   /db_xref="MGI:MGI:98976"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BS74"
FT                   /protein_id="EDL29138.1"
FT                   /translation="MENWDLSSDEMQDGNAPELDVIEEHNPVTRDDENANPEEVVGDTR
FT                   SPVQNILGKFEGDINKRLHIKRKRMETYIKDSFKDSNVKLEQLWKTNKQERKKINNKFC
FT                   EQYITTFQKFDMDVQKFNEEQEKSVNNYQKEQQALKLSKCSQSQTLEAIKDMHENYMEM
FT                   QKAELQLRSRGEDETSCPKEAETS"
FT   gap             15711911..15711930
FT                   /estimated_length=20
FT   mRNA            complement(join(15713587..15714011,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15727471..15727559))
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, transcript variant mCT177645"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT177645.1
FT                   created on 10-JUN-2004"
FT   mRNA            complement(join(15713587..15714011,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15725982..15726059,15727471..15727559))
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, transcript variant mCT192579"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT192579.1
FT                   created on 10-JUN-2004"
FT   mRNA            complement(join(15713587..15714011,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15725982..15726107,15727471..15727559))
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, transcript variant mCT116220"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT116220.1
FT                   created on 10-JUN-2004"
FT   CDS             complement(join(15713871..15714011,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15725982..15726051))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, isoform CRA_a"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT116220.1
FT                   protein_id=mCP87614.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q544L6"
FT                   /db_xref="InterPro:IPR006888"
FT                   /db_xref="MGI:MGI:98976"
FT                   /db_xref="UniProtKB/TrEMBL:Q544L6"
FT                   /protein_id="EDL29137.1"
FT                   /translation="MENWDLSSDEMQDGNAPELDVIEEHNPVTRDDENANPEEVVGDTR
FT                   SPVQNILGKFEGDINKRLHIKRKRMETYIKDSFKDSNVKLEQLWKTNKQERKKINNKFC
FT                   EQYITTFQKFDMDVQKFNEEQEKSVNNYQKEQQALKLSKCSQSQTLEAIKDMHENYMEG
FT                   LMNLETNNYNMLFDVDGELRKEMSVFKKDLMKHTLKYSSSFPSSD"
FT   CDS             complement(join(15713871..15714011,15714331..15714429,
FT                   15716929..15717028,15717722..15717839,15725307..15725341,
FT                   15725612..15725675,15725982..15726051))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, isoform CRA_a"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT192579.1
FT                   protein_id=mCP113530.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q544L6"
FT                   /db_xref="InterPro:IPR006888"
FT                   /db_xref="MGI:MGI:98976"
FT                   /db_xref="UniProtKB/TrEMBL:Q544L6"
FT                   /protein_id="EDL29140.1"
FT                   /translation="MENWDLSSDEMQDGNAPELDVIEEHNPVTRDDENANPEEVVGDTR
FT                   SPVQNILGKFEGDINKRLHIKRKRMETYIKDSFKDSNVKLEQLWKTNKQERKKINNKFC
FT                   EQYITTFQKFDMDVQKFNEEQEKSVNNYQKEQQALKLSKCSQSQTLEAIKDMHENYMEG
FT                   LMNLETNNYNMLFDVDGELRKEMSVFKKDLMKHTLKYSSSFPSSD"
FT   CDS             complement(join(15713871..15714011,15714331..15714429,
FT                   15716929..15717028,15717722..15717801))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115120"
FT                   /product="mCG115120, isoform CRA_c"
FT                   /note="gene_id=mCG115120.2 transcript_id=mCT177645.1
FT                   protein_id=mCP100566.1 isoform=CRA_c"
FT                   /protein_id="EDL29139.1"
FT                   /translation="METYIKDSFKDSNVKLEQLWKTNKQERKKINNKFCEQYITTFQKF
FT                   DMDVQKFNEEQEKSVNNYQKEQQALKLSKCSQSQTLEAIKDMHENYMEGLMNLETNNYN
FT                   MLFDVDGELRKEMSVFKKDLMKHTLKYSSSFPSSD"
FT   gap             15728641..15732596
FT                   /estimated_length=3956
FT   gap             15734407..15739335
FT                   /estimated_length=4929
FT   gene            complement(15746930..15751086)
FT                   /locus_tag="mCG_115115"
FT                   /note="gene_id=mCG115115.0"
FT   mRNA            complement(join(15746930..15747320,15747640..15747738,
FT                   15750172..15750271,15750962..15751086))
FT                   /locus_tag="mCG_115115"
FT                   /product="mCG115115"
FT                   /note="gene_id=mCG115115.0 transcript_id=mCT116215.0
FT                   created on 07-JAN-2003"
FT   CDS             complement(join(15747180..15747320,15747640..15747738,
FT                   15750172..15750271,15750962..15751041))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115115"
FT                   /product="mCG115115"
FT                   /note="gene_id=mCG115115.0 transcript_id=mCT116215.0
FT                   protein_id=mCP87598.1"
FT                   /protein_id="EDL29141.1"
FT                   /translation="METYIKDSFKDSNQKLEQLWKTNKQERRKINNKFCELYMTTFQKF
FT                   DMDVQKFNEEQEKSVNNYQKEQQALKLSKCSQSQTLEAIKDMHENYMEGLMNLETNNYN
FT                   MLFDVDGELRKEMSVFKKDLMKHTLKYSSSFPSSD"
FT   gap             15751277..15751443
FT                   /estimated_length=167
FT   gap             15758101..15759852
FT                   /estimated_length=1752
FT   gap             15783274..15783646
FT                   /estimated_length=373
FT   gap             15785731..15785760
FT                   /estimated_length=30
FT   gap             15789226..15790343
FT                   /estimated_length=1118
FT   gap             15791487..15791881
FT                   /estimated_length=395
FT   gap             15811428..15811466
FT                   /estimated_length=39
FT   gap             15815507..15815526
FT                   /estimated_length=20
FT   gap             15816693..15816712
FT                   /estimated_length=20
FT   gap             15851138..15851157
FT                   /estimated_length=20
FT   gap             15856972..15857114
FT                   /estimated_length=143
FT   gap             15863765..15863784
FT                   /estimated_length=20
FT   gap             15873681..15873700
FT                   /estimated_length=20
FT   gap             15883299..15883326
FT                   /estimated_length=28
FT   gap             15904625..15904911
FT                   /estimated_length=287
FT   gap             15908581..15908600
FT                   /estimated_length=20
FT   gap             15910280..15910384
FT                   /estimated_length=105
FT   gap             15913048..15913180
FT                   /estimated_length=133
FT   gap             15918868..15918887
FT                   /estimated_length=20
FT   gap             15935293..15935390
FT                   /estimated_length=98
FT   gap             15949910..15950527
FT                   /estimated_length=618
FT   gap             15954775..15956855
FT                   /estimated_length=2081
FT   gap             15966563..15968116
FT                   /estimated_length=1554
FT   gap             15969131..15969188
FT                   /estimated_length=58
FT   gap             15976629..15977405
FT                   /estimated_length=777
FT   gap             15981841..15981860
FT                   /estimated_length=20
FT   gap             15983404..15983423
FT                   /estimated_length=20
FT   gap             15985958..15987594
FT                   /estimated_length=1637
FT   gap             15988799..15988818
FT                   /estimated_length=20
FT   gap             15996609..15996628
FT                   /estimated_length=20
FT   gap             16008303..16008531
FT                   /estimated_length=229
FT   gap             16020215..16020234
FT                   /estimated_length=20
FT   gap             16022731..16023550
FT                   /estimated_length=820
FT   gap             16038689..16040443
FT                   /estimated_length=1755
FT   gap             16047664..16047721
FT                   /estimated_length=58
FT   gap             16054367..16055164
FT                   /estimated_length=798
FT   gap             16067645..16068108
FT                   /estimated_length=464
FT   gap             16089042..16089139
FT                   /estimated_length=98
FT   gap             16118703..16118722
FT                   /estimated_length=20
FT   gap             16129239..16129258
FT                   /estimated_length=20
FT   gap             16135539..16136678
FT                   /estimated_length=1140
FT   gap             16139086..16142071
FT                   /estimated_length=2986
FT   gap             16143590..16145889
FT                   /estimated_length=2300
FT   gap             16150672..16151199
FT                   /estimated_length=528
FT   gap             16152341..16160369
FT                   /estimated_length=8029
FT   gap             16165921..16166759
FT                   /estimated_length=839
FT   gap             16167515..16168598
FT                   /estimated_length=1084
FT   gap             16172724..16173593
FT                   /estimated_length=870
FT   gap             16174620..16174639
FT                   /estimated_length=20
FT   gap             16177850..16178588
FT                   /estimated_length=739
FT   gap             16182068..16188818
FT                   /estimated_length=6751
XX
CO   join(AAHY01208832.1:1..3689,gap(845),AAHY01208833.1:1..1500,gap(543),
CO   AAHY01208834.1:1..914,gap(1627),AAHY01208835.1:1..18159,gap(766),
CO   AAHY01208836.1:1..4305,gap(349),AAHY01208837.1:1..10020,gap(557),
CO   AAHY01208838.1:1..4778,gap(9399),AAHY01208839.1:1..1282,gap(20),
CO   complement(AAHY01208840.1:1..3309),gap(973),
CO   complement(AAHY01208841.1:1..6764),gap(280),AAHY01208842.1:1..27050,
CO   gap(119),AAHY01208843.1:1..41770,gap(11102),AAHY01208844.1:1..15144,
CO   gap(3166),complement(AAHY01208845.1:1..9694),gap(131),
CO   AAHY01208846.1:1..2316,gap(1041),AAHY01208847.1:1..1082,gap(446),
CO   AAHY01208848.1:1..4892,gap(20),complement(AAHY01208849.1:1..22118),
CO   gap(6509),complement(AAHY01208850.1:1..2607),gap(169),
CO   complement(AAHY01208851.1:1..3433),gap(41),AAHY01208852.1:1..17331,
CO   gap(2248),AAHY01208853.1:1..20113,gap(20),AAHY01208854.1:1..16690,gap(20),
CO   AAHY01208855.1:1..2027,gap(20),complement(AAHY01208856.1:1..1946),
CO   gap(2405),AAHY01208857.1:1..5211,gap(240),AAHY01208858.1:1..5721,gap(20),
CO   AAHY01208859.1:1..3209,gap(20),complement(AAHY01208860.1:1..2200),gap(20),
CO   complement(AAHY01208861.1:1..20545),gap(20),
CO   complement(AAHY01208862.1:1..2381),gap(976),AAHY01208863.1:1..11279,
CO   gap(120),AAHY01208864.1:1..17327,gap(26),
CO   complement(AAHY01208865.1:1..1065),gap(226),
CO   complement(AAHY01208866.1:1..1081),gap(757),AAHY01208867.1:1..17422,
CO   gap(144),AAHY01208868.1:1..156881,gap(2857),AAHY01208869.1:1..2812,
CO   gap(602),AAHY01208870.1:1..17038,gap(518),AAHY01208871.1:1..107878,
CO   gap(343),AAHY01208872.1:1..84021,gap(60),AAHY01208873.1:1..113330,gap(20),
CO   AAHY01208874.1:1..3441,gap(301),AAHY01208875.1:1..5267,gap(91),
CO   complement(AAHY01208876.1:1..1617),gap(20),
CO   complement(AAHY01208877.1:1..2016),gap(20),AAHY01208878.1:1..1290,gap(70),
CO   complement(AAHY01208879.1:1..8483),gap(20),AAHY01208880.1:1..13334,
CO   gap(2937),AAHY01208881.1:1..11386,gap(2975),AAHY01208882.1:1..10806,
CO   gap(145),AAHY01208883.1:1..37236,gap(3818),AAHY01208884.1:1..40135,gap(20),
CO   complement(AAHY01208885.1:1..1662),gap(671),AAHY01208886.1:1..7169,
CO   gap(3105),AAHY01208887.1:1..14505,gap(5162),AAHY01208888.1:1..12886,
CO   gap(779),AAHY01208889.1:1..5200,gap(20),AAHY01208890.1:1..1519,gap(122),
CO   AAHY01208891.1:1..11547,gap(167),complement(AAHY01208892.1:1..1891),
CO   gap(207),AAHY01208893.1:1..7802,gap(2557),AAHY01208894.1:1..2406,gap(620),
CO   AAHY01208895.1:1..2461,gap(20),AAHY01208896.1:1..3172,gap(279),
CO   AAHY01208897.1:1..2316,gap(331),AAHY01208898.1:1..2677,gap(1973),
CO   AAHY01208899.1:1..12103,gap(124),complement(AAHY01208900.1:1..25942),
CO   gap(20),AAHY01208901.1:1..25440,gap(36),complement(AAHY01208902.1:1..1418),
CO   gap(166),AAHY01208903.1:1..3188,gap(71),complement(AAHY01208904.1:1..2087),
CO   gap(380),AAHY01208905.1:1..3917,gap(20),AAHY01208906.1:1..4707,gap(20),
CO   AAHY01208907.1:1..5831,gap(20),complement(AAHY01208908.1:1..9557),gap(549),
CO   AAHY01208909.1:1..5876,gap(104),complement(AAHY01208910.1:1..18562),
CO   gap(20),AAHY01208911.1:1..5273,gap(1222),AAHY01208912.1:1..1534,gap(2261),
CO   AAHY01208913.1:1..6940,gap(2656),AAHY01208914.1:1..2997,gap(2240),
CO   AAHY01208915.1:1..23280,gap(20),complement(AAHY01208916.1:1..4178),gap(20),
CO   AAHY01208917.1:1..5189,gap(79),AAHY01208918.1:1..19148,gap(20),
CO   AAHY01208919.1:1..5648,gap(20),AAHY01208920.1:1..7656,gap(20),
CO   AAHY01208921.1:1..4568,gap(2301),AAHY01208922.1:1..1492,gap(863),
CO   AAHY01208923.1:1..35118,gap(20),AAHY01208924.1:1..10809,gap(211),
CO   AAHY01208925.1:1..5500,gap(957),AAHY01208926.1:1..2012,gap(12288),
CO   complement(AAHY01208927.1:1..10044),gap(5310),AAHY01208928.1:1..3426,
CO   gap(532),AAHY01208929.1:1..1071,gap(356),AAHY01208930.1:1..1143,gap(20),
CO   AAHY01208931.1:1..37218,gap(6205),AAHY01208932.1:1..1897,gap(538),
CO   AAHY01208933.1:1..2610,gap(679),AAHY01208934.1:1..4548,gap(720),
CO   AAHY01208935.1:1..8858,gap(475),AAHY01208936.1:1..11980,gap(20),
CO   complement(AAHY01208937.1:1..2218),gap(368),
CO   complement(AAHY01208938.1:1..1165),gap(153),AAHY01208939.1:1..10156,
CO   gap(20),complement(AAHY01208940.1:1..1866),gap(274),AAHY01208941.1:1..2671,
CO   gap(228),AAHY01208942.1:1..68477,gap(1139),AAHY01208943.1:1..2260,gap(567),
CO   AAHY01208944.1:1..8040,gap(20),AAHY01208945.1:1..3201,gap(20),
CO   AAHY01208946.1:1..3930,gap(10967),AAHY01208947.1:1..11021,gap(196),
CO   AAHY01208948.1:1..3424,gap(20),AAHY01208949.1:1..3906,gap(48),
CO   complement(AAHY01208950.1:1..1238),gap(73),AAHY01208951.1:1..32903,
CO   gap(701),AAHY01208952.1:1..15733,gap(680),AAHY01208953.1:1..1373,gap(2478),
CO   complement(AAHY01208954.1:1..3624),gap(20),
CO   complement(AAHY01208955.1:1..8717),gap(20),AAHY01208956.1:1..10740,gap(20),
CO   AAHY01208957.1:1..26015,gap(566),AAHY01208958.1:1..4738,gap(911),
CO   AAHY01208959.1:1..1241,gap(2131),AAHY01208960.1:1..10461,gap(20),
CO   AAHY01208961.1:1..13674,gap(1274),AAHY01208962.1:1..8373,gap(20),
CO   AAHY01208963.1:1..5899,gap(184),AAHY01208964.1:1..13204,gap(1018),
CO   AAHY01208965.1:1..5989,gap(125),AAHY01208966.1:1..388,gap(286),
CO   AAHY01208967.1:1..14469,gap(168),AAHY01208968.1:1..2660,gap(269),
CO   AAHY01208969.1:1..3551,gap(20),complement(AAHY01208970.1:1..1378),gap(160),
CO   AAHY01208971.1:1..3089,gap(226),complement(AAHY01208972.1:1..1981),
CO   gap(163),complement(AAHY01208973.1:1..1749),gap(4925),
CO   AAHY01208974.1:1..2757,gap(402),AAHY01208975.1:1..13927,gap(444),
CO   AAHY01208976.1:1..23351,gap(20),AAHY01208977.1:1..11254,gap(20),
CO   complement(AAHY01208978.1:1..7481),gap(8883),AAHY01208979.1:1..1991,
CO   gap(482),AAHY01208980.1:1..1125,gap(856),AAHY01208981.1:1..7215,gap(20),
CO   AAHY01208982.1:1..2719,gap(20),complement(AAHY01208983.1:1..11126),gap(20),
CO   complement(AAHY01208984.1:1..4821),gap(20),AAHY01208985.1:1..27275,gap(20),
CO   complement(AAHY01208986.1:1..1981),gap(651),
CO   complement(AAHY01208987.1:1..9710),gap(20),AAHY01208988.1:1..6729,gap(404),
CO   AAHY01208989.1:1..17549,gap(20),AAHY01208990.1:1..11068,gap(75),
CO   complement(AAHY01208991.1:1..5679),gap(20),AAHY01208992.1:1..8646,gap(420),
CO   complement(AAHY01208993.1:1..4980),gap(1494),AAHY01208994.1:1..1435,
CO   gap(796),complement(AAHY01208995.1:1..3220),gap(537),
CO   AAHY01208996.1:1..1539,gap(1492),AAHY01208997.1:1..3529,gap(20),
CO   AAHY01208998.1:1..20713,gap(357),AAHY01208999.1:1..1115,gap(211),
CO   complement(AAHY01209000.1:1..19036),gap(20),AAHY01209001.1:1..28107,
CO   gap(20),AAHY01209002.1:1..7156,gap(20),AAHY01209003.1:1..34479,gap(20),
CO   AAHY01209004.1:1..3610,gap(4786),complement(AAHY01209005.1:1..1274),
CO   gap(33),AAHY01209006.1:1..2883,gap(463),AAHY01209007.1:1..2839,gap(131),
CO   complement(AAHY01209008.1:1..10130),gap(20),
CO   complement(AAHY01209009.1:1..7810),gap(71),AAHY01209010.1:1..987,gap(242),
CO   complement(AAHY01209011.1:1..2728),gap(83),
CO   complement(AAHY01209012.1:1..5587),gap(148),
CO   complement(AAHY01209013.1:1..13917),gap(107),AAHY01209014.1:1..20925,
CO   gap(20),complement(AAHY01209015.1:1..6586),gap(20),AAHY01209016.1:1..3089,
CO   gap(20),complement(AAHY01209017.1:1..2989),gap(2209),AAHY01209018.1:1..819,
CO   gap(181),complement(AAHY01209019.1:1..8400),gap(20),
CO   complement(AAHY01209020.1:1..5417),gap(1329),
CO   complement(AAHY01209021.1:1..1730),gap(1245),AAHY01209022.1:1..6942,
CO   gap(20),complement(AAHY01209023.1:1..7813),gap(524),AAHY01209024.1:1..4990,
CO   gap(213),AAHY01209025.1:1..3134,gap(50),AAHY01209026.1:1..10487,gap(20),
CO   complement(AAHY01209027.1:1..1670),gap(20),
CO   complement(AAHY01209028.1:1..1120),gap(20),
CO   complement(AAHY01209029.1:1..3307),gap(635),
CO   complement(AAHY01209030.1:1..4110),gap(486),AAHY01209031.1:1..15788,
CO   gap(153),AAHY01209032.1:1..3599,gap(196),AAHY01209033.1:1..3258,gap(4697),
CO   AAHY01209034.1:1..2399,gap(282),AAHY01209035.1:1..2095,gap(20),
CO   AAHY01209036.1:1..4294,gap(20),complement(AAHY01209037.1:1..15012),
CO   gap(1263),AAHY01209038.1:1..6015,gap(20),AAHY01209039.1:1..13143,gap(69),
CO   AAHY01209040.1:1..7529,gap(20),AAHY01209041.1:1..11407,gap(1380),
CO   AAHY01209042.1:1..19872,gap(20),complement(AAHY01209043.1:1..4093),gap(20),
CO   AAHY01209044.1:1..2053,gap(436),AAHY01209045.1:1..3542,gap(98),
CO   AAHY01209046.1:1..949,gap(204),AAHY01209047.1:1..22076,gap(1871),
CO   AAHY01209048.1:1..6484,gap(20),AAHY01209049.1:1..6693,gap(20),
CO   AAHY01209050.1:1..12042,gap(112),complement(AAHY01209051.1:1..7350),
CO   gap(20),complement(AAHY01209052.1:1..7300),gap(332),
CO   complement(AAHY01209053.1:1..6301),gap(532),AAHY01209054.1:1..4105,gap(20),
CO   complement(AAHY01209055.1:1..1685),gap(37),AAHY01209056.1:1..4343,
CO   gap(10787),AAHY01209057.1:1..12199,gap(246),AAHY01209058.1:1..18487,
CO   gap(314),AAHY01209059.1:1..5034,gap(66),AAHY01209060.1:1..12937,gap(490),
CO   AAHY01209061.1:1..3959,gap(897),complement(AAHY01209062.1:1..7824),gap(59),
CO   complement(AAHY01209063.1:1..30219),gap(358),
CO   complement(AAHY01209064.1:1..30034),gap(79),
CO   complement(AAHY01209065.1:1..4230),gap(20),
CO   complement(AAHY01209066.1:1..1657),gap(113),AAHY01209067.1:1..7975,gap(56),
CO   complement(AAHY01209068.1:1..2030),gap(20),AAHY01209069.1:1..22326,
CO   gap(2499),AAHY01209070.1:1..29643,gap(367),
CO   complement(AAHY01209071.1:1..14675),gap(20),
CO   complement(AAHY01209072.1:1..3043),gap(1876),AAHY01209073.1:1..6929,
CO   gap(1149),AAHY01209074.1:1..11017,gap(210),
CO   complement(AAHY01209075.1:1..838),gap(341),
CO   complement(AAHY01209076.1:1..9486),gap(696),
CO   complement(AAHY01209077.1:1..20473),gap(120),AAHY01209078.1:1..5949,
CO   gap(133),AAHY01209079.1:1..5378,gap(20),AAHY01209080.1:1..6791,gap(20),
CO   AAHY01209081.1:1..8644,gap(99),AAHY01209082.1:1..3598,gap(20),
CO   AAHY01209083.1:1..11769,gap(20),AAHY01209084.1:1..2147,gap(465),
CO   complement(AAHY01209085.1:1..819),gap(572),AAHY01209086.1:1..2050,
CO   gap(6474),AAHY01209087.1:1..26693,gap(42),AAHY01209088.1:1..21744,gap(20),
CO   AAHY01209089.1:1..29875,gap(20),AAHY01209090.1:1..2686,gap(20),
CO   AAHY01209091.1:1..7671,gap(20),AAHY01209092.1:1..32329,gap(639),
CO   AAHY01209093.1:1..890,gap(422),AAHY01209094.1:1..2628,gap(67),
CO   AAHY01209095.1:1..10140,gap(25),AAHY01209096.1:1..9708,gap(186),
CO   AAHY01209097.1:1..3231,gap(20),AAHY01209098.1:1..28843,gap(136),
CO   AAHY01209099.1:1..17424,gap(6018),AAHY01209100.1:1..11839,gap(20),
CO   AAHY01209101.1:1..6710,gap(116),AAHY01209102.1:1..4838,gap(72),
CO   AAHY01209103.1:1..4181,gap(3216),complement(AAHY01209104.1:1..2081),
CO   gap(364),AAHY01209105.1:1..6508,gap(20),AAHY01209106.1:1..12725,gap(20),
CO   AAHY01209107.1:1..14567,gap(67),AAHY01209108.1:1..10838,gap(250),
CO   complement(AAHY01209109.1:1..5672),gap(20),AAHY01209110.1:1..15896,gap(20),
CO   complement(AAHY01209111.1:1..1266),gap(162),AAHY01209112.1:1..6024,gap(20),
CO   AAHY01209113.1:1..6192,gap(20),AAHY01209114.1:1..4600,gap(1289),
CO   complement(AAHY01209115.1:1..3416),gap(131),
CO   complement(AAHY01209116.1:1..4787),gap(75),AAHY01209117.1:1..7508,gap(20),
CO   complement(AAHY01209118.1:1..1566),gap(34),AAHY01209119.1:1..1406,gap(20),
CO   complement(AAHY01209120.1:1..6349),gap(6094),AAHY01209121.1:1..4914,
CO   gap(400),AAHY01209122.1:1..7534,gap(92),AAHY01209123.1:1..14003,gap(20),
CO   AAHY01209124.1:1..3422,gap(140),complement(AAHY01209125.1:1..787),gap(182),
CO   AAHY01209126.1:1..13371,gap(20),AAHY01209127.1:1..772,gap(200),
CO   AAHY01209128.1:1..1619,gap(23),AAHY01209129.1:1..42005,gap(20),
CO   complement(AAHY01209130.1:1..3791),gap(243),AAHY01209131.1:1..4187,
CO   gap(1966),AAHY01209132.1:1..9245,gap(194),AAHY01209133.1:1..22102,
CO   gap(1249),complement(AAHY01209134.1:1..5968),gap(20),
CO   AAHY01209135.1:1..1581,gap(178),AAHY01209136.1:1..13126,gap(20),
CO   complement(AAHY01209137.1:1..4735),gap(169),
CO   complement(AAHY01209138.1:1..8140),gap(20),
CO   complement(AAHY01209139.1:1..4662),gap(604),AAHY01209140.1:1..5469,
CO   gap(3302),AAHY01209141.1:1..3333,gap(2576),AAHY01209142.1:1..5464,gap(20),
CO   complement(AAHY01209143.1:1..2014),gap(553),
CO   complement(AAHY01209144.1:1..2312),gap(20),
CO   complement(AAHY01209145.1:1..11815),gap(20),
CO   complement(AAHY01209146.1:1..15425),gap(20),
CO   complement(AAHY01209147.1:1..5763),gap(1434),AAHY01209148.1:1..11909,
CO   gap(104),AAHY01209149.1:1..18630,gap(91),AAHY01209150.1:1..19528,gap(20),
CO   complement(AAHY01209151.1:1..1233),gap(20),AAHY01209152.1:1..13975,
CO   gap(7422),AAHY01209153.1:1..63551,gap(20),AAHY01209154.1:1..23046,gap(107),
CO   AAHY01209155.1:1..26618,gap(20),AAHY01209156.1:1..1467,gap(20),
CO   complement(AAHY01209157.1:1..34332),gap(315),
CO   complement(AAHY01209158.1:1..1785),gap(72),AAHY01209159.1:1..9055,gap(175),
CO   AAHY01209160.1:1..1230,gap(490),AAHY01209161.1:1..2382,gap(895),
CO   complement(AAHY01209162.1:1..2587),gap(20),AAHY01209163.1:1..4942,
CO   gap(4814),AAHY01209164.1:1..2045,gap(1126),AAHY01209165.1:1..5497,gap(98),
CO   complement(AAHY01209166.1:1..3983),gap(142),AAHY01209167.1:1..21282,
CO   gap(96),AAHY01209168.1:1..19386,gap(371),AAHY01209169.1:1..7065,gap(650),
CO   AAHY01209170.1:1..67945,gap(20),complement(AAHY01209171.1:1..5532),gap(20),
CO   AAHY01209172.1:1..1918,gap(20),complement(AAHY01209173.1:1..2048),gap(421),
CO   AAHY01209174.1:1..741,gap(133),AAHY01209175.1:1..2014,gap(346),
CO   complement(AAHY01209176.1:1..2550),gap(288),
CO   complement(AAHY01209177.1:1..2701),gap(4358),AAHY01209178.1:1..3870,
CO   gap(877),complement(AAHY01209179.1:1..4779),gap(269),
CO   complement(AAHY01209180.1:1..9837),gap(130),
CO   complement(AAHY01209181.1:1..11824),gap(609),
CO   complement(AAHY01209182.1:1..10910),gap(69),AAHY01209183.1:1..12656,
CO   gap(5646),complement(AAHY01209184.1:1..4721),gap(217),
CO   complement(AAHY01209185.1:1..1918),gap(20),AAHY01209186.1:1..12978,gap(20),
CO   AAHY01209187.1:1..12455,gap(20),complement(AAHY01209188.1:1..4203),
CO   gap(7358),complement(AAHY01209189.1:1..5204),gap(1052),
CO   complement(AAHY01209190.1:1..1084),gap(329),
CO   complement(AAHY01209191.1:1..7106),gap(20),
CO   complement(AAHY01209192.1:1..4556),gap(83),AAHY01209193.1:1..3157,
CO   gap(3389),AAHY01209194.1:1..6524,gap(20),AAHY01209195.1:1..6833,gap(38),
CO   AAHY01209196.1:1..9090,gap(215),AAHY01209197.1:1..5505,gap(214),
CO   complement(AAHY01209198.1:1..1500),gap(152),AAHY01209199.1:1..2810,
CO   gap(118),complement(AAHY01209200.1:1..1881),gap(1037),
CO   complement(AAHY01209201.1:1..4039),gap(40),
CO   complement(AAHY01209202.1:1..4207),gap(130),AAHY01209203.1:1..2454,gap(39),
CO   complement(AAHY01209204.1:1..4496),gap(314),AAHY01209205.1:1..8643,
CO   gap(783),complement(AAHY01209206.1:1..3709),gap(32),
CO   complement(AAHY01209207.1:1..10870),gap(20),AAHY01209208.1:1..88193,
CO   gap(20),AAHY01209209.1:1..65786,gap(40),
CO   complement(AAHY01209210.1:1..11315),gap(335),
CO   complement(AAHY01209211.1:1..1358),gap(20),
CO   complement(AAHY01209212.1:1..1900),gap(20),AAHY01209213.1:1..3087,gap(568),
CO   AAHY01209214.1:1..1295,gap(365),AAHY01209215.1:1..5003,gap(55),
CO   AAHY01209216.1:1..3657,gap(330),complement(AAHY01209217.1:1..7156),
CO   gap(153),AAHY01209218.1:1..8273,gap(632),AAHY01209219.1:1..5456,gap(20),
CO   AAHY01209220.1:1..2767,gap(185),complement(AAHY01209221.1:1..390),gap(73),
CO   complement(AAHY01209222.1:1..16567),gap(242),AAHY01209223.1:1..8390,
CO   gap(20),complement(AAHY01209224.1:1..2155),gap(43),AAHY01209225.1:1..24170,
CO   gap(20),complement(AAHY01209226.1:1..2061),gap(20),
CO   complement(AAHY01209227.1:1..3233),gap(104),AAHY01209228.1:1..21065,
CO   gap(20),AAHY01209229.1:1..2509,gap(236),complement(AAHY01209230.1:1..510),
CO   gap(1071),AAHY01209231.1:1..4722,gap(385),AAHY01209232.1:1..5203,gap(790),
CO   AAHY01209233.1:1..18964,gap(20),complement(AAHY01209234.1:1..3076),gap(20),
CO   AAHY01209235.1:1..21253,gap(20),AAHY01209236.1:1..1906,gap(33),
CO   AAHY01209237.1:1..24489,gap(246),AAHY01209238.1:1..1713,gap(906),
CO   complement(AAHY01209239.1:1..3981),gap(339),AAHY01209240.1:1..10392,
CO   gap(166),AAHY01209241.1:1..21904,gap(20),
CO   complement(AAHY01209242.1:1..2105),gap(581),AAHY01209243.1:1..10405,
CO   gap(20),AAHY01209244.1:1..11694,gap(141),
CO   complement(AAHY01209245.1:1..2908),gap(4262),AAHY01209246.1:1..12369,
CO   gap(84),AAHY01209247.1:1..4225,gap(251),AAHY01209248.1:1..7918,gap(2237),
CO   AAHY01209249.1:1..1777,gap(20),complement(AAHY01209250.1:1..9656),gap(20),
CO   AAHY01209251.1:1..1326,gap(402),complement(AAHY01209252.1:1..4602),
CO   gap(370),AAHY01209253.1:1..5132,gap(20),complement(AAHY01209254.1:1..4022),
CO   gap(20),complement(AAHY01209255.1:1..12675),gap(20),AAHY01209256.1:1..5262,
CO   gap(116),AAHY01209257.1:1..2457,gap(20),
CO   complement(AAHY01209258.1:1..19150),gap(1759),AAHY01209259.1:1..1040,
CO   gap(517),AAHY01209260.1:1..9151,gap(20),AAHY01209261.1:1..3701,gap(191),
CO   AAHY01209262.1:1..1384,gap(20),AAHY01209263.1:1..5676,gap(647),
CO   complement(AAHY01209264.1:1..3169),gap(182),
CO   complement(AAHY01209265.1:1..21336),gap(951),
CO   complement(AAHY01209266.1:1..43000),gap(161),AAHY01209267.1:1..1508,
CO   gap(418),complement(AAHY01209268.1:1..2870),gap(181),
CO   complement(AAHY01209269.1:1..4949),gap(157),AAHY01209270.1:1..64761,
CO   gap(2869),AAHY01209271.1:1..63403,gap(5469),AAHY01209272.1:1..46662,
CO   gap(24),AAHY01209273.1:1..22631,gap(20),
CO   complement(AAHY01209274.1:1..51086),gap(20),
CO   complement(AAHY01209275.1:1..64530),gap(20),AAHY01209276.1:1..30096,
CO   gap(20),AAHY01209277.1:1..5910,gap(20),complement(AAHY01209278.1:1..9187),
CO   gap(78),complement(AAHY01209279.1:1..6788),gap(139),
CO   AAHY01209280.1:1..15525,gap(1031),complement(AAHY01209281.1:1..15588),
CO   gap(20),AAHY01209282.1:1..1905,gap(3604),AAHY01209283.1:1..95223,gap(20),
CO   AAHY01209284.1:1..34479,gap(20),AAHY01209285.1:1..19132,gap(20),
CO   complement(AAHY01209286.1:1..7781),gap(20),AAHY01209287.1:1..52544,gap(20),
CO   complement(AAHY01209288.1:1..31668),gap(20),AAHY01209289.1:1..32755,
CO   gap(20),complement(AAHY01209290.1:1..10900),gap(20),
CO   AAHY01209291.1:1..82602,gap(1468),complement(AAHY01209292.1:1..8990),
CO   gap(20),complement(AAHY01209293.1:1..1264),gap(20),
CO   complement(AAHY01209294.1:1..4219),gap(20),
CO   complement(AAHY01209295.1:1..6098),gap(20),
CO   complement(AAHY01209296.1:1..1556),gap(756),AAHY01209297.1:1..18831,
CO   gap(112),complement(AAHY01209298.1:1..5588),gap(20),
CO   AAHY01209299.1:1..43285,gap(94),complement(AAHY01209300.1:1..47508),
CO   gap(20),complement(AAHY01209301.1:1..19591),gap(960),
CO   AAHY01209302.1:1..2013,gap(20),complement(AAHY01209303.1:1..6668),
CO   gap(1175),AAHY01209304.1:1..1167,gap(361),AAHY01209305.1:1..12319,gap(56),
CO   AAHY01209306.1:1..12430,gap(20),complement(AAHY01209307.1:1..3817),gap(20),
CO   complement(AAHY01209308.1:1..762),gap(1006),AAHY01209309.1:1..1079,
CO   gap(166),complement(AAHY01209310.1:1..4458),gap(20),
CO   AAHY01209311.1:1..29772,gap(90),AAHY01209312.1:1..5028,gap(20),
CO   AAHY01209313.1:1..2675,gap(281),AAHY01209314.1:1..5869,gap(120),
CO   AAHY01209315.1:1..25024,gap(20),AAHY01209316.1:1..1394,gap(131),
CO   AAHY01209317.1:1..870,gap(20),complement(AAHY01209318.1:1..2381),gap(552),
CO   AAHY01209319.1:1..25947,gap(513),AAHY01209320.1:1..2341,gap(4511),
CO   AAHY01209321.1:1..2596,gap(240),AAHY01209322.1:1..21018,gap(2248),
CO   AAHY01209323.1:1..2676,gap(1167),AAHY01209324.1:1..12098,gap(5725),
CO   AAHY01209325.1:1..3269,gap(20),AAHY01209326.1:1..9131,gap(20),
CO   complement(AAHY01209327.1:1..6179),gap(536),AAHY01209328.1:1..12410,
CO   gap(20),AAHY01209329.1:1..4013,gap(20),AAHY01209330.1:1..1925,gap(699),
CO   AAHY01209331.1:1..14303,gap(528),AAHY01209332.1:1..13213,gap(39),
CO   AAHY01209333.1:1..2014,gap(20),AAHY01209334.1:1..12167,gap(175),
CO   AAHY01209335.1:1..7477,gap(2667),AAHY01209336.1:1..4119,gap(20),
CO   AAHY01209337.1:1..6626,gap(147),complement(AAHY01209338.1:1..3175),
CO   gap(124),complement(AAHY01209339.1:1..1420),gap(20),AAHY01209340.1:1..4442,
CO   gap(160),AAHY01209341.1:1..16235,gap(20),AAHY01209342.1:1..36717,gap(219),
CO   AAHY01209343.1:1..11263,gap(46),AAHY01209344.1:1..6233,gap(64),
CO   complement(AAHY01209345.1:1..2359),gap(20),
CO   complement(AAHY01209346.1:1..1617),gap(20),AAHY01209347.1:1..36964,gap(20),
CO   AAHY01209348.1:1..2521,gap(485),complement(AAHY01209349.1:1..1246),gap(47),
CO   AAHY01209350.1:1..42304,gap(752),AAHY01209351.1:1..6854,gap(147),
CO   complement(AAHY01209352.1:1..2032),gap(495),AAHY01209353.1:1..10155,
CO   gap(20),AAHY01209354.1:1..19969,gap(158),AAHY01209355.1:1..17429,gap(3381),
CO   AAHY01209356.1:1..1598,gap(2120),AAHY01209357.1:1..1423,gap(2015),
CO   AAHY01209358.1:1..3011,gap(484),AAHY01209359.1:1..1179,gap(885),
CO   AAHY01209360.1:1..7170,gap(193),AAHY01209361.1:1..3700,gap(187),
CO   AAHY01209362.1:1..8354,gap(4600),complement(AAHY01209363.1:1..1295),
CO   gap(1031),complement(AAHY01209364.1:1..6944),gap(73),
CO   complement(AAHY01209365.1:1..15263),gap(20),AAHY01209366.1:1..16351,
CO   gap(20),AAHY01209367.1:1..8599,gap(27),AAHY01209368.1:1..955,gap(496),
CO   AAHY01209369.1:1..1335,gap(95),AAHY01209370.1:1..2915,gap(441),
CO   complement(AAHY01209371.1:1..2631),gap(20),
CO   complement(AAHY01209372.1:1..5877),gap(758),
CO   complement(AAHY01209373.1:1..1042),gap(772),
CO   complement(AAHY01209374.1:1..2340),gap(20),AAHY01209375.1:1..1820,gap(20),
CO   complement(AAHY01209376.1:1..3211),gap(20),
CO   complement(AAHY01209377.1:1..4193),gap(152),AAHY01209378.1:1..13536,
CO   gap(86),complement(AAHY01209379.1:1..1631),gap(20),
CO   complement(AAHY01209380.1:1..7514),gap(1127),
CO   complement(AAHY01209381.1:1..15486),gap(29),AAHY01209382.1:1..3832,gap(66),
CO   AAHY01209383.1:1..4820,gap(20),complement(AAHY01209384.1:1..18578),
CO   gap(6204),AAHY01209385.1:1..741,gap(284),
CO   complement(AAHY01209386.1:1..2564),gap(20),
CO   complement(AAHY01209387.1:1..11433),gap(20),
CO   complement(AAHY01209388.1:1..17465),gap(4669),AAHY01209389.1:1..7009,
CO   gap(2600),AAHY01209390.1:1..12705,gap(376),AAHY01209391.1:1..1004,
CO   gap(1528),AAHY01209392.1:1..1584,gap(1054),AAHY01209393.1:1..6095,gap(189),
CO   complement(AAHY01209394.1:1..3636),gap(1000),AAHY01209395.1:1..6901,
CO   gap(2576),complement(AAHY01209396.1:1..1872),gap(20),
CO   AAHY01209397.1:1..4872,gap(20),AAHY01209398.1:1..2559,gap(359),
CO   AAHY01209399.1:1..837,gap(99),AAHY01209400.1:1..21042,gap(20),
CO   AAHY01209401.1:1..24381,gap(20),AAHY01209402.1:1..38395,gap(151),
CO   AAHY01209403.1:1..4798,gap(5011),AAHY01209404.1:1..12818,gap(651),
CO   complement(AAHY01209405.1:1..2671),gap(20),AAHY01209406.1:1..13081,
CO   gap(676),AAHY01209407.1:1..3346,gap(137),AAHY01209408.1:1..7082,gap(96),
CO   complement(AAHY01209409.1:1..2922),gap(1965),AAHY01209410.1:1..22005,
CO   gap(585),AAHY01209411.1:1..10912,gap(947),
CO   complement(AAHY01209412.1:1..2504),gap(20),AAHY01209413.1:1..1083,
CO   gap(5327),AAHY01209414.1:1..5317,gap(126),AAHY01209415.1:1..8498,gap(4103),
CO   AAHY01209416.1:1..5525,gap(20),complement(AAHY01209417.1:1..1345),gap(20),
CO   AAHY01209418.1:1..1967,gap(20),AAHY01209419.1:1..1550,gap(109),
CO   AAHY01209420.1:1..5467,gap(20),complement(AAHY01209421.1:1..4626),
CO   gap(5385),complement(AAHY01209422.1:1..3671),gap(20),
CO   complement(AAHY01209423.1:1..7473),gap(20),AAHY01209424.1:1..11566,gap(20),
CO   AAHY01209425.1:1..17939,gap(1584),AAHY01209426.1:1..4998,gap(517),
CO   AAHY01209427.1:1..1431,gap(20),complement(AAHY01209428.1:1..2372),gap(20),
CO   complement(AAHY01209429.1:1..7254),gap(32),AAHY01209430.1:1..1300,gap(20),
CO   AAHY01209431.1:1..6674,gap(44),complement(AAHY01209432.1:1..2363),gap(20),
CO   AAHY01209433.1:1..1589,gap(2791),AAHY01209434.1:1..7698,gap(20),
CO   AAHY01209435.1:1..7671,gap(454),AAHY01209436.1:1..5416,gap(67),
CO   AAHY01209437.1:1..14712,gap(1237),AAHY01209438.1:1..4140,gap(20),
CO   AAHY01209439.1:1..1081,gap(646),complement(AAHY01209440.1:1..1307),
CO   gap(137),complement(AAHY01209441.1:1..3468),gap(148),
CO   AAHY01209442.1:1..10692,gap(10019),AAHY01209443.1:1..23619,gap(26),
CO   complement(AAHY01209444.1:1..18982),gap(20),AAHY01209445.1:1..6253,gap(20),
CO   AAHY01209446.1:1..16813,gap(20),AAHY01209447.1:1..1368,gap(6586),
CO   AAHY01209448.1:1..31497,gap(230),complement(AAHY01209449.1:1..11091),
CO   gap(786),AAHY01209450.1:1..10230,gap(402),AAHY01209451.1:1..3860,gap(339),
CO   AAHY01209452.1:1..4510,gap(367),complement(AAHY01209453.1:1..12962),
CO   gap(20),AAHY01209454.1:1..8656,gap(204),AAHY01209455.1:1..6493,gap(1181),
CO   AAHY01209456.1:1..11648,gap(27),AAHY01209457.1:1..22798,gap(152),
CO   AAHY01209458.1:1..2389,gap(393),AAHY01209459.1:1..2078,gap(910),
CO   AAHY01209460.1:1..10571,gap(20),AAHY01209461.1:1..36422,gap(249),
CO   AAHY01209462.1:1..4202,gap(535),AAHY01209463.1:1..5262,gap(20),
CO   AAHY01209464.1:1..1025,gap(118),AAHY01209465.1:1..7420,gap(75),
CO   AAHY01209466.1:1..8549,gap(20),AAHY01209467.1:1..11055,gap(20),
CO   AAHY01209468.1:1..3933,gap(20),AAHY01209469.1:1..31912,gap(430),
CO   AAHY01209470.1:1..3857,gap(20),complement(AAHY01209471.1:1..12924),
CO   gap(6972),AAHY01209472.1:1..3053,gap(35),AAHY01209473.1:1..13839,gap(261),
CO   AAHY01209474.1:1..14653,gap(556),AAHY01209475.1:1..8997,gap(20),
CO   AAHY01209476.1:1..1245,gap(20),complement(AAHY01209477.1:1..1444),gap(20),
CO   AAHY01209478.1:1..18457,gap(20),AAHY01209479.1:1..1061,gap(83),
CO   AAHY01209480.1:1..21120,gap(203),AAHY01209481.1:1..1705,gap(1119),
CO   AAHY01209482.1:1..12038,gap(407),complement(AAHY01209483.1:1..2901),
CO   gap(20),AAHY01209484.1:1..1404,gap(20),AAHY01209485.1:1..7103,gap(313),
CO   AAHY01209486.1:1..658,gap(20),AAHY01209487.1:1..14003,gap(20),
CO   AAHY01209488.1:1..20988,gap(1015),complement(AAHY01209489.1:1..11082),
CO   gap(20),complement(AAHY01209490.1:1..2495),gap(120),
CO   AAHY01209491.1:1..21187,gap(20),complement(AAHY01209492.1:1..2113),gap(77),
CO   AAHY01209493.1:1..1047,gap(283),complement(AAHY01209494.1:1..3672),
CO   gap(178),complement(AAHY01209495.1:1..2080),gap(548),
CO   complement(AAHY01209496.1:1..2942),gap(854),
CO   complement(AAHY01209497.1:1..2735),gap(179),
CO   complement(AAHY01209498.1:1..6487),gap(16888),AAHY01209499.1:1..8539,
CO   gap(7118),AAHY01209500.1:1..2088,gap(20),
CO   complement(AAHY01209501.1:1..13041),gap(20),
CO   complement(AAHY01209502.1:1..33330),gap(20),AAHY01209503.1:1..2803,
CO   gap(170),AAHY01209504.1:1..4244,gap(54),complement(AAHY01209505.1:1..9301),
CO   gap(30),AAHY01209506.1:1..19690,gap(20),
CO   complement(AAHY01209507.1:1..16636),gap(28),
CO   complement(AAHY01209508.1:1..11051),gap(6639),
CO   complement(AAHY01209509.1:1..2475),gap(122),AAHY01209510.1:1..985,gap(213),
CO   AAHY01209511.1:1..24659,gap(109),complement(AAHY01209512.1:1..19296),
CO   gap(20),complement(AAHY01209513.1:1..23122),gap(161),
CO   AAHY01209514.1:1..16461,gap(617),AAHY01209515.1:1..2981,gap(20),
CO   complement(AAHY01209516.1:1..13449),gap(141),
CO   complement(AAHY01209517.1:1..1778),gap(20),
CO   complement(AAHY01209518.1:1..13860),gap(42),
CO   complement(AAHY01209519.1:1..3379),gap(781),AAHY01209520.1:1..3391,
CO   gap(723),complement(AAHY01209521.1:1..1292),gap(20),
CO   complement(AAHY01209522.1:1..7899),gap(175),AAHY01209523.1:1..5621,gap(20),
CO   AAHY01209524.1:1..4844,gap(42),AAHY01209525.1:1..2213,gap(764),
CO   AAHY01209526.1:1..2327,gap(1248),complement(AAHY01209527.1:1..23370),
CO   gap(20),complement(AAHY01209528.1:1..6148),gap(193),
CO   AAHY01209529.1:1..33851,gap(20),AAHY01209530.1:1..2437,gap(94),
CO   AAHY01209531.1:1..19451,gap(4691),AAHY01209532.1:1..8666,gap(66),
CO   AAHY01209533.1:1..1348,gap(351),AAHY01209534.1:1..2138,gap(6344),
CO   complement(AAHY01209535.1:1..6523),gap(20),
CO   complement(AAHY01209536.1:1..2045),gap(20),AAHY01209537.1:1..2618,gap(20),
CO   AAHY01209538.1:1..2302,gap(431),complement(AAHY01209539.1:1..1524),
CO   gap(3048),complement(AAHY01209540.1:1..2413),gap(496),
CO   AAHY01209541.1:1..21032,gap(20),AAHY01209542.1:1..4558,gap(109),
CO   AAHY01209543.1:1..1967,gap(211),AAHY01209544.1:1..5491,gap(20),
CO   complement(AAHY01209545.1:1..1573),gap(73),
CO   complement(AAHY01209546.1:1..10166),gap(20),AAHY01209547.1:1..1942,
CO   gap(143),AAHY01209548.1:1..546,gap(20),AAHY01209549.1:1..39775,gap(176),
CO   complement(AAHY01209550.1:1..7409),gap(20),
CO   complement(AAHY01209551.1:1..16068),gap(20),
CO   complement(AAHY01209552.1:1..6995),gap(20),AAHY01209553.1:1..12378,gap(20),
CO   AAHY01209554.1:1..16221,gap(20),AAHY01209555.1:1..7415,gap(725),
CO   complement(AAHY01209556.1:1..7983),gap(20),AAHY01209557.1:1..898,gap(875),
CO   complement(AAHY01209558.1:1..7211),gap(208),AAHY01209559.1:1..24006,
CO   gap(20),complement(AAHY01209560.1:1..12310),gap(207),
CO   AAHY01209561.1:1..1221,gap(20),AAHY01209562.1:1..3334,gap(20),
CO   complement(AAHY01209563.1:1..6865),gap(20),AAHY01209564.1:1..17102,gap(20),
CO   AAHY01209565.1:1..7730,gap(20),complement(AAHY01209566.1:1..4034),gap(158),
CO   complement(AAHY01209567.1:1..3393),gap(1288),
CO   complement(AAHY01209568.1:1..8841),gap(188),
CO   complement(AAHY01209569.1:1..3362),gap(20),
CO   complement(AAHY01209570.1:1..19810),gap(211),
CO   complement(AAHY01209571.1:1..1309),gap(20),AAHY01209572.1:1..2297,gap(20),
CO   AAHY01209573.1:1..3540,gap(20),AAHY01209574.1:1..1046,gap(20),
CO   complement(AAHY01209575.1:1..1506),gap(2811),
CO   complement(AAHY01209576.1:1..4194),gap(88),AAHY01209577.1:1..29368,
CO   gap(1021),complement(AAHY01209578.1:1..8485),gap(20),
CO   AAHY01209579.1:1..1531,gap(1898),AAHY01209580.1:1..1876,gap(45),
CO   AAHY01209581.1:1..13712,gap(220),complement(AAHY01209582.1:1..9537),
CO   gap(20),complement(AAHY01209583.1:1..13845),gap(20),AAHY01209584.1:1..2664,
CO   gap(76),AAHY01209585.1:1..20325,gap(20),AAHY01209586.1:1..10830,gap(20),
CO   AAHY01209587.1:1..17817,gap(336),AAHY01209588.1:1..1347,gap(20),
CO   AAHY01209589.1:1..13878,gap(20),AAHY01209590.1:1..10918,gap(20),
CO   AAHY01209591.1:1..3196,gap(333),complement(AAHY01209592.1:1..7527),gap(20),
CO   complement(AAHY01209593.1:1..23038),gap(59),
CO   complement(AAHY01209594.1:1..7520),gap(183),AAHY01209595.1:1..18583,
CO   gap(108),AAHY01209596.1:1..10806,gap(29),
CO   complement(AAHY01209597.1:1..4690),gap(92),AAHY01209598.1:1..3947,gap(20),
CO   AAHY01209599.1:1..2031,gap(782),complement(AAHY01209600.1:1..1125),
CO   gap(8133),AAHY01209601.1:1..23210,gap(20),AAHY01209602.1:1..20591,
CO   gap(5038),complement(AAHY01209603.1:1..10344),gap(430),
CO   AAHY01209604.1:1..3978,gap(233),AAHY01209605.1:1..16398,gap(3234),
CO   AAHY01209606.1:1..1900,gap(467),AAHY01209607.1:1..3108,gap(20),
CO   AAHY01209608.1:1..9126,gap(224),complement(AAHY01209609.1:1..5582),
CO   gap(136),AAHY01209610.1:1..29095,gap(20),AAHY01209611.1:1..6688,gap(20),
CO   AAHY01209612.1:1..7488,gap(20),AAHY01209613.1:1..7337,gap(20),
CO   AAHY01209614.1:1..54557,gap(20),AAHY01209615.1:1..18671,gap(4139),
CO   AAHY01209616.1:1..3452,gap(20),AAHY01209617.1:1..20138,gap(20),
CO   AAHY01209618.1:1..7657,gap(20),AAHY01209619.1:1..5007,gap(45),
CO   AAHY01209620.1:1..4626,gap(20),AAHY01209621.1:1..20838,gap(1551),
CO   AAHY01209622.1:1..2621,gap(2571),AAHY01209623.1:1..1914,gap(20),
CO   AAHY01209624.1:1..3223,gap(20),complement(AAHY01209625.1:1..7224),gap(20),
CO   AAHY01209626.1:1..1175,gap(20),AAHY01209627.1:1..12908,gap(330),
CO   complement(AAHY01209628.1:1..8200),gap(20),
CO   complement(AAHY01209629.1:1..1421),gap(20),AAHY01209630.1:1..4683,gap(96),
CO   AAHY01209631.1:1..1463,gap(20),AAHY01209632.1:1..39931,gap(120),
CO   AAHY01209633.1:1..6652,gap(20),AAHY01209634.1:1..5922,gap(183),
CO   AAHY01209635.1:1..849,gap(2706),AAHY01209636.1:1..1335,gap(101),
CO   AAHY01209637.1:1..8545,gap(20),AAHY01209638.1:1..3512,gap(142),
CO   AAHY01209639.1:1..16448,gap(74),AAHY01209640.1:1..4902,gap(20),
CO   AAHY01209641.1:1..12385,gap(20),AAHY01209642.1:1..622,gap(394),
CO   AAHY01209643.1:1..7034,gap(20),complement(AAHY01209644.1:1..4065),gap(20),
CO   AAHY01209645.1:1..7634,gap(1098),AAHY01209646.1:1..19335,gap(201),
CO   AAHY01209647.1:1..25313,gap(20),AAHY01209648.1:1..8420,gap(20),
CO   AAHY01209649.1:1..5783,gap(20),AAHY01209650.1:1..6113,gap(63),
CO   complement(AAHY01209651.1:1..5485),gap(20),AAHY01209652.1:1..2427,gap(20),
CO   complement(AAHY01209653.1:1..9709),gap(1937),
CO   complement(AAHY01209654.1:1..808),gap(96),
CO   complement(AAHY01209655.1:1..8440),gap(20),
CO   complement(AAHY01209656.1:1..1604),gap(20),AAHY01209657.1:1..7244,
CO   gap(4091),AAHY01209658.1:1..13168,gap(409),AAHY01209659.1:1..1409,
CO   gap(1874),AAHY01209660.1:1..7700,gap(20),
CO   complement(AAHY01209661.1:1..19929),gap(20),
CO   complement(AAHY01209662.1:1..1231),gap(20),AAHY01209663.1:1..63683,gap(20),
CO   complement(AAHY01209664.1:1..4926),gap(20),
CO   complement(AAHY01209665.1:1..1703),gap(20),AAHY01209666.1:1..1913,gap(665),
CO   complement(AAHY01209667.1:1..1918),gap(394),AAHY01209668.1:1..11918,
CO   gap(694),complement(AAHY01209669.1:1..14517),gap(20),
CO   AAHY01209670.1:1..16351,gap(20),AAHY01209671.1:1..9024,gap(5006),
CO   complement(AAHY01209672.1:1..6957),gap(1034),AAHY01209673.1:1..2942,
CO   gap(892),AAHY01209674.1:1..865,gap(154),complement(AAHY01209675.1:1..2671),
CO   gap(20),AAHY01209676.1:1..17480,gap(20),
CO   complement(AAHY01209677.1:1..12343),gap(47),AAHY01209678.1:1..5060,
CO   gap(419),AAHY01209679.1:1..8071,gap(20),AAHY01209680.1:1..10330,gap(20),
CO   complement(AAHY01209681.1:1..5897),gap(20),
CO   complement(AAHY01209682.1:1..13858),gap(114),
CO   complement(AAHY01209683.1:1..4008),gap(20),
CO   complement(AAHY01209684.1:1..5154),gap(20),AAHY01209685.1:1..5433,gap(20),
CO   complement(AAHY01209686.1:1..5311),gap(247),AAHY01209687.1:1..5791,gap(20),
CO   complement(AAHY01209688.1:1..15901),gap(2159),
CO   complement(AAHY01209689.1:1..1149),gap(731),AAHY01209690.1:1..8906,gap(20),
CO   complement(AAHY01209691.1:1..3229),gap(6696),AAHY01209692.1:1..3362,
CO   gap(177),complement(AAHY01209693.1:1..7723),gap(143),
CO   complement(AAHY01209694.1:1..3861),gap(20),
CO   complement(AAHY01209695.1:1..2301),gap(20),
CO   complement(AAHY01209696.1:1..7846),gap(96),
CO   complement(AAHY01209697.1:1..28385),gap(189),
CO   complement(AAHY01209698.1:1..2552),gap(824),
CO   complement(AAHY01209699.1:1..4067),gap(815),AAHY01209700.1:1..8906,gap(20),
CO   complement(AAHY01209701.1:1..25594),gap(20),AAHY01209702.1:1..35151,
CO   gap(225),complement(AAHY01209703.1:1..5678),gap(33),AAHY01209704.1:1..901,
CO   gap(426),AAHY01209705.1:1..5748,gap(415),AAHY01209706.1:1..9705,gap(59),
CO   complement(AAHY01209707.1:1..43680),gap(122),
CO   complement(AAHY01209708.1:1..6356),gap(20),AAHY01209709.1:1..2294,gap(26),
CO   AAHY01209710.1:1..2918,gap(20),AAHY01209711.1:1..2434,gap(422),
CO   AAHY01209712.1:1..2873,gap(6162),AAHY01209713.1:1..14393,gap(20),
CO   AAHY01209714.1:1..19392,gap(177),AAHY01209715.1:1..14879,gap(447),
CO   AAHY01209716.1:1..838,gap(20),AAHY01209717.1:1..1202,gap(636),
CO   AAHY01209718.1:1..2827,gap(20),AAHY01209719.1:1..2253,gap(515),
CO   complement(AAHY01209720.1:1..802),gap(3201),AAHY01209721.1:1..8771,
CO   gap(419),AAHY01209722.1:1..2945,gap(20),AAHY01209723.1:1..8942,gap(20),
CO   AAHY01209724.1:1..3039,gap(20),AAHY01209725.1:1..40020,gap(20),
CO   AAHY01209726.1:1..13391,gap(20),complement(AAHY01209727.1:1..1512),gap(20),
CO   AAHY01209728.1:1..14270,gap(499),AAHY01209729.1:1..4516,gap(94),
CO   AAHY01209730.1:1..13389,gap(20),AAHY01209731.1:1..6676,gap(20),
CO   AAHY01209732.1:1..1671,gap(155),AAHY01209733.1:1..1538,gap(1075),
CO   complement(AAHY01209734.1:1..1629),gap(597),AAHY01209735.1:1..2274,gap(20),
CO   complement(AAHY01209736.1:1..3248),gap(20),
CO   complement(AAHY01209737.1:1..12354),gap(20),
CO   complement(AAHY01209738.1:1..6603),gap(20),
CO   complement(AAHY01209739.1:1..4830),gap(96),
CO   complement(AAHY01209740.1:1..5394),gap(364),AAHY01209741.1:1..30171,
CO   gap(79),complement(AAHY01209742.1:1..5640),gap(387),AAHY01209743.1:1..4371,
CO   gap(20),AAHY01209744.1:1..15025,gap(20),AAHY01209745.1:1..8909,gap(20),
CO   complement(AAHY01209746.1:1..4845),gap(443),AAHY01209747.1:1..27230,
CO   gap(20),complement(AAHY01209748.1:1..2322),gap(507),
CO   AAHY01209749.1:1..36336,gap(120),complement(AAHY01209750.1:1..7410),
CO   gap(20),AAHY01209751.1:1..1183,gap(252),complement(AAHY01209752.1:1..2124),
CO   gap(313),AAHY01209753.1:1..19877,gap(2141),AAHY01209754.1:1..5212,gap(20),
CO   AAHY01209755.1:1..15087,gap(3776),AAHY01209756.1:1..33693,gap(20),
CO   AAHY01209757.1:1..20797,gap(181),AAHY01209758.1:1..13529,gap(488),
CO   complement(AAHY01209759.1:1..1926),gap(20),AAHY01209760.1:1..10470,
CO   gap(524),AAHY01209761.1:1..9764,gap(177),AAHY01209762.1:1..18313,gap(739),
CO   AAHY01209763.1:1..1086,gap(20),AAHY01209764.1:1..5892,gap(202),
CO   AAHY01209765.1:1..6183,gap(363),AAHY01209766.1:1..23151,gap(20),
CO   AAHY01209767.1:1..20480,gap(645),complement(AAHY01209768.1:1..8343),
CO   gap(20),complement(AAHY01209769.1:1..19369),gap(265),
CO   complement(AAHY01209770.1:1..38033),gap(20),AAHY01209771.1:1..4526,
CO   gap(327),AAHY01209772.1:1..20967,gap(20),AAHY01209773.1:1..34452,gap(389),
CO   complement(AAHY01209774.1:1..33339),gap(20),
CO   complement(AAHY01209775.1:1..6114),gap(20),AAHY01209776.1:1..12505,gap(59),
CO   AAHY01209777.1:1..15163,gap(20),AAHY01209778.1:1..8921,gap(113),
CO   AAHY01209779.1:1..8137,gap(20),AAHY01209780.1:1..2266,gap(276),
CO   complement(AAHY01209781.1:1..1578),gap(20),AAHY01209782.1:1..6464,gap(183),
CO   AAHY01209783.1:1..12720,gap(20),AAHY01209784.1:1..20195,gap(179),
CO   AAHY01209785.1:1..7833,gap(20),AAHY01209786.1:1..2198,gap(103),
CO   complement(AAHY01209787.1:1..9770),gap(200),
CO   complement(AAHY01209788.1:1..2724),gap(20),AAHY01209789.1:1..5420,gap(20),
CO   complement(AAHY01209790.1:1..7611),gap(33),AAHY01209791.1:1..2353,gap(20),
CO   AAHY01209792.1:1..2085,gap(207),AAHY01209793.1:1..2481,gap(24),
CO   AAHY01209794.1:1..5119,gap(20),AAHY01209795.1:1..3155,gap(42),
CO   AAHY01209796.1:1..7128,gap(182),AAHY01209797.1:1..961,gap(850),
CO   complement(AAHY01209798.1:1..2753),gap(4122),AAHY01209799.1:1..9113,
CO   gap(352),complement(AAHY01209800.1:1..3420),gap(20),AAHY01209801.1:1..2054,
CO   gap(20),AAHY01209802.1:1..8315,gap(166),AAHY01209803.1:1..6615,gap(1115),
CO   AAHY01209804.1:1..1738,gap(154),complement(AAHY01209805.1:1..1163),
CO   gap(772),AAHY01209806.1:1..6506,gap(639),
CO   complement(AAHY01209807.1:1..1113),gap(1051),AAHY01209808.1:1..4247,
CO   gap(629),AAHY01209809.1:1..3443,gap(514),AAHY01209810.1:1..5823,gap(36),
CO   AAHY01209811.1:1..7743,gap(737),complement(AAHY01209812.1:1..13358),
CO   gap(20),AAHY01209813.1:1..15151,gap(20),AAHY01209814.1:1..15944,gap(20),
CO   AAHY01209815.1:1..6454,gap(329),complement(AAHY01209816.1:1..3155),
CO   gap(205),AAHY01209817.1:1..5124,gap(641),AAHY01209818.1:1..6077,gap(20),
CO   AAHY01209819.1:1..19350,gap(20),complement(AAHY01209820.1:1..2456),
CO   gap(1049),AAHY01209821.1:1..2595,gap(20),
CO   complement(AAHY01209822.1:1..1751),gap(1184),AAHY01209823.1:1..5796,
CO   gap(145),AAHY01209824.1:1..2432,gap(20),AAHY01209825.1:1..774,gap(908),
CO   AAHY01209826.1:1..7096,gap(2201),AAHY01209827.1:1..12101,gap(732),
CO   complement(AAHY01209828.1:1..5702),gap(655),
CO   complement(AAHY01209829.1:1..1037),gap(20),
CO   complement(AAHY01209830.1:1..12236),gap(20),AAHY01209831.1:1..7247,gap(20),
CO   AAHY01209832.1:1..3729,gap(20),AAHY01209833.1:1..7842,gap(77),
CO   complement(AAHY01209834.1:1..1072),gap(79),
CO   complement(AAHY01209835.1:1..1898),gap(292),
CO   complement(AAHY01209836.1:1..1382),gap(896),AAHY01209837.1:1..6050,gap(20),
CO   AAHY01209838.1:1..8676,gap(20),AAHY01209839.1:1..10567,gap(117),
CO   AAHY01209840.1:1..5255,gap(749),AAHY01209841.1:1..2345,gap(482),
CO   complement(AAHY01209842.1:1..1480),gap(20),
CO   complement(AAHY01209843.1:1..1574),gap(798),AAHY01209844.1:1..1507,
CO   gap(322),AAHY01209845.1:1..21928,gap(3677),AAHY01209846.1:1..2318,gap(747),
CO   complement(AAHY01209847.1:1..1446),gap(1079),AAHY01209848.1:1..1703,
CO   gap(20),AAHY01209849.1:1..3510,gap(681),AAHY01209850.1:1..1316,gap(20),
CO   complement(AAHY01209851.1:1..4032),gap(979),AAHY01209852.1:1..5075,gap(20),
CO   AAHY01209853.1:1..12485,gap(230),AAHY01209854.1:1..4065,gap(20),
CO   complement(AAHY01209855.1:1..1033),gap(145),AAHY01209856.1:1..2996,
CO   gap(1091),AAHY01209857.1:1..5855,gap(105),AAHY01209858.1:1..6993,gap(180),
CO   AAHY01209859.1:1..4783,gap(20),complement(AAHY01209860.1:1..23543),gap(20),
CO   AAHY01209861.1:1..13956,gap(37),AAHY01209862.1:1..3429,gap(2045),
CO   AAHY01209863.1:1..12777,gap(308),AAHY01209864.1:1..21071,gap(25785),
CO   AAHY01209865.1:1..1490,gap(20),complement(AAHY01209866.1:1..1115),
CO   gap(3042),AAHY01209867.1:1..1110,gap(20),AAHY01209868.1:1..18577,gap(190),
CO   complement(AAHY01209869.1:1..2147),gap(362),
CO   complement(AAHY01209870.1:1..27505),gap(20),
CO   complement(AAHY01209871.1:1..16523),gap(530),
CO   complement(AAHY01209872.1:1..1426),gap(41),AAHY01209873.1:1..11072,
CO   gap(1720),AAHY01209874.1:1..13907,gap(20),
CO   complement(AAHY01209875.1:1..2486),gap(724),AAHY01209876.1:1..2157,gap(20),
CO   complement(AAHY01209877.1:1..31724),gap(38),
CO   complement(AAHY01209878.1:1..4298),gap(20),
CO   complement(AAHY01209879.1:1..2252),gap(20),AAHY01209880.1:1..20868,
CO   gap(312),complement(AAHY01209881.1:1..4061),gap(819),
CO   complement(AAHY01209882.1:1..4401),gap(179),
CO   complement(AAHY01209883.1:1..3466),gap(20),AAHY01209884.1:1..3259,gap(20),
CO   complement(AAHY01209885.1:1..4922),gap(1263),AAHY01209886.1:1..1074,
CO   gap(20),AAHY01209887.1:1..2099,gap(20),complement(AAHY01209888.1:1..4363),
CO   gap(489),AAHY01209889.1:1..1165,gap(2898),AAHY01209890.1:1..1251,gap(229),
CO   AAHY01209891.1:1..42575,gap(128),complement(AAHY01209892.1:1..1141),
CO   gap(153),AAHY01209893.1:1..13535,gap(20),AAHY01209894.1:1..11610,gap(122),
CO   AAHY01209895.1:1..1798,gap(20),complement(AAHY01209896.1:1..17350),
CO   gap(283),complement(AAHY01209897.1:1..50583),gap(57),
CO   AAHY01209898.1:1..5789,gap(20),AAHY01209899.1:1..2117,gap(20),
CO   complement(AAHY01209900.1:1..12242),gap(340),
CO   complement(AAHY01209901.1:1..1236),gap(812),AAHY01209902.1:1..5730,gap(20),
CO   complement(AAHY01209903.1:1..25153),gap(20),AAHY01209904.1:1..4218,
CO   gap(129),complement(AAHY01209905.1:1..4502),gap(20),AAHY01209906.1:1..1806,
CO   gap(196),complement(AAHY01209907.1:1..21626),gap(20),
CO   complement(AAHY01209908.1:1..1013),gap(120),
CO   complement(AAHY01209909.1:1..3251),gap(20),AAHY01209910.1:1..2771,
CO   gap(1678),AAHY01209911.1:1..33262,gap(891),AAHY01209912.1:1..5235,gap(347),
CO   AAHY01209913.1:1..28934,gap(1110),complement(AAHY01209914.1:1..14174),
CO   gap(20),complement(AAHY01209915.1:1..1633),gap(28),
CO   complement(AAHY01209916.1:1..9604),gap(403),AAHY01209917.1:1..1560,gap(20),
CO   AAHY01209918.1:1..4647,gap(20),complement(AAHY01209919.1:1..2508),gap(20),
CO   AAHY01209920.1:1..3070,gap(104),complement(AAHY01209921.1:1..688),gap(549),
CO   AAHY01209922.1:1..2633,gap(822),AAHY01209923.1:1..36867,gap(20),
CO   complement(AAHY01209924.1:1..14803),gap(20),
CO   complement(AAHY01209925.1:1..388),gap(20),AAHY01209926.1:1..13511,gap(993),
CO   complement(AAHY01209927.1:1..3411),gap(29),AAHY01209928.1:1..10878,
CO   gap(2661),AAHY01209929.1:1..6915,gap(20),
CO   complement(AAHY01209930.1:1..1879),gap(389),AAHY01209931.1:1..3191,
CO   gap(231),AAHY01209932.1:1..22704,gap(20),AAHY01209933.1:1..4942,gap(20),
CO   AAHY01209934.1:1..1535,gap(312),AAHY01209935.1:1..3412,gap(103),
CO   AAHY01209936.1:1..17462,gap(136),AAHY01209937.1:1..19689,gap(20),
CO   AAHY01209938.1:1..3148,gap(1109),AAHY01209939.1:1..1927,gap(20),
CO   AAHY01209940.1:1..16062,gap(461),complement(AAHY01209941.1:1..19129),
CO   gap(20),AAHY01209942.1:1..9942,gap(50),AAHY01209943.1:1..8663,gap(20),
CO   AAHY01209944.1:1..6573,gap(181),AAHY01209945.1:1..37836,gap(133),
CO   AAHY01209946.1:1..6781,gap(649),AAHY01209947.1:1..8256,gap(1021),
CO   AAHY01209948.1:1..7912,gap(20),AAHY01209949.1:1..1093,gap(1594),
CO   complement(AAHY01209950.1:1..1767),gap(92),
CO   complement(AAHY01209951.1:1..1722),gap(20),
CO   complement(AAHY01209952.1:1..11972),gap(120),AAHY01209953.1:1..16198,
CO   gap(10662),complement(AAHY01209954.1:1..1441),gap(20),
CO   complement(AAHY01209955.1:1..11996),gap(20),AAHY01209956.1:1..12229,
CO   gap(425),complement(AAHY01209957.1:1..2849),gap(141),
CO   AAHY01209958.1:1..2205,gap(875),AAHY01209959.1:1..2143,gap(1457),
CO   complement(AAHY01209960.1:1..18503),gap(97),
CO   complement(AAHY01209961.1:1..2647),gap(47),
CO   complement(AAHY01209962.1:1..20480),gap(20),
CO   complement(AAHY01209963.1:1..8071),gap(544),
CO   complement(AAHY01209964.1:1..889),gap(895),AAHY01209965.1:1..18075,gap(20),
CO   AAHY01209966.1:1..6085,gap(688),complement(AAHY01209967.1:1..3476),gap(74),
CO   complement(AAHY01209968.1:1..20654),gap(20),AAHY01209969.1:1..11124,
CO   gap(20),complement(AAHY01209970.1:1..8048),gap(20),AAHY01209971.1:1..27189,
CO   gap(95),complement(AAHY01209972.1:1..3528),gap(281),
CO   complement(AAHY01209973.1:1..1940),gap(98),
CO   complement(AAHY01209974.1:1..28096),gap(183),AAHY01209975.1:1..10143,
CO   gap(926),AAHY01209976.1:1..7560,gap(2484),AAHY01209977.1:1..9900,gap(2777),
CO   AAHY01209978.1:1..3215,gap(20),AAHY01209979.1:1..2680,gap(20),
CO   AAHY01209980.1:1..5622,gap(1085),complement(AAHY01209981.1:1..1951),
CO   gap(344),complement(AAHY01209982.1:1..3165),gap(153),
CO   AAHY01209983.1:1..11902,gap(6463),AAHY01209984.1:1..11272,gap(20),
CO   AAHY01209985.1:1..13569,gap(113),complement(AAHY01209986.1:1..4543),
CO   gap(20),complement(AAHY01209987.1:1..3841),gap(437),
CO   complement(AAHY01209988.1:1..638),gap(252),AAHY01209989.1:1..10150,gap(20),
CO   complement(AAHY01209990.1:1..5442),gap(2212),AAHY01209991.1:1..1884,
CO   gap(515),AAHY01209992.1:1..2304,gap(20),complement(AAHY01209993.1:1..1327),
CO   gap(1995),complement(AAHY01209994.1:1..6419),gap(20),
CO   complement(AAHY01209995.1:1..9237),gap(11968),
CO   complement(AAHY01209996.1:1..3479),gap(20),
CO   complement(AAHY01209997.1:1..2507),gap(38),AAHY01209998.1:1..6007,gap(413),
CO   AAHY01209999.1:1..5038,gap(254),complement(AAHY01210000.1:1..4960),
CO   gap(555),complement(AAHY01210001.1:1..1831),gap(20),AAHY01210002.1:1..9712,
CO   gap(103),AAHY01210003.1:1..3701,gap(160),AAHY01210004.1:1..11560,gap(20),
CO   AAHY01210005.1:1..15415,gap(4814),AAHY01210006.1:1..7689,gap(1344),
CO   AAHY01210007.1:1..8491,gap(2885),AAHY01210008.1:1..7744,gap(20),
CO   complement(AAHY01210009.1:1..9209),gap(20),AAHY01210010.1:1..2213,
CO   gap(1324),AAHY01210011.1:1..1014,gap(1115),
CO   complement(AAHY01210012.1:1..1761),gap(20),AAHY01210013.1:1..2315,gap(20),
CO   AAHY01210014.1:1..1968,gap(4720),AAHY01210015.1:1..17140,gap(20),
CO   AAHY01210016.1:1..1395,gap(833),AAHY01210017.1:1..7492,gap(32),
CO   complement(AAHY01210018.1:1..1419),gap(20),AAHY01210019.1:1..5199,gap(445),
CO   complement(AAHY01210020.1:1..7826),gap(1429),AAHY01210021.1:1..1813,
CO   gap(591),AAHY01210022.1:1..7217,gap(314),AAHY01210023.1:1..3171,gap(20),
CO   AAHY01210024.1:1..4539,gap(20),AAHY01210025.1:1..41084,gap(20),
CO   AAHY01210026.1:1..6232,gap(121),AAHY01210027.1:1..12437,gap(5138),
CO   AAHY01210028.1:1..3484,gap(20),AAHY01210029.1:1..3078,gap(873),
CO   AAHY01210030.1:1..2793,gap(20),complement(AAHY01210031.1:1..17105),
CO   gap(156),AAHY01210032.1:1..4281,gap(62),AAHY01210033.1:1..4173,gap(3673),
CO   AAHY01210034.1:1..6565,gap(534),AAHY01210035.1:1..498,gap(748),
CO   AAHY01210036.1:1..5234,gap(369),AAHY01210037.1:1..1914,gap(2428),
CO   complement(AAHY01210038.1:1..733),gap(1533),AAHY01210039.1:1..2497,
CO   gap(115),complement(AAHY01210040.1:1..1415),gap(20),
CO   AAHY01210041.1:1..10228,gap(20),AAHY01210042.1:1..23152,gap(20),
CO   AAHY01210043.1:1..5491,gap(20),AAHY01210044.1:1..21753,gap(38),
CO   AAHY01210045.1:1..18394,gap(3823),AAHY01210046.1:1..859,gap(505),
CO   AAHY01210047.1:1..1165,gap(541),AAHY01210048.1:1..1774,gap(257),
CO   AAHY01210049.1:1..1505,gap(20),AAHY01210050.1:1..1656,gap(3890),
CO   complement(AAHY01210051.1:1..1979),gap(20),AAHY01210052.1:1..6384,gap(443),
CO   complement(AAHY01210053.1:1..4792),gap(95),AAHY01210054.1:1..4213,gap(20),
CO   AAHY01210055.1:1..11839,gap(731),complement(AAHY01210056.1:1..3190),
CO   gap(20),AAHY01210057.1:1..12201,gap(34),
CO   complement(AAHY01210058.1:1..24091),gap(20),
CO   complement(AAHY01210059.1:1..9699),gap(20),
CO   complement(AAHY01210060.1:1..5819),gap(20),
CO   complement(AAHY01210061.1:1..5213),gap(555),AAHY01210062.1:1..6225,gap(39),
CO   AAHY01210063.1:1..6796,gap(2240),AAHY01210064.1:1..13598,gap(34),
CO   complement(AAHY01210065.1:1..625),gap(20),AAHY01210066.1:1..7116,gap(20),
CO   AAHY01210067.1:1..1290,gap(448),AAHY01210068.1:1..4348,gap(84),
CO   AAHY01210069.1:1..4337,gap(149),AAHY01210070.1:1..5031,gap(40),
CO   complement(AAHY01210071.1:1..3444),gap(20),AAHY01210072.1:1..18413,gap(20),
CO   AAHY01210073.1:1..42599,gap(1432),AAHY01210074.1:1..20505,gap(324),
CO   AAHY01210075.1:1..1550,gap(1583),AAHY01210076.1:1..18487,gap(20),
CO   AAHY01210077.1:1..28887,gap(20),AAHY01210078.1:1..1239,gap(824),
CO   AAHY01210079.1:1..5637,gap(470),complement(AAHY01210080.1:1..1738),
CO   gap(4011),AAHY01210081.1:1..18063,gap(179),AAHY01210082.1:1..4831,gap(20),
CO   AAHY01210083.1:1..19702,gap(35),AAHY01210084.1:1..5223,gap(20),
CO   AAHY01210085.1:1..4072,gap(20),complement(AAHY01210086.1:1..629),gap(1655),
CO   complement(AAHY01210087.1:1..1518),gap(20),AAHY01210088.1:1..11817,
CO   gap(152),complement(AAHY01210089.1:1..10984),gap(192),
CO   AAHY01210090.1:1..1471,gap(21),AAHY01210091.1:1..1695,gap(924),
CO   complement(AAHY01210092.1:1..2212),gap(49),AAHY01210093.1:1..14314,
CO   gap(706),complement(AAHY01210094.1:1..3352),gap(253),
CO   AAHY01210095.1:1..17111,gap(20),AAHY01210096.1:1..25775,gap(20),
CO   AAHY01210097.1:1..9517,gap(97),complement(AAHY01210098.1:1..3164),gap(20),
CO   AAHY01210099.1:1..11232,gap(92),AAHY01210100.1:1..6477,gap(20),
CO   complement(AAHY01210101.1:1..1503),gap(1207),
CO   complement(AAHY01210102.1:1..7320),gap(20),AAHY01210103.1:1..13006,
CO   gap(624),complement(AAHY01210104.1:1..3176),gap(20),AAHY01210105.1:1..8787,
CO   gap(709),complement(AAHY01210106.1:1..5486),gap(978),
CO   complement(AAHY01210107.1:1..3559),gap(854),
CO   complement(AAHY01210108.1:1..8239),gap(20),AAHY01210109.1:1..3858,gap(86),
CO   complement(AAHY01210110.1:1..6873),gap(121),AAHY01210111.1:1..3257,gap(20),
CO   AAHY01210112.1:1..1337,gap(27),complement(AAHY01210113.1:1..2718),gap(30),
CO   AAHY01210114.1:1..9494,gap(273),AAHY01210115.1:1..385,gap(274),
CO   AAHY01210116.1:1..6005,gap(97),AAHY01210117.1:1..6335,gap(713),
CO   AAHY01210118.1:1..1993,gap(112),AAHY01210119.1:1..11266,gap(429),
CO   AAHY01210120.1:1..10546,gap(51),complement(AAHY01210121.1:1..3919),gap(20),
CO   AAHY01210122.1:1..9107,gap(20),AAHY01210123.1:1..1597,gap(20),
CO   AAHY01210124.1:1..61744,gap(530),AAHY01210125.1:1..8691,gap(20),
CO   AAHY01210126.1:1..5416,gap(709),AAHY01210127.1:1..15265,gap(59),
CO   AAHY01210128.1:1..7158,gap(20),AAHY01210129.1:1..5302,gap(128),
CO   complement(AAHY01210130.1:1..1153),gap(107),
CO   complement(AAHY01210131.1:1..2796),gap(20),AAHY01210132.1:1..17936,gap(20),
CO   AAHY01210133.1:1..1209,gap(2355),complement(AAHY01210134.1:1..748),
CO   gap(2877),AAHY01210135.1:1..2229,gap(119),AAHY01210136.1:1..5400,gap(5188),
CO   AAHY01210137.1:1..4283,gap(150),complement(AAHY01210138.1:1..8013),
CO   gap(817),complement(AAHY01210139.1:1..7416),gap(94),AAHY01210140.1:1..9119,
CO   gap(126),AAHY01210141.1:1..3081,gap(60),complement(AAHY01210142.1:1..4286),
CO   gap(393),complement(AAHY01210143.1:1..6057),gap(1685),
CO   AAHY01210144.1:1..4591,gap(20),complement(AAHY01210145.1:1..1908),gap(769),
CO   AAHY01210146.1:1..6157,gap(22),AAHY01210147.1:1..1593,gap(20),
CO   AAHY01210148.1:1..1953,gap(32),AAHY01210149.1:1..12815,gap(724),
CO   AAHY01210150.1:1..2158,gap(1764),AAHY01210151.1:1..2708,gap(452),
CO   AAHY01210152.1:1..339,gap(210),AAHY01210153.1:1..3129,gap(20),
CO   AAHY01210154.1:1..14323,gap(56),AAHY01210155.1:1..2540,gap(193),
CO   complement(AAHY01210156.1:1..24563),gap(434),AAHY01210157.1:1..2458,
CO   gap(184),complement(AAHY01210158.1:1..21847),gap(20),
CO   complement(AAHY01210159.1:1..1586),gap(20),AAHY01210160.1:1..6468,
CO   gap(4903),complement(AAHY01210161.1:1..12685),gap(20),
CO   AAHY01210162.1:1..3228,gap(177),complement(AAHY01210163.1:1..4515),gap(62),
CO   complement(AAHY01210164.1:1..28579),gap(220),AAHY01210165.1:1..11642,
CO   gap(20),complement(AAHY01210166.1:1..7434),gap(20),
CO   complement(AAHY01210167.1:1..5506),gap(68),AAHY01210168.1:1..3933,gap(108),
CO   AAHY01210169.1:1..8948,gap(818),complement(AAHY01210170.1:1..14025),
CO   gap(20),complement(AAHY01210171.1:1..1780),gap(67),
CO   complement(AAHY01210172.1:1..2626),gap(135),
CO   complement(AAHY01210173.1:1..3204),gap(176),AAHY01210174.1:1..16820,
CO   gap(3472),complement(AAHY01210175.1:1..47736),gap(71),
CO   complement(AAHY01210176.1:1..34328),gap(20),AAHY01210177.1:1..52873,
CO   gap(43),AAHY01210178.1:1..22902,gap(5588),AAHY01210179.1:1..35640,gap(468),
CO   complement(AAHY01210180.1:1..7594),gap(20),AAHY01210181.1:1..4718,gap(680),
CO   AAHY01210182.1:1..1184,gap(20),complement(AAHY01210183.1:1..2219),gap(209),
CO   AAHY01210184.1:1..3181,gap(44),AAHY01210185.1:1..15709,gap(109),
CO   complement(AAHY01210186.1:1..3061),gap(20),AAHY01210187.1:1..39056,
CO   gap(112),complement(AAHY01210188.1:1..4881),gap(278),
CO   complement(AAHY01210189.1:1..4341),gap(20),
CO   complement(AAHY01210190.1:1..1431),gap(242),
CO   complement(AAHY01210191.1:1..4644),gap(29),
CO   complement(AAHY01210192.1:1..13567),gap(148),AAHY01210193.1:1..8086,
CO   gap(682),AAHY01210194.1:1..1927,gap(20),AAHY01210195.1:1..1527,gap(224),
CO   complement(AAHY01210196.1:1..15134),gap(60),
CO   complement(AAHY01210197.1:1..9476),gap(2499),AAHY01210198.1:1..2992,
CO   gap(7875),complement(AAHY01210199.1:1..1240),gap(20),
CO   AAHY01210200.1:1..2163,gap(177),complement(AAHY01210201.1:1..7011),gap(20),
CO   complement(AAHY01210202.1:1..9103),gap(20),
CO   complement(AAHY01210203.1:1..13188),gap(281),
CO   complement(AAHY01210204.1:1..5403),gap(64),
CO   complement(AAHY01210205.1:1..2932),gap(414),
CO   complement(AAHY01210206.1:1..10394),gap(167),AAHY01210207.1:1..6988,
CO   gap(20),AAHY01210208.1:1..8664,gap(20),AAHY01210209.1:1..2736,gap(396),
CO   complement(AAHY01210210.1:1..7120),gap(63),AAHY01210211.1:1..1160,
CO   gap(3435),complement(AAHY01210212.1:1..11213),gap(20),
CO   AAHY01210213.1:1..2902,gap(105),AAHY01210214.1:1..1789,gap(1500),
CO   complement(AAHY01210215.1:1..1351),gap(20),
CO   complement(AAHY01210216.1:1..3661),gap(337),
CO   complement(AAHY01210217.1:1..698),gap(513),AAHY01210218.1:1..5044,gap(463),
CO   complement(AAHY01210219.1:1..1405),gap(192),
CO   complement(AAHY01210220.1:1..1283),gap(527),
CO   complement(AAHY01210221.1:1..2121),gap(20),
CO   complement(AAHY01210222.1:1..1442),gap(20),AAHY01210223.1:1..7603,gap(481),
CO   complement(AAHY01210224.1:1..26575),gap(42),AAHY01210225.1:1..1491,
CO   gap(151),complement(AAHY01210226.1:1..11119),gap(20),
CO   AAHY01210227.1:1..2742,gap(236),complement(AAHY01210228.1:1..6658),
CO   gap(181),AAHY01210229.1:1..21047,gap(212),AAHY01210230.1:1..24231,gap(75),
CO   AAHY01210231.1:1..3790,gap(20),AAHY01210232.1:1..17553,gap(232),
CO   AAHY01210233.1:1..1174,gap(227),AAHY01210234.1:1..2328,gap(772),
CO   AAHY01210235.1:1..3954,gap(59),complement(AAHY01210236.1:1..1259),gap(271),
CO   complement(AAHY01210237.1:1..16912),gap(20),AAHY01210238.1:1..2311,gap(20),
CO   AAHY01210239.1:1..12996,gap(760),AAHY01210240.1:1..2634,gap(20),
CO   AAHY01210241.1:1..1175,gap(84),complement(AAHY01210242.1:1..5839),gap(20),
CO   complement(AAHY01210243.1:1..1658),gap(55),
CO   complement(AAHY01210244.1:1..11093),gap(43),
CO   complement(AAHY01210245.1:1..10299),gap(366),AAHY01210246.1:1..7354,
CO   gap(20),AAHY01210247.1:1..32125,gap(979),
CO   complement(AAHY01210248.1:1..12881),gap(20),AAHY01210249.1:1..3083,gap(35),
CO   complement(AAHY01210250.1:1..4344),gap(20),
CO   complement(AAHY01210251.1:1..26995),gap(20),AAHY01210252.1:1..3700,
CO   gap(2704),complement(AAHY01210253.1:1..3722),gap(5971),
CO   AAHY01210254.1:1..3586,gap(202),complement(AAHY01210255.1:1..10003),
CO   gap(20),AAHY01210256.1:1..2058,gap(20),complement(AAHY01210257.1:1..3608),
CO   gap(195),complement(AAHY01210258.1:1..8103),gap(590),
CO   complement(AAHY01210259.1:1..4102),gap(154),
CO   complement(AAHY01210260.1:1..15881),gap(20),
CO   complement(AAHY01210261.1:1..10578),gap(516),AAHY01210262.1:1..8959,
CO   gap(146),complement(AAHY01210263.1:1..11875),gap(20),
CO   AAHY01210264.1:1..11620,gap(20),complement(AAHY01210265.1:1..13204),
CO   gap(133),complement(AAHY01210266.1:1..16089),gap(20),
CO   AAHY01210267.1:1..25366,gap(80),complement(AAHY01210268.1:1..6428),
CO   gap(831),complement(AAHY01210269.1:1..5615),gap(20),AAHY01210270.1:1..4582,
CO   gap(611),complement(AAHY01210271.1:1..56010),gap(78),
CO   complement(AAHY01210272.1:1..12891),gap(20),
CO   complement(AAHY01210273.1:1..3877),gap(288),
CO   complement(AAHY01210274.1:1..18543),gap(690),
CO   complement(AAHY01210275.1:1..11606),gap(884),
CO   complement(AAHY01210276.1:1..2905),gap(20),
CO   complement(AAHY01210277.1:1..14161),gap(20),AAHY01210278.1:1..3854,gap(20),
CO   AAHY01210279.1:1..6472,gap(20),complement(AAHY01210280.1:1..12738),gap(97),
CO   AAHY01210281.1:1..22959,gap(42),complement(AAHY01210282.1:1..6160),gap(20),
CO   complement(AAHY01210283.1:1..7988),gap(325),AAHY01210284.1:1..1249,
CO   gap(1432),AAHY01210285.1:1..3950,gap(1006),AAHY01210286.1:1..3624,gap(259),
CO   complement(AAHY01210287.1:1..6028),gap(20),
CO   complement(AAHY01210288.1:1..949),gap(321),AAHY01210289.1:1..8084,gap(20),
CO   AAHY01210290.1:1..1162,gap(200),AAHY01210291.1:1..18449,gap(20),
CO   complement(AAHY01210292.1:1..6255),gap(479),
CO   complement(AAHY01210293.1:1..1320),gap(59),AAHY01210294.1:1..1789,gap(709),
CO   complement(AAHY01210295.1:1..3439),gap(886),
CO   complement(AAHY01210296.1:1..3209),gap(20),
CO   complement(AAHY01210297.1:1..2780),gap(217),AAHY01210298.1:1..548,gap(20),
CO   complement(AAHY01210299.1:1..3796),gap(78),
CO   complement(AAHY01210300.1:1..3700),gap(227),
CO   complement(AAHY01210301.1:1..1854),gap(20),
CO   complement(AAHY01210302.1:1..12777),gap(20),
CO   complement(AAHY01210303.1:1..17126),gap(20),AAHY01210304.1:1..2101,gap(20),
CO   AAHY01210305.1:1..3238,gap(1548),complement(AAHY01210306.1:1..3569),
CO   gap(20),AAHY01210307.1:1..3512,gap(356),AAHY01210308.1:1..5751,gap(87),
CO   AAHY01210309.1:1..2930,gap(77),complement(AAHY01210310.1:1..9194),gap(194),
CO   complement(AAHY01210311.1:1..1041),gap(223),
CO   complement(AAHY01210312.1:1..9697),gap(602),AAHY01210313.1:1..1411,gap(20),
CO   AAHY01210314.1:1..13374,gap(92),AAHY01210315.1:1..4902,gap(392),
CO   complement(AAHY01210316.1:1..8426),gap(20),AAHY01210317.1:1..1888,gap(62),
CO   complement(AAHY01210318.1:1..2235),gap(2376),AAHY01210319.1:1..10466,
CO   gap(20),AAHY01210320.1:1..7432,gap(348),AAHY01210321.1:1..931,gap(84),
CO   complement(AAHY01210322.1:1..3975),gap(43),
CO   complement(AAHY01210323.1:1..10214),gap(62),AAHY01210324.1:1..2661,gap(20),
CO   AAHY01210325.1:1..19010,gap(20),AAHY01210326.1:1..2905,gap(279),
CO   AAHY01210327.1:1..1380,gap(20),AAHY01210328.1:1..2765,gap(212),
CO   complement(AAHY01210329.1:1..900),gap(282),AAHY01210330.1:1..13206,
CO   gap(163),AAHY01210331.1:1..13134,gap(317),
CO   complement(AAHY01210332.1:1..4421),gap(20),
CO   complement(AAHY01210333.1:1..3005),gap(20),
CO   complement(AAHY01210334.1:1..764),gap(434),AAHY01210335.1:1..7646,gap(20),
CO   AAHY01210336.1:1..4898,gap(20),complement(AAHY01210337.1:1..1310),gap(878),
CO   AAHY01210338.1:1..2153,gap(402),AAHY01210339.1:1..921,gap(20),
CO   AAHY01210340.1:1..11402,gap(589),AAHY01210341.1:1..18871,gap(20),
CO   complement(AAHY01210342.1:1..1750),gap(139),
CO   complement(AAHY01210343.1:1..1525),gap(20),
CO   complement(AAHY01210344.1:1..2121),gap(20),AAHY01210345.1:1..9119,gap(34),
CO   AAHY01210346.1:1..1542,gap(20),AAHY01210347.1:1..20362,gap(72),
CO   AAHY01210348.1:1..2041,gap(152),AAHY01210349.1:1..19653,gap(596),
CO   AAHY01210350.1:1..8849,gap(30),AAHY01210351.1:1..4170,gap(20),
CO   AAHY01210352.1:1..4710,gap(387),AAHY01210353.1:1..4106,gap(637),
CO   complement(AAHY01210354.1:1..2165),gap(266),AAHY01210355.1:1..2786,gap(20),
CO   complement(AAHY01210356.1:1..5129),gap(754),
CO   complement(AAHY01210357.1:1..16039),gap(20),AAHY01210358.1:1..1786,
CO   gap(183),AAHY01210359.1:1..9369,gap(20),AAHY01210360.1:1..2435,gap(20),
CO   AAHY01210361.1:1..2910,gap(119),AAHY01210362.1:1..16742,gap(20),
CO   AAHY01210363.1:1..7764,gap(20),complement(AAHY01210364.1:1..7961),gap(349),
CO   AAHY01210365.1:1..1258,gap(106),AAHY01210366.1:1..11972,gap(20),
CO   AAHY01210367.1:1..3036,gap(20),AAHY01210368.1:1..1096,gap(9421),
CO   AAHY01210369.1:1..1396,gap(544),AAHY01210370.1:1..10303,gap(31),
CO   AAHY01210371.1:1..8175,gap(500),complement(AAHY01210372.1:1..7580),
CO   gap(316),AAHY01210373.1:1..3905,gap(20),AAHY01210374.1:1..18053,gap(55),
CO   AAHY01210375.1:1..1085,gap(30),AAHY01210376.1:1..10912,gap(927),
CO   complement(AAHY01210377.1:1..1048),gap(20),AAHY01210378.1:1..2243,gap(20),
CO   AAHY01210379.1:1..8226,gap(20),complement(AAHY01210380.1:1..3607),gap(196),
CO   complement(AAHY01210381.1:1..5130),gap(20),AAHY01210382.1:1..9563,gap(20),
CO   AAHY01210383.1:1..1505,gap(181),AAHY01210384.1:1..21914,gap(6093),
CO   AAHY01210385.1:1..27459,gap(20),AAHY01210386.1:1..2038,gap(91),
CO   AAHY01210387.1:1..11889,gap(325),AAHY01210388.1:1..7438,gap(20),
CO   AAHY01210389.1:1..3597,gap(34),AAHY01210390.1:1..10451,gap(308),
CO   complement(AAHY01210391.1:1..3890),gap(20),
CO   complement(AAHY01210392.1:1..4281),gap(20),AAHY01210393.1:1..4990,
CO   gap(3325),AAHY01210394.1:1..3682,gap(20),AAHY01210395.1:1..1162,gap(73),
CO   AAHY01210396.1:1..10850,gap(20),AAHY01210397.1:1..1104,gap(91),
CO   complement(AAHY01210398.1:1..3531),gap(20),AAHY01210399.1:1..3662,gap(188),
CO   AAHY01210400.1:1..4406,gap(6108),AAHY01210401.1:1..7156,gap(560),
CO   AAHY01210402.1:1..1844,gap(616),AAHY01210403.1:1..795,gap(358),
CO   AAHY01210404.1:1..1181,gap(37),complement(AAHY01210405.1:1..1260),
CO   gap(9422),AAHY01210406.1:1..2759,gap(596),AAHY01210407.1:1..4585,gap(2836),
CO   complement(AAHY01210408.1:1..3745),gap(66),
CO   complement(AAHY01210409.1:1..2133),gap(20),
CO   complement(AAHY01210410.1:1..7068),gap(4385),AAHY01210411.1:1..4163,
CO   gap(2631),AAHY01210412.1:1..3111,gap(20),AAHY01210413.1:1..22800,gap(181),
CO   complement(AAHY01210414.1:1..5526),gap(93),
CO   complement(AAHY01210415.1:1..3174),gap(330),AAHY01210416.1:1..2582,
CO   gap(195),AAHY01210417.1:1..10412,gap(37348),AAHY01210418.1:1..1755,
CO   gap(231),complement(AAHY01210419.1:1..1604),gap(20),AAHY01210420.1:1..1635,
CO   gap(273),complement(AAHY01210421.1:1..1509),gap(20),AAHY01210422.1:1..6137,
CO   gap(20),complement(AAHY01210423.1:1..7447),gap(796),
CO   complement(AAHY01210424.1:1..7383),gap(218),AAHY01210425.1:1..11325,
CO   gap(20),AAHY01210426.1:1..8002,gap(20),complement(AAHY01210427.1:1..1929),
CO   gap(20),AAHY01210428.1:1..2579,gap(473),AAHY01210429.1:1..25641,gap(20),
CO   AAHY01210430.1:1..16710,gap(3956),AAHY01210431.1:1..1810,gap(4929),
CO   complement(AAHY01210432.1:1..11941),gap(167),
CO   complement(AAHY01210433.1:1..6657),gap(1752),
CO   complement(AAHY01210434.1:1..23421),gap(373),AAHY01210435.1:1..2084,
CO   gap(30),complement(AAHY01210436.1:1..3465),gap(1118),
CO   complement(AAHY01210437.1:1..1143),gap(395),
CO   complement(AAHY01210438.1:1..19546),gap(39),AAHY01210439.1:1..4040,gap(20),
CO   AAHY01210440.1:1..1166,gap(20),AAHY01210441.1:1..34425,gap(20),
CO   complement(AAHY01210442.1:1..5814),gap(143),AAHY01210443.1:1..6650,gap(20),
CO   complement(AAHY01210444.1:1..9896),gap(20),
CO   complement(AAHY01210445.1:1..9598),gap(28),
CO   complement(AAHY01210446.1:1..21298),gap(287),AAHY01210447.1:1..3669,
CO   gap(20),complement(AAHY01210448.1:1..1679),gap(105),AAHY01210449.1:1..2663,
CO   gap(133),complement(AAHY01210450.1:1..5687),gap(20),
CO   complement(AAHY01210451.1:1..16405),gap(98),
CO   complement(AAHY01210452.1:1..14519),gap(618),
CO   complement(AAHY01210453.1:1..4247),gap(2081),AAHY01210454.1:1..9707,
CO   gap(1554),complement(AAHY01210455.1:1..1014),gap(58),
CO   complement(AAHY01210456.1:1..7440),gap(777),AAHY01210457.1:1..4435,gap(20),
CO   AAHY01210458.1:1..1543,gap(20),AAHY01210459.1:1..2534,gap(1637),
CO   complement(AAHY01210460.1:1..1204),gap(20),AAHY01210461.1:1..7790,gap(20),
CO   AAHY01210462.1:1..11674,gap(229),AAHY01210463.1:1..11683,gap(20),
CO   AAHY01210464.1:1..2496,gap(820),AAHY01210465.1:1..15138,gap(1755),
CO   AAHY01210466.1:1..7220,gap(58),AAHY01210467.1:1..6645,gap(798),
CO   AAHY01210468.1:1..12480,gap(464),AAHY01210469.1:1..20933,gap(98),
CO   AAHY01210470.1:1..29563,gap(20),AAHY01210471.1:1..10516,gap(20),
CO   AAHY01210472.1:1..6280,gap(1140),AAHY01210473.1:1..2407,gap(2986),
CO   complement(AAHY01210474.1:1..1518),gap(2300),AAHY01210475.1:1..4782,
CO   gap(528),complement(AAHY01210476.1:1..1141),gap(8029),
CO   AAHY01210477.1:1..5551,gap(839),complement(AAHY01210478.1:1..755),
CO   gap(1084),complement(AAHY01210479.1:1..4125),gap(870),
CO   complement(AAHY01210480.1:1..1026),gap(20),AAHY01210481.1:1..3210,gap(739),
CO   AAHY01210482.1:1..3479,gap(6751),AAHY01210483.1:1..3017)
//


spacer
spacer