spacer

EBI Dbfetch

ID   CH466569; SV 1; linear; genomic DNA; CON; MUS; 16218469 BP.
XX
AC   CH466569;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009803149 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-16218469
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-16218469
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; ad89b90be39bc5634cc82adcf1b21539.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000216.
DR   Ensembl-Gn; ENSMUSG00000000792; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002345; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002393; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002396; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004319; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025588; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030735; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031609; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031610; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031635; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031807; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031808; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031834; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031838; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031840; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031848; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031849; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031861; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031862; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034845; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036120; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036330; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036437; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037921; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038206; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038257; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038508; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043243; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044014; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046258; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046295; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049988; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051147; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053626; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054044; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055553; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068240; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070002; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070003; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071089; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079019; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079033; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079042; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000087408; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090137; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000275; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000809; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002466; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002469; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003659; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026677; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032981; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034022; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034023; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034052; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034054; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034261; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034267; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034296; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034301; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034325; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034326; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037478; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039303; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040218; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049908; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052437; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053441; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056508; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066166; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066837; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070631; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070810; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072500; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075724; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081940; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089430; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093454; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093470; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093490; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095295; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110092; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110093; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110146; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110301; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110322; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118850; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119976; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120725; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121623; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125184; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126559; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129909; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000135446; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140239; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140679; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143441; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163756; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163856; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164890; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165126; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..16218469
FT                   /organism="Mus musculus"
FT                   /chromosome="8"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <2568..>11294
FT                   /locus_tag="mCG_140356"
FT                   /note="gene_id=mCG140356.0"
FT   mRNA            join(<2568..2895,2991..3064,11199..>11294)
FT                   /locus_tag="mCG_140356"
FT                   /product="mCG140356, transcript variant mCT169135"
FT                   /note="gene_id=mCG140356.0 transcript_id=mCT169135.0
FT                   created on 23-MAY-2002"
FT   mRNA            join(<2568..2845,2991..3064,11199..>11270)
FT                   /locus_tag="mCG_140356"
FT                   /product="mCG140356, transcript variant mCT169134"
FT                   /note="gene_id=mCG140356.0 transcript_id=mCT169134.0
FT                   created on 23-MAY-2002"
FT   CDS             join(<2793..2845,2991..3064,11199..>11270)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140356"
FT                   /product="mCG140356, isoform CRA_a"
FT                   /note="gene_id=mCG140356.0 transcript_id=mCT169134.0
FT                   protein_id=mCP92294.0 isoform=CRA_a"
FT                   /protein_id="EDL28596.1"
FT                   /translation="LVPKPGTLTCPKTRNLNLLLCAYFLATLCSPLFYPRSFPNSWGYF
FT                   VPTSWQLYAHLYFIRGPSQTP"
FT   CDS             join(<2843..2895,2991..3064,11199..>11294)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140356"
FT                   /product="mCG140356, isoform CRA_b"
FT                   /note="gene_id=mCG140356.0 transcript_id=mCT169135.0
FT                   protein_id=mCP92295.0 isoform=CRA_b"
FT                   /protein_id="EDL28597.1"
FT                   /translation="LVPKPGTLTCPKTRNLNLLLCAYFLATLCSPLFYPRSFPNSWGYF
FT                   VPTSWQLYAHLYFIRGPSQTPGVASFTNR"
FT   gene            complement(<30878..>32449)
FT                   /locus_tag="mCG_118054"
FT                   /note="gene_id=mCG118054.0"
FT   mRNA            complement(join(<30878..31315,32084..>32449))
FT                   /locus_tag="mCG_118054"
FT                   /product="mCG118054"
FT                   /note="gene_id=mCG118054.0 transcript_id=mCT119202.0
FT                   created on 23-MAY-2002"
FT   CDS             complement(join(30878..31315,32084..32449))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118054"
FT                   /product="mCG118054"
FT                   /note="gene_id=mCG118054.0 transcript_id=mCT119202.0
FT                   protein_id=mCP54067.0"
FT                   /protein_id="EDL28598.1"
FT                   /translation="METRSEAGVLQKLLDRLCQETDPGKIYKTLKELSSLPILCDTLAE
FT                   IDFKQTIKSLKKQQLLVPFVKDLVDKWSTGFLLGPQIQQVRQDFGLEKGLTREGQSTSP
FT                   EEKPQKQASQEAREDGREVGKDKAGRGQPEEKSRAQGHRCKEYYSQPESPTPLQVQGSQ
FT                   EERLQALKARLQSTRAKRPQPRQTMMVSFFTDLKSPSQQGKPGKSGAASVQNQHSLSEA
FT                   LAHSEVHWASCPLAGETDTKKAPAKRPAPLMAKTLKDYRKCFYKR"
FT   gene            121706..122256
FT                   /pseudo
FT                   /locus_tag="mCG_1048877"
FT                   /note="gene_id=mCG1048877.1"
FT   mRNA            121706..122256
FT                   /pseudo
FT                   /locus_tag="mCG_1048877"
FT                   /note="gene_id=mCG1048877.1 transcript_id=mCT166581.1
FT                   created on 23-MAY-2002"
FT   gene            complement(<128190..>129749)
FT                   /locus_tag="mCG_118053"
FT                   /note="gene_id=mCG118053.0"
FT   mRNA            complement(join(<128190..128666,129384..>129749))
FT                   /locus_tag="mCG_118053"
FT                   /product="mCG118053"
FT                   /note="gene_id=mCG118053.0 transcript_id=mCT119201.0
FT                   created on 23-MAY-2002"
FT   CDS             complement(join(128190..128666,129384..129749))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118053"
FT                   /product="mCG118053"
FT                   /note="gene_id=mCG118053.0 transcript_id=mCT119201.0
FT                   protein_id=mCP54066.0"
FT                   /protein_id="EDL28599.1"
FT                   /translation="METRSEAGVLQKLLERLCQETDPGKIYKTLKELSSLPILCDTLAE
FT                   IDFKQTIKSLKKQQLLVPFVKDLVDKWSTGFLLGPQIQQARQDFGLEKGLKREGQSTSS
FT                   EEKPQKQASQEARGYGREQKHTGTRDSGHCQVGKDKAGRGQPEEKSRAQGHRYKESYSH
FT                   PESPTPLQVQGSQEERLQALRARLQSTRAKRPQPRQTMMVSFFTELKSPSQQGKPGKSG
FT                   DASVQNQHSFSEVPAHPGVQWASCPLAGETGTKKAPAKRPAPLMAKTLKDYRKCFYKR"
FT   gene            360213..360998
FT                   /pseudo
FT                   /locus_tag="mCG_1048902"
FT                   /note="gene_id=mCG1048902.1"
FT   mRNA            360213..360998
FT                   /pseudo
FT                   /locus_tag="mCG_1048902"
FT                   /note="gene_id=mCG1048902.1 transcript_id=mCT166606.1
FT                   created on 24-MAY-2002"
FT   gene            complement(<453402..>455693)
FT                   /locus_tag="mCG_61645"
FT                   /note="gene_id=mCG61645.1"
FT   mRNA            complement(<453402..>455693)
FT                   /locus_tag="mCG_61645"
FT                   /product="mCG61645"
FT                   /note="gene_id=mCG61645.1 transcript_id=mCT61828.1 created
FT                   on 24-MAY-2002"
FT   CDS             complement(453402..455693)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61645"
FT                   /product="mCG61645"
FT                   /note="gene_id=mCG61645.1 transcript_id=mCT61828.1
FT                   protein_id=mCP33406.1"
FT                   /db_xref="GOA:G3X9B5"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:2676326"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9B5"
FT                   /protein_id="EDL28600.1"
FT                   /translation="MNMIEALLSMRVLFLTQVFGIFLCFPGLTKAGHLHYHSSIEVVIP
FT                   MKVTEKTRGMNLPNWISYSLKLGGQRYIIHMKIKNLFLTRHLPVFTYSDQDSLLEDYPF
FT                   VQDDCYYQGYVEGDSESLVSLSSCFGGFHGLLEINNIVYEIMPKKFSRKFEHLVYKVDS
FT                   NKTESRGSSLMQDNITCQVELQKSGNPILKQSSFEDWWTHTKIVELVVVVDKTLYDHYG
FT                   NYTVMLSDLYSVINIVDTIYEVIGIKILLVGVEVWNKKNLIVIDDVSKSLRLYCRWKAS
FT                   NFLHRLKHDVSHLFIYRHLRGLSGIGSTGGICDPKRSCAVVTFIDRTLNLRAIGVAHHL
FT                   GHNLGMKHDEDICKCSYSKCIMHMDSPPIPKFSNCSYNYFWSYTVKNTRCLMENMYTKD
FT                   IFDRTRCGNGVVEDKEQCDCGSLRNCTNDLCCMSNCTLSTGSSCAFGLCCKNCQFLPSG
FT                   TLCRKRDNICDLPEWCNGTSHECPDDAYVEDGIPCGVSAYCYEKQCNDRNEHCRQIFGQ
FT                   NAKTASVHCYREINTKGDRFGHCGLQGPTYIKCKSNDALCGRIQCDNVVQIPNMKDHST
FT                   IHFALVKNVSCWGTDYHTGTSLTDIGDVKDGTECEQNHICINRHCVHISTLDSNCTPAF
FT                   CNYRGICNNKHHCHCNFHWDPPNCMIRGHGGSVDSGLPPKTNKKKHFFYLLLLQLIILA
FT                   CLLSCLLWLLFNIKGSKRKPQVQPTPVKTKKVSKKVPSQKPSPVPSPSLPQLRMPSRSA
FT                   SPTSSIKSTN"
FT   gene            525092..>708073
FT                   /gene="Glra3"
FT                   /locus_tag="mCG_4607"
FT                   /note="gene_id=mCG4607.1"
FT   mRNA            join(525092..525247,573829..573956,587823..587890,
FT                   622179..622402,645046..645128,667700..667837,
FT                   671578..671792,693137..693280,695520..695564,
FT                   707795..>708073)
FT                   /gene="Glra3"
FT                   /locus_tag="mCG_4607"
FT                   /product="glycine receptor, alpha 3 subunit"
FT                   /note="gene_id=mCG4607.1 transcript_id=mCT3369.2 created on
FT                   24-MAY-2002"
FT   CDS             join(525129..525247,573829..573956,587823..587890,
FT                   622179..622402,645046..645128,667700..667837,
FT                   671578..671792,693137..693280,695520..695564,
FT                   707795..708073)
FT                   /codon_start=1
FT                   /gene="Glra3"
FT                   /locus_tag="mCG_4607"
FT                   /product="glycine receptor, alpha 3 subunit"
FT                   /note="gene_id=mCG4607.1 transcript_id=mCT3369.2
FT                   protein_id=mCP11632.2"
FT                   /db_xref="GOA:G5E811"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008127"
FT                   /db_xref="InterPro:IPR008130"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:95749"
FT                   /db_xref="UniProtKB/TrEMBL:G5E811"
FT                   /protein_id="EDL28601.1"
FT                   /translation="MPWIRLLSGSWISFRIMAHVRHFRTLVSGFYFWEAALLLSLVATK
FT                   ETNSARSRSAPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETT
FT                   MDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTD
FT                   NKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDE
FT                   APVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSL
FT                   LIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCL
FT                   LFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEAFALEKFYRFSDTDDEVRESRFSF
FT                   TAYGMGPCLQAKDGVVPKGPNHAVQVMPKSPDEMRKVFIDRAKKIDTISRACFPLAFLI
FT                   FNIFYWVIYKILRHEDIHQQQD"
FT   gene            complement(556336..556906)
FT                   /pseudo
FT                   /locus_tag="mCG_4608"
FT                   /note="gene_id=mCG4608.2"
FT   mRNA            complement(556336..556906)
FT                   /pseudo
FT                   /locus_tag="mCG_4608"
FT                   /note="gene_id=mCG4608.2 transcript_id=mCT3370.2 created on
FT                   24-MAY-2002"
FT   gene            complement(712218..712790)
FT                   /locus_tag="mCG_1048932"
FT                   /note="gene_id=mCG1048932.1"
FT   mRNA            complement(712218..712790)
FT                   /locus_tag="mCG_1048932"
FT                   /product="mCG1048932"
FT                   /note="gene_id=mCG1048932.1 transcript_id=mCT166636.1
FT                   created on 24-MAY-2002"
FT   CDS             complement(712465..712635)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048932"
FT                   /product="mCG1048932"
FT                   /note="gene_id=mCG1048932.1 transcript_id=mCT166636.1
FT                   protein_id=mCP54032.1"
FT                   /protein_id="EDL28602.1"
FT                   /translation="MQNILIHLNHNVMKNCGTHLDRKGDSDILLRKMYFRCSDNSYYHK
FT                   IAVFLRNRLSH"
FT   gene            876889..903340
FT                   /gene="Hpgd"
FT                   /locus_tag="mCG_4609"
FT                   /note="gene_id=mCG4609.2"
FT   mRNA            join(876889..877008,877235..877358,880649..880755,
FT                   889873..889969,900036..900112,901279..901442,
FT                   902355..903340)
FT                   /gene="Hpgd"
FT                   /locus_tag="mCG_4609"
FT                   /product="hydroxyprostaglandin dehydrogenase 15 (NAD)"
FT                   /note="gene_id=mCG4609.2 transcript_id=mCT3371.1 created on
FT                   24-MAY-2002"
FT   CDS             join(876916..877008,877235..877358,880649..880755,
FT                   889873..889969,900036..900112,901279..901442,
FT                   902355..902502)
FT                   /codon_start=1
FT                   /gene="Hpgd"
FT                   /locus_tag="mCG_4609"
FT                   /product="hydroxyprostaglandin dehydrogenase 15 (NAD)"
FT                   /note="gene_id=mCG4609.2 transcript_id=mCT3371.1
FT                   protein_id=mCP11620.1"
FT                   /protein_id="EDL28603.1"
FT                   /translation="MHVNGKVALVTGAAQGIGKAFAEALLLHGAKVALVDWNLEAGVKC
FT                   KAALDEQFEPQKTLFVQCDVADQKQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTL
FT                   QINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIIGFTR
FT                   SAAMAANLMKSGVRLNVICPGFVDTPILESIEKEENMGQYIEYKDQIKAMMKFYGVLHP
FT                   STIANGLINLIEDDALNGAIMKITASKGIHFQDYDISPLLVKAPLTS"
FT   gene            1030078..1031001
FT                   /pseudo
FT                   /locus_tag="mCG_1048878"
FT                   /note="gene_id=mCG1048878.1"
FT   mRNA            1030078..1031001
FT                   /pseudo
FT                   /locus_tag="mCG_1048878"
FT                   /note="gene_id=mCG1048878.1 transcript_id=mCT166582.1
FT                   created on 24-MAY-2002"
FT   gene            complement(1046927..>1066327)
FT                   /locus_tag="mCG_67058"
FT                   /note="gene_id=mCG67058.1"
FT   mRNA            complement(join(1046927..1047097,1053051..1053258,
FT                   1066135..>1066327))
FT                   /locus_tag="mCG_67058"
FT                   /product="mCG67058"
FT                   /note="gene_id=mCG67058.1 transcript_id=mCT67241.1 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(1047058..1047097,1053051..>1053241))
FT                   /codon_start=1
FT                   /locus_tag="mCG_67058"
FT                   /product="mCG67058"
FT                   /note="gene_id=mCG67058.1 transcript_id=mCT67241.1
FT                   protein_id=mCP33400.1"
FT                   /protein_id="EDL28604.1"
FT                   /translation="LLESCCPAFCIFTKNLLPETKLYFYLITSGPYPAGSSQNSPAIIG
FT                   ISSSSSEGAAAISPVLAKRGVERETLLVPCI"
FT   gene            complement(1112878..1133362)
FT                   /gene="BC088983"
FT                   /locus_tag="mCG_4611"
FT                   /note="gene_id=mCG4611.1"
FT   mRNA            complement(join(1112878..1113089,1113835..1113872,
FT                   1114134..1114258,1119930..1120002,1121076..1121282,
FT                   1122246..1122413,1125408..1125530,1126619..1126765,
FT                   1127906..1128053,1129888..1130024,1133045..1133362))
FT                   /gene="BC088983"
FT                   /locus_tag="mCG_4611"
FT                   /product="cDNA sequence BC088983, transcript variant
FT                   mCT3366"
FT                   /note="gene_id=mCG4611.1 transcript_id=mCT3366.2 created on
FT                   29-MAY-2002"
FT   CDS             complement(join(1113047..1113089,1113835..1113872,
FT                   1114134..1114258,1119930..1120002,1121076..1121282,
FT                   1122246..1122413,1125408..1125530,1126619..1126765,
FT                   1127906..1128053,1129888..1129976))
FT                   /codon_start=1
FT                   /gene="BC088983"
FT                   /locus_tag="mCG_4611"
FT                   /product="cDNA sequence BC088983, isoform CRA_b"
FT                   /note="gene_id=mCG4611.1 transcript_id=mCT3366.2
FT                   protein_id=mCP11628.2 isoform=CRA_b"
FT                   /protein_id="EDL28606.1"
FT                   /translation="MATGDLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISY
FT                   SLTSYSPYVAELLMESSIELIAKNDVRFTDTVYKLLRDQFDYKPILTKKQFIQSGFAEW
FT                   KIEIVCDILNCVMKKHKELIGLDKNSSCQRKKNVSEKPEPCSNSEKRPAEAVGIDITGR
FT                   FMTSGKKKAVVIRHLYTDEKVGVPEGTVTLADISQGCSESAEQSSDIRIPEAQDPEVKA
FT                   ELQDICDHPEITALQIALAECQEKLKQLTWIEKRLERLEAATHGKVMVDEKAWNNLLSR
FT                   VTLLETEMLLSKKSESVERNVASQDCESISDVDFVPYDKNYSVGGAAGNYRSSGCSAVS
FT                   AETAPGSSIVNYCVLREFSEETTIQKMERMKKMFEETAELLKCSSR"
FT   mRNA            complement(join(1120961..1121282,1122246..1122413,
FT                   1125408..1125530,1126619..1126765,1127906..1128053,
FT                   1129888..1130024,1131725..1131884,1132563..1132621,
FT                   1133188..1133301))
FT                   /gene="BC088983"
FT                   /locus_tag="mCG_4611"
FT                   /product="cDNA sequence BC088983, transcript variant
FT                   mCT169547"
FT                   /note="gene_id=mCG4611.1 transcript_id=mCT169547.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1121049..1121282,1122246..1122413,
FT                   1125408..1125530,1126619..1126765,1127906..1128053,
FT                   1129888..1129976))
FT                   /codon_start=1
FT                   /gene="BC088983"
FT                   /locus_tag="mCG_4611"
FT                   /product="cDNA sequence BC088983, isoform CRA_a"
FT                   /note="gene_id=mCG4611.1 transcript_id=mCT169547.0
FT                   protein_id=mCP92738.0 isoform=CRA_a"
FT                   /protein_id="EDL28605.1"
FT                   /translation="MATGDLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISY
FT                   SLTSYSPYVAELLMESSIELIAKNDVRFTDTVYKLLRDQFDYKPILTKKQFIQSGFAEW
FT                   KIEIVCDILNCVMKKHKELIGLDKNSSCQRKKNVSEKPEPCSNSEKRPAEAVGIDITGR
FT                   FMTSGKKKAVVIRHLYTDEKVGVPEGTVTLADISQGCSESAEQSSDIRIPEAQDPEVKA
FT                   ELQDICDHPEITALQIALAECQEKLKQLTWIEKRLERLEAATHGKVMVDEKAWNNLLSR
FT                   VTLLETEMLLSKKVSLWKAVQ"
FT   gene            1133614..1176362
FT                   /gene="Fbxo8"
FT                   /locus_tag="mCG_4610"
FT                   /note="gene_id=mCG4610.3"
FT   mRNA            join(1133614..1133876,1146536..1146638,1147033..1147369,
FT                   1151757..1151883,1170431..1170549,1172482..1172678,
FT                   1173859..1176362)
FT                   /gene="Fbxo8"
FT                   /locus_tag="mCG_4610"
FT                   /product="F-box only protein 8, transcript variant mCT3372"
FT                   /note="gene_id=mCG4610.3 transcript_id=mCT3372.3 created on
FT                   12-JUN-2003"
FT   mRNA            join(1133625..1133876,1147033..1147369,1151757..1151883,
FT                   1173859..1176362)
FT                   /gene="Fbxo8"
FT                   /locus_tag="mCG_4610"
FT                   /product="F-box only protein 8, transcript variant
FT                   mCT169546"
FT                   /note="gene_id=mCG4610.3 transcript_id=mCT169546.1 created
FT                   on 12-JUN-2003"
FT   mRNA            join(1133627..1133876,1147033..1147369,1151757..1151883,
FT                   1170431..1170549,1172482..1172678,1173859..1176362)
FT                   /gene="Fbxo8"
FT                   /locus_tag="mCG_4610"
FT                   /product="F-box only protein 8, transcript variant
FT                   mCT185440"
FT                   /note="gene_id=mCG4610.3 transcript_id=mCT185440.0 created
FT                   on 12-JUN-2003"
FT   gene            1143422..1143895
FT                   /pseudo
FT                   /locus_tag="mCG_140443"
FT                   /note="gene_id=mCG140443.0"
FT   mRNA            1143422..1143895
FT                   /pseudo
FT                   /locus_tag="mCG_140443"
FT                   /note="gene_id=mCG140443.0 transcript_id=mCT169548.0
FT                   created on 29-MAY-2002"
FT   CDS             join(1147041..1147369,1151757..1151883,1170431..1170549,
FT                   1172482..1172678,1173859..1174046)
FT                   /codon_start=1
FT                   /gene="Fbxo8"
FT                   /locus_tag="mCG_4610"
FT                   /product="F-box only protein 8, isoform CRA_b"
FT                   /note="gene_id=mCG4610.3 transcript_id=mCT185440.0
FT                   protein_id=mCP106698.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9QZN3"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="MGI:MGI:1354696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZN3"
FT                   /protein_id="EDL28608.1"
FT                   /translation="MGQGLWRVARNHHLQQEAYSETGYLSREQSRRVASSNISHTSHRK
FT                   QAQGGIDIYHLLKARKSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLAND
FT                   ELLWQGLCKSTWGHCSIYNKNPPLGFSFRKLYMQLDEGSLTFNANPEEGVSYFMSKGIL
FT                   DDSPKEIAKFIFCTRTLNWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIH
FT                   APEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKN
FT                   KMSKREFIRNTRRAAQNISEDFVGHLYDNIYLIGHVAA"
FT   CDS             join(1147041..1147369,1151757..1151883,1170431..1170549,
FT                   1172482..1172678,1173859..1174046)
FT                   /codon_start=1
FT                   /gene="Fbxo8"
FT                   /locus_tag="mCG_4610"
FT                   /product="F-box only protein 8, isoform CRA_b"
FT                   /note="gene_id=mCG4610.3 transcript_id=mCT3372.3
FT                   protein_id=mCP11623.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9QZN3"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="MGI:MGI:1354696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZN3"
FT                   /protein_id="EDL28609.1"
FT                   /translation="MGQGLWRVARNHHLQQEAYSETGYLSREQSRRVASSNISHTSHRK
FT                   QAQGGIDIYHLLKARKSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLAND
FT                   ELLWQGLCKSTWGHCSIYNKNPPLGFSFRKLYMQLDEGSLTFNANPEEGVSYFMSKGIL
FT                   DDSPKEIAKFIFCTRTLNWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIH
FT                   APEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKN
FT                   KMSKREFIRNTRRAAQNISEDFVGHLYDNIYLIGHVAA"
FT   CDS             join(1147041..1147369,1151757..1151883,1173859..1173888)
FT                   /codon_start=1
FT                   /gene="Fbxo8"
FT                   /locus_tag="mCG_4610"
FT                   /product="F-box only protein 8, isoform CRA_a"
FT                   /note="gene_id=mCG4610.3 transcript_id=mCT169546.1
FT                   protein_id=mCP92748.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q921R9"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="MGI:MGI:1354696"
FT                   /db_xref="UniProtKB/TrEMBL:Q921R9"
FT                   /protein_id="EDL28607.1"
FT                   /translation="MGQGLWRVARNHHLQQEAYSETGYLSREQSRRVASSNISHTSHRK
FT                   QAQGGIDIYHLLKARKSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLAND
FT                   ELLWQGLCKSTWGHCSIYNKNPPLGFSFRKLYMQLDEGSLTFNANPEEMLSMYCATL"
FT   gene            1293131..1295284
FT                   /pseudo
FT                   /locus_tag="mCG_11167"
FT                   /note="gene_id=mCG11167.2"
FT   mRNA            1293131..1295284
FT                   /pseudo
FT                   /locus_tag="mCG_11167"
FT                   /note="gene_id=mCG11167.2 transcript_id=mCT11245.2 created
FT                   on 29-MAY-2002"
FT   gene            1529114..1531560
FT                   /pseudo
FT                   /locus_tag="mCG_49700"
FT                   /note="gene_id=mCG49700.2"
FT   mRNA            1529114..1531560
FT                   /pseudo
FT                   /locus_tag="mCG_49700"
FT                   /note="gene_id=mCG49700.2 transcript_id=mCT49883.2 created
FT                   on 24-NOV-2004"
FT   gene            complement(1855156..1855674)
FT                   /pseudo
FT                   /locus_tag="mCG_11162"
FT                   /note="gene_id=mCG11162.2"
FT   mRNA            complement(1855156..1855674)
FT                   /pseudo
FT                   /locus_tag="mCG_11162"
FT                   /note="gene_id=mCG11162.2 transcript_id=mCT11240.2 created
FT                   on 29-MAY-2002"
FT   gene            complement(1867978..>1884418)
FT                   /locus_tag="mCG_117600"
FT                   /note="gene_id=mCG117600.1"
FT   mRNA            complement(join(1867978..1867996,1868823..1868983,
FT                   1870647..1870743,1883762..1883866,1884277..>1884418))
FT                   /locus_tag="mCG_117600"
FT                   /product="mCG117600, transcript variant mCT169539"
FT                   /note="gene_id=mCG117600.1 transcript_id=mCT169539.0
FT                   created on 29-MAY-2002"
FT   CDS             complement(join(1868965..1868983,1870647..1870743,
FT                   1883762..1883866,1884277..>1884343))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117600"
FT                   /product="mCG117600, isoform CRA_b"
FT                   /note="gene_id=mCG117600.1 transcript_id=mCT169539.0
FT                   protein_id=mCP92764.0 isoform=CRA_b"
FT                   /protein_id="EDL28611.1"
FT                   /translation="CKCLTDASLLKYFPPILKNLKPATLTEIAKIFKVGHLDFSNLWCG
FT                   EYPCSSCLTSLFGRSDSIYSKDRVGDGLPLVLIEMTSSHLSPYSWVHRCG"
FT   mRNA            complement(join(1870647..1870743,1878089..1878188,
FT                   1883762..1883866,1884277..>1884418))
FT                   /locus_tag="mCG_117600"
FT                   /product="mCG117600, transcript variant mCT118742"
FT                   /note="gene_id=mCG117600.1 transcript_id=mCT118742.1
FT                   created on 29-MAY-2002"
FT   CDS             complement(join(1870734..1870743,1878089..1878188,
FT                   1883762..1883866,1884277..>1884343))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117600"
FT                   /product="mCG117600, isoform CRA_a"
FT                   /note="gene_id=mCG117600.1 transcript_id=mCT118742.1
FT                   protein_id=mCP54202.1 isoform=CRA_a"
FT                   /protein_id="EDL28610.1"
FT                   /translation="CKCLTDASLLKYFPPILKNLKPATLTEIAKIFKVGHLDFSNLWCG
FT                   EYPCSSCLTSLFEGTVHSRAIRHLLGVFSSRLQESVTSERTSDWPRQV"
FT   gene            complement(1878743..1882399)
FT                   /locus_tag="mCG_147972"
FT                   /note="gene_id=mCG147972.0"
FT   mRNA            complement(1878743..1882399)
FT                   /locus_tag="mCG_147972"
FT                   /product="mCG147972"
FT                   /note="gene_id=mCG147972.0 transcript_id=mCT188235.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1879112..1879411)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147972"
FT                   /product="mCG147972"
FT                   /note="gene_id=mCG147972.0 transcript_id=mCT188235.0
FT                   protein_id=mCP108239.0"
FT                   /protein_id="EDL28612.1"
FT                   /translation="MDFFFFLTSDSSLQAFPAFFYSLCLETRDLSQDRLGFRLTKRNTF
FT                   IVNINGKLRFLQGLGLADQKQLVLISQYSLEFRQLTAILVLMKQYEKASCKKHW"
FT   gene            <1885639..1888258
FT                   /gene="Hand2"
FT                   /locus_tag="mCG_11163"
FT                   /note="gene_id=mCG11163.2"
FT   mRNA            join(<1885639..1886086,1887387..1888258)
FT                   /gene="Hand2"
FT                   /locus_tag="mCG_11163"
FT                   /product="heart and neural crest derivatives expressed
FT                   transcript 2"
FT                   /note="gene_id=mCG11163.2 transcript_id=mCT11241.2 created
FT                   on 29-MAY-2002"
FT   CDS             join(<1885640..1886086,1887387..1887485)
FT                   /codon_start=1
FT                   /gene="Hand2"
FT                   /locus_tag="mCG_11163"
FT                   /product="heart and neural crest derivatives expressed
FT                   transcript 2"
FT                   /note="gene_id=mCG11163.2 transcript_id=mCT11241.2
FT                   protein_id=mCP11626.1"
FT                   /protein_id="EDL28613.1"
FT                   /translation="HEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGAAGLDHSHYG
FT                   GVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKT
FT                   LRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKK
FT                   TKGRTGWPQHVWALELKQ"
FT   gene            1896069..1918074
FT                   /locus_tag="mCG_140438"
FT                   /note="gene_id=mCG140438.0"
FT   mRNA            join(1896069..1896268,1908763..1908873,1917433..1918074)
FT                   /locus_tag="mCG_140438"
FT                   /product="mCG140438"
FT                   /note="gene_id=mCG140438.0 transcript_id=mCT169534.0
FT                   created on 29-MAY-2002"
FT   CDS             1917433..1917630
FT                   /codon_start=1
FT                   /locus_tag="mCG_140438"
FT                   /product="mCG140438"
FT                   /note="gene_id=mCG140438.0 transcript_id=mCT169534.0
FT                   protein_id=mCP92777.0"
FT                   /protein_id="EDL28614.1"
FT                   /translation="MPTSPKESGVSCVPHGTRGKEMIKAVRFPGSSWCLRWVLIWEESR
FT                   RGYGRLPSASVLNLPGLQMT"
FT   gene            2020688..2042389
FT                   /gene="Scrg1"
FT                   /locus_tag="mCG_11164"
FT                   /note="gene_id=mCG11164.1"
FT   mRNA            join(2020688..2020892,2039114..2039366,2042148..2042389)
FT                   /gene="Scrg1"
FT                   /locus_tag="mCG_11164"
FT                   /product="scrapie responsive gene 1"
FT                   /note="gene_id=mCG11164.1 transcript_id=mCT11242.0 created
FT                   on 29-MAY-2002"
FT   CDS             join(2039125..2039366,2042148..2042202)
FT                   /codon_start=1
FT                   /gene="Scrg1"
FT                   /locus_tag="mCG_11164"
FT                   /product="scrapie responsive gene 1"
FT                   /note="gene_id=mCG11164.1 transcript_id=mCT11242.0
FT                   protein_id=mCP11629.1"
FT                   /db_xref="InterPro:IPR028063"
FT                   /db_xref="MGI:MGI:1328308"
FT                   /db_xref="UniProtKB/TrEMBL:Q543T5"
FT                   /protein_id="EDL28615.1"
FT                   /translation="MMKSVVLVILGLTLLLETQAMPSSRLSCYRKLLKDRNCHNLPEGR
FT                   ADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH"
FT   gene            complement(2047537..2052669)
FT                   /gene="Sap30"
FT                   /locus_tag="mCG_11165"
FT                   /note="gene_id=mCG11165.1"
FT   mRNA            complement(join(2047537..2047862,2049854..2049952,
FT                   2050322..2050447,2052064..2052669))
FT                   /gene="Sap30"
FT                   /locus_tag="mCG_11165"
FT                   /product="sin3 associated polypeptide, transcript variant
FT                   mCT11243"
FT                   /note="gene_id=mCG11165.1 transcript_id=mCT11243.0 created
FT                   on 25-JUN-2002"
FT   mRNA            complement(join(2047575..2047858,2049854..2049952,
FT                   2050322..2050447,2052064..2052596))
FT                   /gene="Sap30"
FT                   /locus_tag="mCG_11165"
FT                   /product="sin3 associated polypeptide, transcript variant
FT                   mCT170261"
FT                   /note="gene_id=mCG11165.1 transcript_id=mCT170261.0 created
FT                   on 25-JUN-2002"
FT   CDS             complement(join(2047740..2047862,2049854..2049952,
FT                   2050322..2050447,2052064..2052378))
FT                   /codon_start=1
FT                   /gene="Sap30"
FT                   /locus_tag="mCG_11165"
FT                   /product="sin3 associated polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG11165.1 transcript_id=mCT11243.0
FT                   protein_id=mCP11630.1 isoform=CRA_a"
FT                   /db_xref="GOA:O88574"
FT                   /db_xref="InterPro:IPR024145"
FT                   /db_xref="InterPro:IPR025717"
FT                   /db_xref="InterPro:IPR025718"
FT                   /db_xref="MGI:MGI:1929129"
FT                   /db_xref="PDB:2LD7"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88574"
FT                   /protein_id="EDL28616.1"
FT                   /translation="MNGFTPEEMSRGGDAAAAVAAVVAAAAAAASAGNGNAAGGGAEVP
FT                   GAGAVSASGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDK
FT                   SARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKR
FT                   HFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH"
FT   CDS             complement(join(2047829..2047858,2049854..2049952,
FT                   2050322..2050447,2052064..2052378))
FT                   /codon_start=1
FT                   /gene="Sap30"
FT                   /locus_tag="mCG_11165"
FT                   /product="sin3 associated polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG11165.1 transcript_id=mCT170261.0
FT                   protein_id=mCP93179.0 isoform=CRA_b"
FT                   /protein_id="EDL28617.1"
FT                   /translation="MNGFTPEEMSRGGDAAAAVAAVVAAAAAAASAGNGNAAGGGAEVP
FT                   GAGAVSASGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDK
FT                   SARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKR
FT                   HFKLPTRPGLNKAQLVELVATLSLFQ"
FT   gene            2052863..2075109
FT                   /locus_tag="mCG_140439"
FT                   /note="gene_id=mCG140439.0"
FT   mRNA            join(2052863..2053005,2055151..2055278,2071389..2071662,
FT                   2074952..2075109)
FT                   /locus_tag="mCG_140439"
FT                   /product="mCG140439, transcript variant mCT169537"
FT                   /note="gene_id=mCG140439.0 transcript_id=mCT169537.0
FT                   created on 29-MAY-2002"
FT   mRNA            join(2052943..2053005,2054402..2054593,2055151..2055278,
FT                   2071389..2071453)
FT                   /locus_tag="mCG_140439"
FT                   /product="mCG140439, transcript variant mCT169536"
FT                   /note="gene_id=mCG140439.0 transcript_id=mCT169536.0
FT                   created on 29-MAY-2002"
FT   CDS             join(2054448..2054593,2055151..2055196)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140439"
FT                   /product="mCG140439, isoform CRA_b"
FT                   /note="gene_id=mCG140439.0 transcript_id=mCT169536.0
FT                   protein_id=mCP92769.0 isoform=CRA_b"
FT                   /protein_id="EDL28619.1"
FT                   /translation="MITKNNSNSGVESICYRECYRGQSWRSDTSPLEEPRRSCVDPRYW
FT                   NKKRNFLQYFHSNLQMKV"
FT   mRNA            join(2054461..2054593,2055151..2055278,2071389..2071662,
FT                   2074952..2075109)
FT                   /locus_tag="mCG_140439"
FT                   /product="mCG140439, transcript variant mCT169535"
FT                   /note="gene_id=mCG140439.0 transcript_id=mCT169535.0
FT                   created on 29-MAY-2002"
FT   CDS             join(2071545..2071662,2074952..2075004)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140439"
FT                   /product="mCG140439, isoform CRA_a"
FT                   /note="gene_id=mCG140439.0 transcript_id=mCT169535.0
FT                   protein_id=mCP92770.0 isoform=CRA_a"
FT                   /protein_id="EDL28618.1"
FT                   /translation="MTFSLREILKMNLPTFHTPASFKPPTQEICLCLLRAGIKEITSLP
FT                   LEPTSSGFCLY"
FT   CDS             join(2071545..2071662,2074952..2075004)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140439"
FT                   /product="mCG140439, isoform CRA_a"
FT                   /note="gene_id=mCG140439.0 transcript_id=mCT169537.0
FT                   protein_id=mCP92780.0 isoform=CRA_a"
FT                   /protein_id="EDL28620.1"
FT                   /translation="MTFSLREILKMNLPTFHTPASFKPPTQEICLCLLRAGIKEITSLP
FT                   LEPTSSGFCLY"
FT   gene            complement(2072647..>2074578)
FT                   /locus_tag="mCG_1048941"
FT                   /note="gene_id=mCG1048941.0"
FT   mRNA            complement(join(2072647..2072677,2074257..>2074578))
FT                   /locus_tag="mCG_1048941"
FT                   /product="mCG1048941"
FT                   /note="gene_id=mCG1048941.0 transcript_id=mCT166645.0
FT                   created on 29-MAY-2002"
FT   CDS             complement(2074376..>2074504)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048941"
FT                   /product="mCG1048941"
FT                   /note="gene_id=mCG1048941.0 transcript_id=mCT166645.0
FT                   protein_id=mCP54204.0"
FT                   /protein_id="EDL28621.1"
FT                   /translation="RRGPPCPATLSDLIKGGKSLTGVPSYFFGFKVNFRCSQIDNQ"
FT   gene            <2077875..2079308
FT                   /locus_tag="mCG_11166"
FT                   /note="gene_id=mCG11166.1"
FT   mRNA            join(<2077875..2078020,2078103..2078277,2078779..2079308)
FT                   /locus_tag="mCG_11166"
FT                   /product="mCG11166"
FT                   /note="gene_id=mCG11166.1 transcript_id=mCT11244.2 created
FT                   on 29-MAY-2002"
FT   CDS             join(<2077875..2078020,2078103..2078277,2078779..2078940)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11166"
FT                   /product="mCG11166"
FT                   /note="gene_id=mCG11166.1 transcript_id=mCT11244.2
FT                   protein_id=mCP11621.1"
FT                   /protein_id="EDL28622.1"
FT                   /translation="TMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGDKKGKKKDPNAP
FT                   KRPPSAFFLFCSENRPKIKIEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEK
FT                   YEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEEEEDDEEEEEDEE"
FT   gene            complement(2085071..2085803)
FT                   /pseudo
FT                   /locus_tag="mCG_1048880"
FT                   /note="gene_id=mCG1048880.1"
FT   mRNA            complement(2085071..2085803)
FT                   /pseudo
FT                   /locus_tag="mCG_1048880"
FT                   /note="gene_id=mCG1048880.1 transcript_id=mCT166584.1
FT                   created on 29-MAY-2002"
FT   gene            complement(2088739..>2149199)
FT                   /gene="Galnt7"
FT                   /locus_tag="mCG_11168"
FT                   /note="gene_id=mCG11168.2"
FT   mRNA            complement(join(2088739..2091162,2096517..2096645,
FT                   2097544..2097642,2101527..2101745,2103030..2103152,
FT                   2104964..2105081,2107456..2107638,2110273..2110352,
FT                   2110613..2110743,2117388..2117554,2148735..>2149199))
FT                   /gene="Galnt7"
FT                   /locus_tag="mCG_11168"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine: polypeptide
FT                   N-acetylgalactosaminyltransferase 7, transcript variant
FT                   mCT11246"
FT                   /note="gene_id=mCG11168.2 transcript_id=mCT11246.2 created
FT                   on 23-AUG-2002"
FT   mRNA            complement(join(2089611..2091162,2096517..2096645,
FT                   2097544..2097642,2101527..2101745,2103030..2103152,
FT                   2104964..2105081,2107779..2107961,2110273..2110352,
FT                   2110613..2110743,2117388..2117554,2148735..>2149199))
FT                   /gene="Galnt7"
FT                   /locus_tag="mCG_11168"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine: polypeptide
FT                   N-acetylgalactosaminyltransferase 7, transcript variant
FT                   mCT192547"
FT                   /note="gene_id=mCG11168.2 transcript_id=mCT192547.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2091025..2091162,2096517..2096645,
FT                   2097544..2097642,2101527..2101745,2103030..2103152,
FT                   2104964..2105081,2107456..2107638,2110273..2110352,
FT                   2110613..2110743,2117388..2117554,2148735..>2149195))
FT                   /codon_start=1
FT                   /gene="Galnt7"
FT                   /locus_tag="mCG_11168"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine: polypeptide
FT                   N-acetylgalactosaminyltransferase 7, isoform CRA_a"
FT                   /note="gene_id=mCG11168.2 transcript_id=mCT11246.2
FT                   protein_id=mCP11624.2 isoform=CRA_a"
FT                   /protein_id="EDL28623.1"
FT                   /translation="EDRDVNNPLPNRGGNGLAPGDDRFKPVVPWPHVEGVEVDLESIRR
FT                   KNKAKNEQERHAGGDSQRDVMQRQYLTFKPQTFTYRDPVLRPGVLGNFEPKEPEPHGVV
FT                   GGPGEKAKPLVLGPEYKQAVQASIKEFGFNMVASDMISLDRSVNDLRQEECKYWHYDEN
FT                   LLTSSVVIVFHNEGWSTLMRTVHSVIKRTPRKYLAEIVLIDDFSNKEHLKEKLDEYIKL
FT                   WNGLVKVFRNERREGLIQARSIGAQKAKLGQVLIYLDAHCEVAVNWYAPLVAPISKDRT
FT                   ICTVPIIDVISGNTYEIIPQGGGDEDGYARGAWDWSMLWKRVPLTSREKRLRKTKTEPY
FT                   RSPAMAGGLFAIEKDFFFELGLYDPGLQIWGGENFEISYKIWQCGGKLLFVPCSRVGHI
FT                   YRLEGWQGNPPPLYVGSSPTLKNYVRVVEVWWDEYKDYFYASRPESKALPYGDISELKK
FT                   FREDHNCKSFKWFMEEIAYDITAHYPLPPRNVEWGEIRGLETAYCIDSMGKTNGGFVEL
FT                   GPCHRMGGNQLFRINEANQLMQYDQCLTKGPDGSKVMITHCNLNEFKEWQYFKSLHRFT
FT                   HITSGKCLDRSEVLHQVFISTCDSSKMTQKWEMNNIHSV"
FT   CDS             complement(join(2091025..2091162,2096517..2096645,
FT                   2097544..2097642,2101527..2101745,2103030..2103152,
FT                   2104964..2105081,2107779..2107961,2110273..2110352,
FT                   2110613..2110743,2117388..2117554,2148735..>2149195))
FT                   /codon_start=1
FT                   /gene="Galnt7"
FT                   /locus_tag="mCG_11168"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine: polypeptide
FT                   N-acetylgalactosaminyltransferase 7, isoform CRA_b"
FT                   /note="gene_id=mCG11168.2 transcript_id=mCT192547.0
FT                   protein_id=mCP113501.0 isoform=CRA_b"
FT                   /protein_id="EDL28624.1"
FT                   /translation="EDRDVNNPLPNRGGNGLAPGDDRFKPVVPWPHVEGVEVDLESIRR
FT                   KNKAKNEQERHAGGDSQRDVMQRQYLTFKPQTFTYRDPVLRPGVLGNFEPKEPEPHGVV
FT                   GGPGEKAKPLVLGPEYKQAVQASIKEFGFNMVASDMISLDRSVNDLRQEECKYWHYDEN
FT                   LLTSSVVIVFHNEGWSTLMRTVHSVIKRTPRKYLAEIVLIDDFSNKEHLKEKLDEYIKL
FT                   WNGLVKVFRNERREGLIQARSIGAQKAKLGQVLIYLDAHCEVAVNWYAPLVAPISKDRA
FT                   TCTVPLIDYIDGNDYSIEPQQGGDEDGFARGAWDWSMLWKRIPLSHKEKAKRKHKTEPY
FT                   RSPAMAGGLFAIEKDFFFELGLYDPGLQIWGGENFEISYKIWQCGGKLLFVPCSRVGHI
FT                   YRLEGWQGNPPPLYVGSSPTLKNYVRVVEVWWDEYKDYFYASRPESKALPYGDISELKK
FT                   FREDHNCKSFKWFMEEIAYDITAHYPLPPRNVEWGEIRGLETAYCIDSMGKTNGGFVEL
FT                   GPCHRMGGNQLFRINEANQLMQYDQCLTKGPDGSKVMITHCNLNEFKEWQYFKSLHRFT
FT                   HITSGKCLDRSEVLHQVFISTCDSSKMTQKWEMNNIHSV"
FT   gene            2115172..2116427
FT                   /pseudo
FT                   /locus_tag="mCG_112896"
FT                   /note="gene_id=mCG112896.1"
FT   mRNA            2115172..2116427
FT                   /pseudo
FT                   /locus_tag="mCG_112896"
FT                   /note="gene_id=mCG112896.1 transcript_id=mCT113969.1
FT                   created on 23-MAY-2003"
FT   gene            <2259826..2286506
FT                   /locus_tag="mCG_144778"
FT                   /note="gene_id=mCG144778.0"
FT   mRNA            join(<2259826..2259930,2260053..2260178,2285913..2286506)
FT                   /locus_tag="mCG_144778"
FT                   /product="mCG144778"
FT                   /note="gene_id=mCG144778.0 transcript_id=mCT184202.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<2260079..2260178,2285913..2286286)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144778"
FT                   /product="mCG144778"
FT                   /note="gene_id=mCG144778.0 transcript_id=mCT184202.0
FT                   protein_id=mCP105389.0"
FT                   /protein_id="EDL28625.1"
FT                   /translation="QALAHTCTDDQFSLLCLESLDVTSFLLCLKVWKVFWTRKIQGCVR
FT                   SCLIVLPEDPSIPLLGIYPEDVPTCKKDTCSTMFIAALFIIARSWKEPICPSTEEWIQK
FT                   MWYIYTMEYYSAIKKNEFMKFLGKWMDLEGIILSEVTQSQKNSHVMYSLISGF"
FT   gene            complement(2335870..>2531147)
FT                   /locus_tag="mCG_6366"
FT                   /note="gene_id=mCG6366.2"
FT   mRNA            complement(join(2335870..2336832,2354309..2354458,
FT                   2363644..2363810,2398480..2398696,2418893..2419000,
FT                   2452456..2452573,2526854..2527037,2530962..>2531147))
FT                   /locus_tag="mCG_6366"
FT                   /product="mCG6366"
FT                   /note="gene_id=mCG6366.2 transcript_id=mCT5728.2 created on
FT                   30-MAY-2002"
FT   CDS             complement(join(2336665..2336832,2354309..2354458,
FT                   2363644..2363810,2398480..2398696,2418893..2419000,
FT                   2452456..2452573,2526854..2527037,2530962..>2531145))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6366"
FT                   /product="mCG6366"
FT                   /note="gene_id=mCG6366.2 transcript_id=mCT5728.2
FT                   protein_id=mCP11631.2"
FT                   /protein_id="EDL28626.1"
FT                   /translation="HLKDKLEDYMARFSKVRIVRTKKREGLIRTRLLGASVARGEVLTF
FT                   LDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYY
FT                   KRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKV
FT                   WMCGGEMFDVPCSRVGHIYRKYVPYKVPSGTSLARNLKRVAETWMDEFAEYIYQRRPEY
FT                   RHLSTGDISAQKELRKRLKCKDFKWFMAAVAWDVPKYYPPVEPLPAAWGLSGIVTQPVL
FT                   DVFLIQIRSVAANLCVDSKHGATGTELRLDVCVKDGSERTWSHEQLFTFGWREDIRPGE
FT                   PLHTRKFCLDAISHSSPVTLYDCHGMKGNQLWGYREDRTLFHPVSNSCMDCNPSEKKIF
FT                   MARCDPLSETQQWIFEHINMTVLEKNSHYAIS"
FT   gene            <2359484..2362109
FT                   /locus_tag="mCG_64840"
FT                   /note="gene_id=mCG64840.1"
FT   mRNA            join(<2359484..2359615,2361896..2362109)
FT                   /locus_tag="mCG_64840"
FT                   /product="mCG64840"
FT                   /note="gene_id=mCG64840.1 transcript_id=mCT65023.1 created
FT                   on 30-MAY-2002"
FT   CDS             join(<2359484..2359615,2361896..2362021)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64840"
FT                   /product="mCG64840"
FT                   /note="gene_id=mCG64840.1 transcript_id=mCT65023.1
FT                   protein_id=mCP33408.1"
FT                   /protein_id="EDL28627.1"
FT                   /translation="PVHKARTISNSSADDPGRMNHTPVSHTEAGLVLARARQKVFLIKV
FT                   IQFKERPFYKDFQVLGWIRIHTFLKCSCTESAFQSKQCIV"
FT   gene            complement(2968928..3242438)
FT                   /gene="4930431L04Rik"
FT                   /locus_tag="mCG_4548"
FT                   /note="gene_id=mCG4548.2"
FT   mRNA            complement(join(2968928..2969300,3007204..3007342,
FT                   3071608..3071716,3129424..3129453,3141232..3141409,
FT                   3142919..3143257,3242340..3242438))
FT                   /gene="4930431L04Rik"
FT                   /locus_tag="mCG_4548"
FT                   /product="RIKEN cDNA 4930431L04, transcript variant
FT                   mCT171238"
FT                   /note="gene_id=mCG4548.2 transcript_id=mCT171238.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(2969117..2969300,3007204..3007342,
FT                   3071608..3071716,3129424..3129444))
FT                   /codon_start=1
FT                   /gene="4930431L04Rik"
FT                   /locus_tag="mCG_4548"
FT                   /product="RIKEN cDNA 4930431L04, isoform CRA_a"
FT                   /note="gene_id=mCG4548.2 transcript_id=mCT171238.0
FT                   protein_id=mCP94156.0 isoform=CRA_a"
FT                   /protein_id="EDL28628.1"
FT                   /translation="MILFYKQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQRDALRSGK
FT                   GEHGKPYPLTEEDRDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTS
FT                   IIIPFHNEGWTSLLRTIHSIINRTPESLIAEIILVDDFSDRGKLHW"
FT   mRNA            complement(join(3037124..3037233,3071608..3071716,
FT                   3129424..3129453,3141232..3141409,3142919..3143257,
FT                   3242340..3242438))
FT                   /gene="4930431L04Rik"
FT                   /locus_tag="mCG_4548"
FT                   /product="RIKEN cDNA 4930431L04, transcript variant
FT                   mCT3466"
FT                   /note="gene_id=mCG4548.2 transcript_id=mCT3466.1 created on
FT                   24-JUL-2002"
FT   CDS             complement(join(3037217..3037233,3071608..3071716,
FT                   3129424..3129444))
FT                   /codon_start=1
FT                   /gene="4930431L04Rik"
FT                   /locus_tag="mCG_4548"
FT                   /product="RIKEN cDNA 4930431L04, isoform CRA_b"
FT                   /note="gene_id=mCG4548.2 transcript_id=mCT3466.1
FT                   protein_id=mCP14716.2 isoform=CRA_b"
FT                   /protein_id="EDL28629.1"
FT                   /translation="MILFYKQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQRDALRSGH
FT                   PCE"
FT   gene            complement(<3241236..>3242177)
FT                   /locus_tag="mCG_140442"
FT                   /note="gene_id=mCG140442.0"
FT   mRNA            complement(<3241236..>3242177)
FT                   /locus_tag="mCG_140442"
FT                   /product="mCG140442"
FT                   /note="gene_id=mCG140442.0 transcript_id=mCT169545.0
FT                   created on 30-MAY-2002"
FT   CDS             complement(3241236..3242177)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140442"
FT                   /product="mCG140442"
FT                   /note="gene_id=mCG140442.0 transcript_id=mCT169545.0
FT                   protein_id=mCP92754.0"
FT                   /protein_id="EDL28630.1"
FT                   /translation="MPATVTHTTFTKSVSPGLDSLIMVATPRALLRPLGLLRLLQLCST
FT                   GMAFPLVLYMGAWMGPMGSWCVFSWSFSFAMTLIVLAVELTGLQSRLLLSWRDFPITCA
FT                   CYAVLFCLSSSIIYPMTYVRFMSYDYIRKYAVCAIIFSCISCVAYATEVTWTHSRPGYI
FT                   TGYMASKTGMLKVFESFIACVIFLFLSKPQLYGKEPALIWCLVVYIICFILTMVVILLC
FT                   LGKCTNILPIPFTTYLTGMTFMCVLLYTTAIVLWPLYQFNEEFHGFPHRVMDSSCSYKS
FT                   AHSVCVWDRQLTVTFLTGVNLMAYIADFMNSS"
FT   gene            <3452367..3454903
FT                   /gene="BC030500"
FT                   /locus_tag="mCG_140444"
FT                   /note="gene_id=mCG140444.0"
FT   mRNA            join(<3452367..3452413,3453028..3453149,3453475..3454903)
FT                   /gene="BC030500"
FT                   /locus_tag="mCG_140444"
FT                   /product="cDNA sequence BC030500"
FT                   /note="gene_id=mCG140444.0 transcript_id=mCT169549.0
FT                   created on 30-MAY-2002"
FT   CDS             join(<3452407..3452413,3453028..3453149,3453475..3453816)
FT                   /codon_start=1
FT                   /gene="BC030500"
FT                   /locus_tag="mCG_140444"
FT                   /product="cDNA sequence BC030500"
FT                   /note="gene_id=mCG140444.0 transcript_id=mCT169549.0
FT                   protein_id=mCP92760.0"
FT                   /protein_id="EDL28631.1"
FT                   /translation="NNATERTQRSITSTPRAVFLISTSRQGTDGRRRMSSVTGLYRQTG
FT                   SSLSSPERRQARNSGVQVALSGRAMEEFLHGPDGIAARKARQRQRAEATQSGLVPERRV
FT                   SPEPTAQARYVAWKEKEDSHAAWTALLAAASRQHCGEQRQLSGSRPAPGAQV"
FT   gene            complement(3634250..3635043)
FT                   /pseudo
FT                   /locus_tag="mCG_1048881"
FT                   /note="gene_id=mCG1048881.1"
FT   mRNA            complement(3634250..3635043)
FT                   /pseudo
FT                   /locus_tag="mCG_1048881"
FT                   /note="gene_id=mCG1048881.1 transcript_id=mCT166585.1
FT                   created on 30-MAY-2002"
FT   gene            3759912..3761764
FT                   /pseudo
FT                   /locus_tag="mCG_13057"
FT                   /note="gene_id=mCG13057.1"
FT   mRNA            3759912..3761764
FT                   /pseudo
FT                   /locus_tag="mCG_13057"
FT                   /note="gene_id=mCG13057.1 transcript_id=mCT12725.2 created
FT                   on 30-MAY-2002"
FT   gene            <4352835..4372267
FT                   /locus_tag="mCG_1048882"
FT                   /note="gene_id=mCG1048882.0"
FT   mRNA            join(<4352835..4353030,4355749..4355835,4356605..4356762,
FT                   4372046..4372267)
FT                   /locus_tag="mCG_1048882"
FT                   /product="mCG1048882"
FT                   /note="gene_id=mCG1048882.0 transcript_id=mCT166586.0
FT                   created on 30-MAY-2002"
FT   CDS             join(<4356655..4356762,4372046..4372177)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048882"
FT                   /product="mCG1048882"
FT                   /note="gene_id=mCG1048882.0 transcript_id=mCT166586.0
FT                   protein_id=mCP54118.0"
FT                   /protein_id="EDL28632.1"
FT                   /translation="DTSHAMLMQGWQSISQDITGKSPGKTEEFMGWLTAQMWLHLQTLH
FT                   LQTSPVWDLQSSFFLEGFLLPLILWEKEYCFKFQ"
FT   gene            complement(4794544..4798132)
FT                   /pseudo
FT                   /locus_tag="mCG_1048883"
FT                   /note="gene_id=mCG1048883.0"
FT   mRNA            complement(4794544..4798132)
FT                   /pseudo
FT                   /locus_tag="mCG_1048883"
FT                   /note="gene_id=mCG1048883.0 transcript_id=mCT166587.1
FT                   created on 31-MAY-2002"
FT   gene            complement(4944610..>5016407)
FT                   /gene="LOC330776"
FT                   /locus_tag="mCG_144780"
FT                   /note="gene_id=mCG144780.0"
FT   mRNA            complement(join(4944610..4944936,5014382..5014532,
FT                   5016323..>5016407))
FT                   /gene="LOC330776"
FT                   /locus_tag="mCG_144780"
FT                   /product="hypothetical protein EG330776"
FT                   /note="gene_id=mCG144780.0 transcript_id=mCT184204.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(4944787..4944936,5014382..5014532,
FT                   5016323..>5016405))
FT                   /codon_start=1
FT                   /gene="LOC330776"
FT                   /locus_tag="mCG_144780"
FT                   /product="hypothetical protein EG330776"
FT                   /note="gene_id=mCG144780.0 transcript_id=mCT184204.0
FT                   protein_id=mCP105391.0"
FT                   /protein_id="EDL28633.1"
FT                   /translation="LSPYSLPRNAMNFKGRWKQFIALREQKSFLLHICFCLCVIDCNSM
FT                   PETSLLTRTLLVLDYGLPRCCFTCALYIKPYLQAIGTGSQEKSGWFGFAACGGLSMLSP
FT                   RSDTIGKCGPVGVEEVYHCGCGV"
FT   gene            5019264..5058450
FT                   /gene="Aadat"
FT                   /locus_tag="mCG_14813"
FT                   /note="gene_id=mCG14813.2"
FT   mRNA            join(5019264..5019456,5020266..5020434,5029252..5029384,
FT                   5031481..5031555,5039521..5039730,5042327..5042392,
FT                   5044609..5044691,5045141..5045237,5047500..5047561,
FT                   5048653..5048717,5052982..5053088,5056448..5056549,
FT                   5057940..5058450)
FT                   /gene="Aadat"
FT                   /locus_tag="mCG_14813"
FT                   /product="aminoadipate aminotransferase"
FT                   /note="gene_id=mCG14813.2 transcript_id=mCT20552.2 created
FT                   on 31-MAY-2002"
FT   CDS             join(5019390..5019456,5020266..5020434,5029252..5029384,
FT                   5031481..5031555,5039521..5039730,5042327..5042392,
FT                   5044609..5044691,5045141..5045237,5047500..5047561,
FT                   5048653..5048717,5052982..5053088,5056448..5056549,
FT                   5057940..5057981)
FT                   /codon_start=1
FT                   /gene="Aadat"
FT                   /locus_tag="mCG_14813"
FT                   /product="aminoadipate aminotransferase"
FT                   /note="gene_id=mCG14813.2 transcript_id=mCT20552.2
FT                   protein_id=mCP3545.2"
FT                   /protein_id="EDL28634.1"
FT                   /translation="MNYSRFLTATSLARKPSPIRTTADILSKAPKTLISLAPGSPNPSM
FT                   FPFKSAAFTVENGSTIRFEDDLIKRALQYSPSYGIPELLSWLKQFQVKLHNPPTVNYPP
FT                   NQGQMDLCITSGCQDGLCKAFEMLINPGDTILVNEPLFPGTLYAMKPLGCNIINVPSDE
FT                   HGIIPEGLKKILSQWKPEDSKDPTKKTPKFLYTVPNGNNPTGNSLTGDRKKEIYELARK
FT                   YDFLIIEDDPYYFLQFSKPWEPTFLSMDVDGRVIRADTFSKTVSSGLRVGFMTGPKTLI
FT                   QNIVLHTQVSSVHACTLSQLMILQLLHQWGEEGFLAHIDRTIDFYKNQRDSILAAADKW
FT                   LRGLAEWHVPKAGMFLWIKVKGISDTKQLIEEKAIEREVLLVPGNGFFIDGSAPTSFFR
FT                   ASFSLATPAQMDTAFQRLAQLIKESL"
FT   gene            <5137433..5179224
FT                   /gene="Mfap3l"
FT                   /locus_tag="mCG_14815"
FT                   /note="gene_id=mCG14815.2"
FT   mRNA            join(<5137433..5137611,5160965..5161394,5177495..5178833)
FT                   /gene="Mfap3l"
FT                   /locus_tag="mCG_14815"
FT                   /product="microfibrillar-associated protein 3-like,
FT                   transcript variant mCT169542"
FT                   /note="gene_id=mCG14815.2 transcript_id=mCT169542.0 created
FT                   on 31-MAY-2002"
FT   CDS             join(<5137435..5137611,5160965..5161394,5177495..5178426)
FT                   /codon_start=1
FT                   /gene="Mfap3l"
FT                   /locus_tag="mCG_14815"
FT                   /product="microfibrillar-associated protein 3-like, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG14815.2 transcript_id=mCT169542.0
FT                   protein_id=mCP92751.0 isoform=CRA_a"
FT                   /protein_id="EDL28635.1"
FT                   /translation="AGSGARRWEAPAPGGGARNPHREEARAAEEVGTRSVLQSSPGGHG
FT                   ERCTATTRVAQRCQILLEQVPTPWIQDRFVPWPALSSVQSERRFHWQTISGLTEQAKTM
FT                   GLQKSHLTVCLPPSVPFLILVSTLATAKSVTNSTLNGTDVVLGSVPVIIARTDHIIVKE
FT                   GSSALINCSAYGFPDLEFKWYNSVGKLLKEMDDEKEKGGGKWQMLDGGLLNITKVSFSD
FT                   RGKYTCVASNIYGTINNTVTLRVIFTSGDMGVYYMVVCLVAFTIVMILNITRLCMMSSH
FT                   LKKTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEEL
FT                   ARSVPLPPLIMNCRTIMEEIMEVVGLEEQGQNFVRHTPEGQEAPDRDEVYTIPNSLKRS
FT                   ESPTADSDASSLHEQPQQIAIKVSVHPQSKRDHVDDQEGGHFEVKDEEETEPSEEHSPE
FT                   TAEPSTDITTTELTSEETSPVEAPERGLPPAHLETTEPAVTCDRNTCIIYESHV"
FT   mRNA            join(<5160059..5160170,5160965..5161394,5177495..5179224)
FT                   /gene="Mfap3l"
FT                   /locus_tag="mCG_14815"
FT                   /product="microfibrillar-associated protein 3-like,
FT                   transcript variant mCT20555"
FT                   /note="gene_id=mCG14815.2 transcript_id=mCT20555.1 created
FT                   on 31-MAY-2002"
FT   CDS             join(<5160150..5160170,5160965..5161394,5177495..5178426)
FT                   /codon_start=1
FT                   /gene="Mfap3l"
FT                   /locus_tag="mCG_14815"
FT                   /product="microfibrillar-associated protein 3-like, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG14815.2 transcript_id=mCT20555.1
FT                   protein_id=mCP3525.0 isoform=CRA_b"
FT                   /protein_id="EDL28636.1"
FT                   /translation="RSKPGTLILLEQVPTPWIQDRFVPWPALSSVQSERRFHWQTISGL
FT                   TEQAKTMGLQKSHLTVCLPPSVPFLILVSTLATAKSVTNSTLNGTDVVLGSVPVIIART
FT                   DHIIVKEGSSALINCSAYGFPDLEFKWYNSVGKLLKEMDDEKEKGGGKWQMLDGGLLNI
FT                   TKVSFSDRGKYTCVASNIYGTINNTVTLRVIFTSGDMGVYYMVVCLVAFTIVMILNITR
FT                   LCMMSSHLKKTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEF
FT                   ARYIEELARSVPLPPLIMNCRTIMEEIMEVVGLEEQGQNFVRHTPEGQEAPDRDEVYTI
FT                   PNSLKRSESPTADSDASSLHEQPQQIAIKVSVHPQSKRDHVDDQEGGHFEVKDEEETEP
FT                   SEEHSPETAEPSTDITTTELTSEETSPVEAPERGLPPAHLETTEPAVTCDRNTCIIYES
FT                   HV"
FT   gene            <5383260..5400434
FT                   /locus_tag="mCG_14817"
FT                   /note="gene_id=mCG14817.2"
FT   mRNA            join(<5383260..5383385,5386554..5386713,5388314..5388503,
FT                   5389591..5389689,5392937..5393087,5396853..5396940,
FT                   5398401..5398573,5400190..5400434)
FT                   /locus_tag="mCG_14817"
FT                   /product="mCG14817, transcript variant mCT20556"
FT                   /note="gene_id=mCG14817.2 transcript_id=mCT20556.2 created
FT                   on 10-JAN-2003"
FT   CDS             join(<5383260..5383385,5386554..5386713,5388314..5388503,
FT                   5389591..5389689,5392937..5393087,5396853..5396940,
FT                   5398401..5398573,5400190..5400321)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14817"
FT                   /product="mCG14817, isoform CRA_d"
FT                   /note="gene_id=mCG14817.2 transcript_id=mCT20556.2
FT                   protein_id=mCP3529.2 isoform=CRA_d"
FT                   /protein_id="EDL28640.1"
FT                   /translation="LLNPEALAGARKRQERGPWLARCGCGMVGGGGKRRTAGAGPQCEK
FT                   TVEVKKSKFSEADVSSDLRKEVENLYKLSLPEDFYHFWKFCEELDPEKPADALATSLGL
FT                   RLVGPYDILAGKHKMKKKPTGLNCNLHWRFYYDPPEFQTIIIGDNKTQYHMGYFRDSPD
FT                   ELPVYVGTNEAKKNCIIIQNGDNVFAAIKLFLMKKLKEVTDRKKISILKNIDEKLTEAA
FT                   RKLGYSLEQRTVKMRQRDKKVVTKTFHGAGLVVPVDKNDVGYRELPETDADLKRICKAV
FT                   VDAASDEERLKAFAPIQEMMTFVQFANDECDYGMGLELGMDLFCYGSHYFHKVAGQLLP
FT                   LAYNLLKRDLFAKIIEDHLASRSEENIDQLAG"
FT   mRNA            join(<5383275..5383385,5389591..5389689,5392937..5393087,
FT                   5396853..5396940,5398401..5398573,5400190..5400428)
FT                   /locus_tag="mCG_14817"
FT                   /product="mCG14817, transcript variant mCT170282"
FT                   /note="gene_id=mCG14817.2 transcript_id=mCT170282.0 created
FT                   on 10-JAN-2003"
FT   CDS             join(<5383282..5383385,5389591..5389689,5392937..5393087,
FT                   5396853..5396940,5398401..5398573,5400190..5400321)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14817"
FT                   /product="mCG14817, isoform CRA_b"
FT                   /note="gene_id=mCG14817.2 transcript_id=mCT170282.0
FT                   protein_id=mCP93200.0 isoform=CRA_b"
FT                   /protein_id="EDL28638.1"
FT                   /translation="RALGSGRSAGLGSLAAAAGWLAVAGSAGRPGRDRRDSPDELPVYV
FT                   GTNEAKKNCIIIQNGDNVFAAIKLFLMKKLKEVTDRKKISILKNIDEKLTEAARKLGYS
FT                   LEQRTVKMRQRDKKVVTKTFHGAGLVVPVDKNDVGYRELPETDADLKRICKAVVDAASD
FT                   EERLKAFAPIQEMMTFVQFANDECDYGMGLELGMDLFCYGSHYFHKVAGQLLPLAYNLL
FT                   KRDLFAKIIEDHLASRSEENIDQLAG"
FT   mRNA            join(<5383300..5383385,5398401..5398573,5400190..5400415)
FT                   /locus_tag="mCG_14817"
FT                   /product="mCG14817, transcript variant mCT169543"
FT                   /note="gene_id=mCG14817.2 transcript_id=mCT169543.0 created
FT                   on 10-JAN-2003"
FT   CDS             join(<5383301..5383385,5398401..5398573,5400190..5400321)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14817"
FT                   /product="mCG14817, isoform CRA_a"
FT                   /note="gene_id=mCG14817.2 transcript_id=mCT169543.0
FT                   protein_id=mCP92741.0 isoform=CRA_a"
FT                   /protein_id="EDL28637.1"
FT                   /translation="GARALARSLRLRDGWRWREAPDGRGGTAADLKRICKAVVDAASDE
FT                   ERLKAFAPIQEMMTFVQFANDECDYGMGLELGMDLFCYGSHYFHKVAGQLLPLAYNLLK
FT                   RDLFAKIIEDHLASRSEENIDQLAG"
FT   mRNA            join(<5383306..5383385,5386554..5386713,5388314..5388503,
FT                   5389591..5389689,5392937..5393087,5396853..5396940,
FT                   5398401..5399513)
FT                   /locus_tag="mCG_14817"
FT                   /product="mCG14817, transcript variant mCT178303"
FT                   /note="gene_id=mCG14817.2 transcript_id=mCT178303.0 created
FT                   on 10-JAN-2003"
FT   CDS             join(<5383308..5383385,5386554..5386713,5388314..5388503,
FT                   5389591..5389689,5392937..5393087,5396853..5396940,
FT                   5398401..5398732)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14817"
FT                   /product="mCG14817, isoform CRA_c"
FT                   /note="gene_id=mCG14817.2 transcript_id=mCT178303.0
FT                   protein_id=mCP101225.0 isoform=CRA_c"
FT                   /protein_id="EDL28639.1"
FT                   /translation="GPWLARCGCGMVGGGGKRRTAGAGPQCEKTVEVKKSKFSEADVSS
FT                   DLRKEVENLYKLSLPEDFYHFWKFCEELDPEKPADALATSLGLRLVGPYDILAGKHKMK
FT                   KKPTGLNCNLHWRFYYDPPEFQTIIIGDNKTQYHMGYFRDSPDELPVYVGTNEAKKNCI
FT                   IIQNGDNVFAAIKLFLMKKLKEVTDRKKISILKNIDEKLTEAARKLGYSLEQRTVKMRQ
FT                   RDKKVVTKTFHGAGLVVPVDKNDVGYRELPETDADLKRICKAVVDAASDEERLKAFAPI
FT                   QEMMTFVQFANDECDYGMGLELGMDLFCYGSHVSKAPPSAVLNTQTHGYLSSQLQLPRG
FT                   GSSSYFQTFGSDLKVKVLKRFEILY"
FT   gene            <5403311..5405615
FT                   /locus_tag="mCG_140441"
FT                   /note="gene_id=mCG140441.0"
FT   mRNA            join(<5403311..5405081,5405472..5405615)
FT                   /locus_tag="mCG_140441"
FT                   /product="mCG140441"
FT                   /note="gene_id=mCG140441.0 transcript_id=mCT169544.0
FT                   created on 31-MAY-2002"
FT   CDS             <5403926..5404207
FT                   /codon_start=1
FT                   /locus_tag="mCG_140441"
FT                   /product="mCG140441"
FT                   /note="gene_id=mCG140441.0 transcript_id=mCT169544.0
FT                   protein_id=mCP92772.0"
FT                   /protein_id="EDL28641.1"
FT                   /translation="TTKKLASPLKTWNSEGAEPPISSAEEFLPQQCLPYCKNTFRATEL
FT                   PLKMSPLYLAKEQRGILKSAIRSKKTKYHWQTAILGNFGSLEYGFLIF"
FT   gene            complement(5405791..5476671)
FT                   /gene="Clcn3"
FT                   /locus_tag="mCG_14814"
FT                   /note="gene_id=mCG14814.2"
FT   mRNA            complement(join(5405791..5406112,5412267..5412483,
FT                   5415717..5416115,5420153..5420339,5421992..5422537,
FT                   5423602..5423682,5426007..5426213,5427405..5427527,
FT                   5430220..5430407,5431468..5431567,5434177..5434334,
FT                   5468650..5468825,5475703..5476671))
FT                   /gene="Clcn3"
FT                   /locus_tag="mCG_14814"
FT                   /product="chloride channel 3, transcript variant mCT169540"
FT                   /note="gene_id=mCG14814.2 transcript_id=mCT169540.0 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(5405922..5406112,5412267..5412483,
FT                   5415717..5416115,5420153..5420339,5421992..5422537,
FT                   5423602..5423682,5426007..5426213,5427405..5427527,
FT                   5430220..5430407,5431468..5431567,5434177..5434334,
FT                   5475703..5476065))
FT                   /gene="Clcn3"
FT                   /locus_tag="mCG_14814"
FT                   /product="chloride channel 3, transcript variant mCT20553"
FT                   /note="gene_id=mCG14814.2 transcript_id=mCT20553.1 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(5406022..5406112,5412267..5412483,
FT                   5415717..5416115,5420153..5420339,5421992..5422537,
FT                   5423602..5423682,5426007..5426213,5427405..5427527,
FT                   5430220..5430407,5431468..5431567,5434177..5434334,
FT                   5468650..5468809))
FT                   /codon_start=1
FT                   /gene="Clcn3"
FT                   /locus_tag="mCG_14814"
FT                   /product="chloride channel 3, isoform CRA_a"
FT                   /note="gene_id=mCG14814.2 transcript_id=mCT169540.0
FT                   protein_id=mCP92758.0 isoform=CRA_a"
FT                   /db_xref="GOA:P51791"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002245"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="MGI:MGI:103555"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51791"
FT                   /protein_id="EDL28642.1"
FT                   /translation="MESEQLFHRGYYRNSYNSITSASSDEELLDGAGAIMDFQTSEDDN
FT                   LLDGDTAAGTHYTMTNGGSINSSTHLLDLLDEPIPGVGTYDDFHTIDWVREKCKDRERH
FT                   RRINSKKKESAWEMTKSLYDAWSGWLVVTLTGLASGALAGLIDIAADWMTDLKEGICLS
FT                   ALWYNHEQCCWGSNETTFEERDKCPQWKTWAELIIGQAEGPGSYIMNYIMYIFWALSFA
FT                   FLAVSLVKVFAPYACGSGIPEIKTILSGFIIRGYLGKWTLMIKTITLVLAVASGLSLGK
FT                   EGPLVHVACCCGNIFSYLFPKYSTNEAKKREVLSAASAAGVSVAFGAPIGGVLFSLEEV
FT                   SYYFPLKTLWRSFFAALVAAFVLRSINPFGNSRLVLFYVEYHTPWYLFELFPFILLGVF
FT                   GGLWGAFFIRANIAWCRRRKSTKFGKYPVLEVIIVAAITAVIAFPNPYTRLNTSELIKE
FT                   LFTDCGPLESSSLCDYRNDMNASKIVDDIPDRPAGVGVYSAIWQLCLALIFKIIMTVFT
FT                   FGIKVPSGLFIPSMAIGAIAGRIVGIAVEQLAYYHHDWFIFKEWCEVGADCITPGLYAM
FT                   VGAAACLGGVTRMTVSLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIR
FT                   LNGYPFLDAKEEFTHTTLAADVMRPRRSDPPLAVLTQDNMTVDDIENMINETSYNGFPV
FT                   IMSKESQRLVGFALRRDLTIAIESARKKQEGIVGSSRVCFAQHTPSLPAESPRPLKLRS
FT                   ILDMSPFTVTDHTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDILRHMAQTANQDP
FT                   ASIMFN"
FT   CDS             complement(join(5406022..5406112,5412267..5412483,
FT                   5415717..5416115,5420153..5420339,5421992..5422537,
FT                   5423602..5423682,5426007..5426213,5427405..5427527,
FT                   5430220..5430407,5431468..5431567,5434177..5434320))
FT                   /codon_start=1
FT                   /gene="Clcn3"
FT                   /locus_tag="mCG_14814"
FT                   /product="chloride channel 3, isoform CRA_b"
FT                   /note="gene_id=mCG14814.2 transcript_id=mCT20553.1
FT                   protein_id=mCP3543.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q790S0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002245"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="MGI:MGI:103555"
FT                   /db_xref="UniProtKB/TrEMBL:Q790S0"
FT                   /protein_id="EDL28643.1"
FT                   /translation="MTNGGSINSSTHLLDLLDEPIPGVGTYDDFHTIDWVREKCKDRER
FT                   HRRINSKKKESAWEMTKSLYDAWSGWLVVTLTGLASGALAGLIDIAADWMTDLKEGICL
FT                   SALWYNHEQCCWGSNETTFEERDKCPQWKTWAELIIGQAEGPGSYIMNYIMYIFWALSF
FT                   AFLAVSLVKVFAPYACGSGIPEIKTILSGFIIRGYLGKWTLMIKTITLVLAVASGLSLG
FT                   KEGPLVHVACCCGNIFSYLFPKYSTNEAKKREVLSAASAAGVSVAFGAPIGGVLFSLEE
FT                   VSYYFPLKTLWRSFFAALVAAFVLRSINPFGNSRLVLFYVEYHTPWYLFELFPFILLGV
FT                   FGGLWGAFFIRANIAWCRRRKSTKFGKYPVLEVIIVAAITAVIAFPNPYTRLNTSELIK
FT                   ELFTDCGPLESSSLCDYRNDMNASKIVDDIPDRPAGVGVYSAIWQLCLALIFKIIMTVF
FT                   TFGIKVPSGLFIPSMAIGAIAGRIVGIAVEQLAYYHHDWFIFKEWCEVGADCITPGLYA
FT                   MVGAAACLGGVTRMTVSLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHI
FT                   RLNGYPFLDAKEEFTHTTLAADVMRPRRSDPPLAVLTQDNMTVDDIENMINETSYNGFP
FT                   VIMSKESQRLVGFALRRDLTIAIESARKKQEGIVGSSRVCFAQHTPSLPAESPRPLKLR
FT                   SILDMSPFTVTDHTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDILRHMAQTANQD
FT                   PASIMFN"
FT   gene            <5486147..5623247
FT                   /locus_tag="mCG_114244"
FT                   /note="gene_id=mCG114244.0"
FT   mRNA            join(<5486147..5486691,5499575..5499722,5500105..5500201,
FT                   5505039..5505136,5509169..5509252,5512788..5512855,
FT                   5512981..5513067,5515156..5515210,5521671..5521871,
FT                   5527023..5527083,5528930..5529081,5536298..5536357,
FT                   5536980..5537039,5537125..5537172,5537324..5537398,
FT                   5542849..5543012,5547585..5547687,5565340..5565423,
FT                   5565819..5565896,5566569..5566664,5579399..5579527,
FT                   5582429..5582488,5582562..5582637,5590307..5590459,
FT                   5591811..5591975,5596010..5596130,5597448..5597536,
FT                   5598693..5598935,5612804..5612955,5616017..5616225,
FT                   5616901..5617031,5617869..5618001,5622049..5623247)
FT                   /locus_tag="mCG_114244"
FT                   /product="mCG114244"
FT                   /note="gene_id=mCG114244.0 transcript_id=mCT115338.1
FT                   created on 31-MAY-2002"
FT   CDS             join(<5499597..5499722,5500105..5500201,5505039..5505136,
FT                   5509169..5509252,5512788..5512855,5512981..5513067,
FT                   5515156..5515210,5521671..5521871,5527023..5527083,
FT                   5528930..5529081,5536298..5536357,5536980..5537039,
FT                   5537125..5537172,5537324..5537398,5542849..5543012,
FT                   5547585..5547687,5565340..5565423,5565819..5565896,
FT                   5566569..5566664,5579399..5579527,5582429..5582488,
FT                   5582562..5582585)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114244"
FT                   /product="mCG114244"
FT                   /note="gene_id=mCG114244.0 transcript_id=mCT115338.1
FT                   protein_id=mCP54013.1"
FT                   /protein_id="EDL28644.1"
FT                   /translation="EGTMEKYVRLQKIGEGSFGKAVLVKSTEDGRHYVIKEINISRMSD
FT                   KERQESRREVAVLANMKHPNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQKGALFQ
FT                   EDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELA
FT                   RTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGS
FT                   FPPVSPHYSYDLRSLLSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQLIAEEFCLK
FT                   TLSKFGPQPLPGKRPASGQGVSSFVPAQKITKPAAKYGVPLTYKKYGDKKLLEKKPPPK
FT                   HKQAHQIPVKKMNSGEERKKMSEEAAKKRRLEFIEKEKKQKDQIRFLKAEQMKRQEKQR
FT                   LERINRAREQGWRNVLRAGGSGEVKASFFGIGGAVSPSPCSPRGQYEHYHAIFDQMQRL
FT                   RAEDNEARWKGGIYGRWLPERQKGHLAVERANQVEEFLQRKREAMQNKARAEGHVVYLA
FT                   RLRQIRLQNFNERQQIKAKLRGENKEADGTKGQEATEETDMRLKKMESLKAQTNARAAV
FT                   LKEQLERKRKEAYEREKKVWEEHLVARVKSSDVPLPLELLETGGSPSKQQVKPVISVTS
FT                   ALKEVGLDGSLTDTQEEEMEKSNSAISSKREIPA"
FT   gene            complement(5604034..>5604441)
FT                   /locus_tag="mCG_140440"
FT                   /note="gene_id=mCG140440.0"
FT   mRNA            complement(5604034..>5604441)
FT                   /locus_tag="mCG_140440"
FT                   /product="mCG140440"
FT                   /note="gene_id=mCG140440.0 transcript_id=mCT169538.0
FT                   created on 31-MAY-2002"
FT   CDS             complement(5604130..>5604441)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140440"
FT                   /product="mCG140440"
FT                   /note="gene_id=mCG140440.0 transcript_id=mCT169538.0
FT                   protein_id=mCP92773.0"
FT                   /protein_id="EDL28645.1"
FT                   /translation="PPLSSHHGGHLRQHWKLVDSKNFDDYMKSLGVGFATRQVASMTKP
FT                   TTVIEKSGDTITIKIHSTFKSTEISFHLGVDFEEVTADDRKVKSVLTLGRGKVVHVQK"
FT   gene            5716044..5882312
FT                   /gene="Sh3rf1"
FT                   /locus_tag="mCG_114239"
FT                   /note="gene_id=mCG114239.1"
FT   mRNA            join(5716044..5716118,5717604..5718090,5821270..5821545,
FT                   5822095..5822160,5842056..5842327,5846323..5846464,
FT                   5854216..5854400,5855703..5855873,5860623..5860882,
FT                   5862132..5862490,5872694..5873046,5881786..5882312)
FT                   /gene="Sh3rf1"
FT                   /locus_tag="mCG_114239"
FT                   /product="SH3 domain containing ring finger 1"
FT                   /note="gene_id=mCG114239.1 transcript_id=mCT115331.1
FT                   created on 03-JUN-2002"
FT   CDS             join(5717698..5718090,5821270..5821545,5822095..5822160,
FT                   5842056..5842327,5846323..5846464,5854216..5854400,
FT                   5855703..5855873,5860623..5860882,5862132..5862490,
FT                   5872694..5873046,5881786..5881954)
FT                   /codon_start=1
FT                   /gene="Sh3rf1"
FT                   /locus_tag="mCG_114239"
FT                   /product="SH3 domain containing ring finger 1"
FT                   /note="gene_id=mCG114239.1 transcript_id=mCT115331.1
FT                   protein_id=mCP54060.1"
FT                   /protein_id="EDL28646.1"
FT                   /translation="MDESALLDLLECPVCLERLDASAKVLPCQHTFCKRCLLGIVGSRN
FT                   ELRCPECRTLVGSGVDELPSNILLVRLLDGIKQRPWKPGPGGGGGTTCTNTLRAQGSTV
FT                   VNCGSKDLQSSQCGQQPRVQAWSPPVRGIPQLPCAKALYNYEGKEPGDLKFSKGDIIIL
FT                   RRQVDENWYHGEVSGVHGFFPTNFVQIIKPLPQPPPQCKALYDFEVKDKEADKDCLPFA
FT                   KDENWAEGMLADKIGIFPMSYVEFNSAAKQLIEWDKPPVPGVDTAECPSATAQSTSASK
FT                   HPDTKKNTRKRHSFTSLTMANKSSQGSQNRHSMEISPPVLISSSNPTAAARISAPYLFN
FT                   TYSPWQVHISTTGLIVTPPPSSPVTTGPAFTFPSDVPYQAALGSMNPPLPPPPLLAATV
FT                   LASTPSGATAAVAAAAAAAAAGMGPRPVMGSSEQIAHLRPQTRPSVYVAIYPYTPRKED
FT                   ELELRKGEMFLVFERCQDGWYKGTSMHTSKIGVFPGNYVAPVTRAVTNASQAKVSMSTA
FT                   GQASRGVTMVSPSTAGGPTQKPQGNGVAGNPSVVPTAVVSAAHIQTSPQAKVLLHMSGQ
FT                   MTVNQARNAVRTVAAHSQERPTAAVTPIQVQNAACLGPASVGLPHHSLASQPLPPMAGP
FT                   AAHGAAVSISRTNAPMACAAGASLASPNMTSAVLETEPSGRTVTILPGLPTSPESAASA
FT                   CGNSSAGKPDKDSKKEKKGLLKLLSGASTKRKPRVSPPASPTLDVELGAGEAPLQGAVG
FT                   PELPLGGSHGRVGSCPTDGDGPVAAGTAALAQDAFHRKTSSLDSAVPIAPPPRQACSSL
FT                   GPVMNEARPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTG
FT                   LFPGSFVENI"
FT   gene            complement(5773538..>5780891)
FT                   /locus_tag="mCG_140491"
FT                   /note="gene_id=mCG140491.0"
FT   mRNA            complement(join(5773538..5773588,5774028..5774172,
FT                   5774277..5774432,5774819..5774902,5780762..>5780891))
FT                   /locus_tag="mCG_140491"
FT                   /product="mCG140491, transcript variant mCT170268"
FT                   /note="gene_id=mCG140491.0 transcript_id=mCT170268.0
FT                   created on 25-JUN-2002"
FT   mRNA            complement(join(5773538..5773588,5774028..5774172,
FT                   5774277..5774432,5774819..5774902,5780758..>5780891))
FT                   /locus_tag="mCG_140491"
FT                   /product="mCG140491, transcript variant mCT169775"
FT                   /note="gene_id=mCG140491.0 transcript_id=mCT169775.0
FT                   created on 25-JUN-2002"
FT   CDS             complement(join(5774100..5774172,5774277..>5774413))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140491"
FT                   /product="mCG140491, isoform CRA_a"
FT                   /note="gene_id=mCG140491.0 transcript_id=mCT169775.0
FT                   protein_id=mCP92744.0 isoform=CRA_a"
FT                   /protein_id="EDL28647.1"
FT                   /translation="RSPRTCLADLHIVLKTSYGRKKENKMGAETQKEQGKDKKSFNNIT
FT                   RLPVSSEVNIPDPPLHCTLSLQQG"
FT   CDS             complement(join(5774428..5774432,5774819..5774902,
FT                   5780762..>5780891))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140491"
FT                   /product="mCG140491, isoform CRA_b"
FT                   /note="gene_id=mCG140491.0 transcript_id=mCT170268.0
FT                   protein_id=mCP93186.0 isoform=CRA_b"
FT                   /protein_id="EDL28648.1"
FT                   /translation="SPTAPISQLSQFVDFILSKVHQSLLFRVLRTRSQVQRSPSITAAP
FT                   RSLHTGQRKSLVIQGEMIRTHNHAEAK"
FT   gene            complement(5856442..>5857125)
FT                   /locus_tag="mCG_48957"
FT                   /note="gene_id=mCG48957.1"
FT   mRNA            complement(5856442..>5857125)
FT                   /locus_tag="mCG_48957"
FT                   /product="mCG48957"
FT                   /note="gene_id=mCG48957.1 transcript_id=mCT49140.1 created
FT                   on 03-JUN-2002"
FT   CDS             complement(5856647..>5857123)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48957"
FT                   /product="mCG48957"
FT                   /note="gene_id=mCG48957.1 transcript_id=mCT49140.1
FT                   protein_id=mCP26573.1"
FT                   /protein_id="EDL28649.1"
FT                   /translation="LRSKMAASRRLMKELEEIRKYGMKNFCNIQVDEANSWTSQGLIVP
FT                   DKPPYDKGAFRIEINFPAEYPFKPPKITLKTKIYHPNIDEKGQVCLPVISAENWKPATK
FT                   TDQVIQSLTALVSDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD"
FT   gene            complement(5868583..5869537)
FT                   /pseudo
FT                   /locus_tag="mCG_11382"
FT                   /note="gene_id=mCG11382.1"
FT   mRNA            complement(5868583..5869537)
FT                   /pseudo
FT                   /locus_tag="mCG_11382"
FT                   /note="gene_id=mCG11382.1 transcript_id=mCT11542.1 created
FT                   on 03-JUN-2002"
FT   gene            <5976669..5992437
FT                   /gene="Cbr4"
FT                   /locus_tag="mCG_11388"
FT                   /note="gene_id=mCG11388.1"
FT   mRNA            join(<5976669..5976931,5978880..5979000,5979526..5979633,
FT                   5980480..5980609,5984004..5984138,5991967..5992437)
FT                   /gene="Cbr4"
FT                   /locus_tag="mCG_11388"
FT                   /product="carbonyl reductase 4, transcript variant
FT                   mCT11548"
FT                   /note="gene_id=mCG11388.1 transcript_id=mCT11548.2 created
FT                   on 03-JUN-2002"
FT   mRNA            join(5976699..5976931,5978880..5979000,5980480..5980609,
FT                   5984004..5984138,5991967..5992418)
FT                   /gene="Cbr4"
FT                   /locus_tag="mCG_11388"
FT                   /product="carbonyl reductase 4, transcript variant
FT                   mCT169776"
FT                   /note="gene_id=mCG11388.1 transcript_id=mCT169776.0 created
FT                   on 03-JUN-2002"
FT   mRNA            join(<5976708..5976931,5978880..5980609,5984004..5984138,
FT                   5991967..5992263)
FT                   /gene="Cbr4"
FT                   /locus_tag="mCG_11388"
FT                   /product="carbonyl reductase 4, transcript variant
FT                   mCT192560"
FT                   /note="gene_id=mCG11388.1 transcript_id=mCT192560.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<5976754..5976931,5978880..5979000,5979526..5979633,
FT                   5980480..5980552)
FT                   /codon_start=1
FT                   /gene="Cbr4"
FT                   /locus_tag="mCG_11388"
FT                   /product="carbonyl reductase 4, isoform CRA_c"
FT                   /note="gene_id=mCG11388.1 transcript_id=mCT11548.2
FT                   protein_id=mCP3542.2 isoform=CRA_c partial"
FT                   /protein_id="EDL28652.1"
FT                   /translation="VSGIHLAGPRSKMDKVCAVFGGSRGIGRAVAQLMAQKGYRLAIVS
FT                   RNLEVAKVTAGELGGNHLAFRCDVAKEQDVQSTFQEMEKHLGPVNFLVNAAGINSTCGV
FT                   CGFPQERKEGIKSLELVIREPVSYLELHLHSLDSLLVRTKTEDMXXXXXXXWAPC"
FT   CDS             join(<5980510..5980609,5984004..5984138,5991967..5992145)
FT                   /codon_start=1
FT                   /gene="Cbr4"
FT                   /locus_tag="mCG_11388"
FT                   /product="carbonyl reductase 4, isoform CRA_b"
FT                   /note="gene_id=mCG11388.1 transcript_id=mCT192560.0
FT                   protein_id=mCP113502.0 isoform=CRA_b partial"
FT                   /protein_id="EDL28651.1"
FT                   /translation="RHXXXXXXXLGSMLTCKAAMKTMIQQGGSIVNVGSIIGLKGNVGQ
FT                   SAYSATKGGLVGFSRSLAKEVARKKIRVNVVAPGFIRTDMTRHLKEEHFKKNIPLGRFG
FT                   ETLEVAHAVVFLLESPYITGHVLIVDGGLQLTV"
FT   CDS             join(5980546..5980609,5984004..5984138,5991967..5992145)
FT                   /codon_start=1
FT                   /gene="Cbr4"
FT                   /locus_tag="mCG_11388"
FT                   /product="carbonyl reductase 4, isoform CRA_a"
FT                   /note="gene_id=mCG11388.1 transcript_id=mCT169776.0
FT                   protein_id=mCP92757.0 isoform=CRA_a partial"
FT                   /protein_id="EDL28650.1"
FT                   /translation="MLTCKAAMKTMIQQGGSIVNVGSIIGLKGNVGQSAYSATKGGLVG
FT                   FSRSLAKEVARKKIRVNVVAPGFIRTDMTRHLKEEHFKKNIPLGRFGETLEVAHAVVFL
FT                   LESPYITGHVLIVDGGLQLTV"
FT   gene            complement(6000193..>6086991)
FT                   /locus_tag="mCG_116606"
FT                   /note="gene_id=mCG116606.1"
FT   mRNA            complement(join(6000193..6002462,6004143..6004276,
FT                   6005450..6005615,6006116..6006323,6018740..6018872,
FT                   6020924..6021018,6027778..6027928,6029221..6029442,
FT                   6031553..6031651,6034554..6034689,6045444..6046118,
FT                   6086873..>6086991))
FT                   /locus_tag="mCG_116606"
FT                   /product="mCG116606, transcript variant mCT117729"
FT                   /note="gene_id=mCG116606.1 transcript_id=mCT117729.1
FT                   created on 03-JUN-2002"
FT   mRNA            complement(join(6005494..6005615,6006116..6006323,
FT                   6018740..6018872,6020924..6021018,6027778..6027928,
FT                   6029221..6029442,6031553..6031651,6034554..6034689,
FT                   6046039..6046118,6086873..>6086953))
FT                   /locus_tag="mCG_116606"
FT                   /product="mCG116606, transcript variant mCT192564"
FT                   /note="gene_id=mCG116606.1 transcript_id=mCT192564.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(6018840..6018872,6020924..6021018,
FT                   6027778..6027928,6029221..6029442,6031553..6031651,
FT                   6034554..6034689,6045444..6046118,6086873..>6086991))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116606"
FT                   /product="mCG116606, isoform CRA_b"
FT                   /note="gene_id=mCG116606.1 transcript_id=mCT117729.1
FT                   protein_id=mCP53921.1 isoform=CRA_b"
FT                   /protein_id="EDL28654.1"
FT                   /translation="LGAIKRGYLPGAAGGALDTHPLASLRPQIGERQAEPGDSRDPLKL
FT                   QQLQNQVRLEQEACAWPPAPPGVPCNSSSSGSSAPPSPPFPPPPPAFPELAACASPVPS
FT                   EPMSALASRATAMQSSGSFNYARPKQFIAAQNLGPASGLPTPTSSPSSSSLPSPLSPTP
FT                   RPFGRAPGPPFVEPEAMWGPSSPSPPPPPPPVFSPSAAYPVPDVFPLPPPPPPLPSSTS
FT                   HCASPARFGPSQTPAAFLSALLPSQPPPVAVNALGLPKGVTPAGFPKKSSRTARIASDE
FT                   EIQGTKDAVIQDLERKLRFKEDLLNNGQPRLTYEERMARRLLGADSANVFNIQEPEETA
FT                   ANQEYKVSSCEQRLISEIEYRLERSPVDESGDEVQDPDVPVENATAPFFEMKLKHYKIF
FT                   EGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGN
FT                   YTIMAANPPGSRQLYRKANGTGCQPKRPQSPLSLRPSSCQKASLSITGQWR"
FT   CDS             complement(join(6018840..6018872,6020924..6021018,
FT                   6027778..6027928,6029221..6029442,6031553..6031651,
FT                   6034554..6034689,6046039..6046118,6086873..>6086953))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116606"
FT                   /product="mCG116606, isoform CRA_a"
FT                   /note="gene_id=mCG116606.1 transcript_id=mCT192564.0
FT                   protein_id=mCP113503.0 isoform=CRA_a"
FT                   /protein_id="EDL28653.1"
FT                   /translation="RRSPRHPPSCFAETPDRRAPGRAGRLKGSSEASAAAEPSAPGTGG
FT                   LRLAPSAPRGFPKKSSRTARIASDEEIQGTKDAVIQDLERKLRFKEDLLNNGQPRLTYE
FT                   ERMARRLLGADSANVFNIQEPEETAANQEYKVSSCEQRLISEIEYRLERSPVDESGDEV
FT                   QDPDVPVENATAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDH
FT                   YTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPPGSRQLYRKANGTGCQPKRPQSPLSL
FT                   RPSSCQKASLSITGQWR"
FT   gene            complement(<6182865..>6258218)
FT                   /locus_tag="mCG_55522"
FT                   /note="gene_id=mCG55522.2"
FT   mRNA            complement(join(<6182865..6183211,6185464..6185583,
FT                   6200260..6200283,6201192..6201333,6207083..6207157,
FT                   6209465..6209570,6210902..6210968,6218604..6218782,
FT                   6257942..>6258218))
FT                   /locus_tag="mCG_55522"
FT                   /product="mCG55522"
FT                   /note="gene_id=mCG55522.2 transcript_id=mCT55705.2 created
FT                   on 03-JUN-2002"
FT   CDS             complement(join(6182865..6183211,6185464..6185583,
FT                   6200260..6200283,6201192..6201333,6207083..6207157,
FT                   6209465..6209570,6210902..6210968,6218604..>6218781))
FT                   /codon_start=1
FT                   /locus_tag="mCG_55522"
FT                   /product="mCG55522"
FT                   /note="gene_id=mCG55522.2 transcript_id=mCT55705.2
FT                   protein_id=mCP26572.2"
FT                   /protein_id="EDL28655.1"
FT                   /translation="WFCEGKELYNSPDVQIHCESGELHTLVIAEAFEDDTGRYTCLATN
FT                   PSGSDSTSAEVFIEGASSTDSDSESLSFISKAGAMPQAQKKTTSVSLTIGSSAPKTGVT
FT                   TAVIQPLSVPVQQAHSATSYLCRPDGTTMGCLLPVFTKELQNTAASEGQVVVLECRVRG
FT                   APPLQVQWFRQGSEIQDSPDFRILQKKPRSTAEPEEICTLVIAESFPEDAGIFTCSATN
FT                   DYGSVTSTAQLVITSANNENCSYDSTGEPNSDHFQHFPPPPPILETGSYELASQKPSEI
FT                   QQVNSPNLGFSMAALQMQFNTAERETNGVHPSHGVNGLINGKAYGNKSPPTPTALLSPT
FT                   KEPPPLLAKPKL"
FT   gene            complement(6318408..6320149)
FT                   /pseudo
FT                   /locus_tag="mCG_1048886"
FT                   /note="gene_id=mCG1048886.1"
FT   mRNA            complement(6318408..6320149)
FT                   /pseudo
FT                   /locus_tag="mCG_1048886"
FT                   /note="gene_id=mCG1048886.1 transcript_id=mCT166590.1
FT                   created on 03-JUN-2002"
FT   gene            <6347508..6421100
FT                   /locus_tag="mCG_63369"
FT                   /note="gene_id=mCG63369.2"
FT   mRNA            join(<6347508..6347594,6349912..6350053,6419837..6421100)
FT                   /locus_tag="mCG_63369"
FT                   /product="mCG63369, transcript variant mCT185477"
FT                   /note="gene_id=mCG63369.2 transcript_id=mCT185477.0 created
FT                   on 11-JUN-2003"
FT   mRNA            join(<6411276..6411442,6419837..6421100)
FT                   /locus_tag="mCG_63369"
FT                   /product="mCG63369, transcript variant mCT63552"
FT                   /note="gene_id=mCG63369.2 transcript_id=mCT63552.2 created
FT                   on 11-JUN-2003"
FT   gene            complement(6419638..>6426304)
FT                   /locus_tag="mCG_140494"
FT                   /note="gene_id=mCG140494.0"
FT   mRNA            complement(join(6419638..6420336,6426040..>6426274))
FT                   /locus_tag="mCG_140494"
FT                   /product="mCG140494, transcript variant mCT169784"
FT                   /note="gene_id=mCG140494.0 transcript_id=mCT169784.0
FT                   created on 25-JUN-2002"
FT   mRNA            complement(join(6419750..6420336,6423974..6424015,
FT                   6426026..>6426304))
FT                   /locus_tag="mCG_140494"
FT                   /product="mCG140494, transcript variant mCT170269"
FT                   /note="gene_id=mCG140494.0 transcript_id=mCT170269.0
FT                   created on 25-JUN-2002"
FT   CDS             complement(6419969..>6420220)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140494"
FT                   /product="mCG140494, isoform CRA_a"
FT                   /note="gene_id=mCG140494.0 transcript_id=mCT170269.0
FT                   protein_id=mCP93187.0 isoform=CRA_a"
FT                   /protein_id="EDL28658.1"
FT                   /translation="HLLTNHSEETLGVEDTPVPRTFLPEIGFIKLLWQKKQQGGQTPGC
FT                   VAPLLSLTVGILSVSKSSVAPTADFLLCPTLPFWFYRE"
FT   CDS             complement(6419969..>6420220)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140494"
FT                   /product="mCG140494, isoform CRA_a"
FT                   /note="gene_id=mCG140494.0 transcript_id=mCT169784.0
FT                   protein_id=mCP92752.0 isoform=CRA_a"
FT                   /protein_id="EDL28659.1"
FT                   /translation="HLLTNHSEETLGVEDTPVPRTFLPEIGFIKLLWQKKQQGGQTPGC
FT                   VAPLLSLTVGILSVSKSSVAPTADFLLCPTLPFWFYRE"
FT   CDS             <6419982..6420206
FT                   /codon_start=1
FT                   /locus_tag="mCG_63369"
FT                   /product="mCG63369, isoform CRA_a"
FT                   /note="gene_id=mCG63369.2 transcript_id=mCT185477.0
FT                   protein_id=mCP106735.0 isoform=CRA_a"
FT                   /protein_id="EDL28656.1"
FT                   /translation="NQKGRVGQRRKSAVGATEDLDTDKMPTVRDSSGATQPGVCPPCCF
FT                   FCHSNLIKPISGRNVLGTGVSSTPKVSSE"
FT   CDS             <6419982..6420206
FT                   /codon_start=1
FT                   /locus_tag="mCG_63369"
FT                   /product="mCG63369, isoform CRA_a"
FT                   /note="gene_id=mCG63369.2 transcript_id=mCT63552.2
FT                   protein_id=mCP26565.1 isoform=CRA_a"
FT                   /protein_id="EDL28657.1"
FT                   /translation="NQKGRVGQRRKSAVGATEDLDTDKMPTVRDSSGATQPGVCPPCCF
FT                   FCHSNLIKPISGRNVLGTGVSSTPKVSSE"
FT   gene            6426302..6535962
FT                   /locus_tag="mCG_11385"
FT                   /note="gene_id=mCG11385.1"
FT   mRNA            join(6426302..6426551,6438167..6438274,6438459..6438525,
FT                   6438771..6438960,6440460..6440801,6444020..6444136,
FT                   6446995..6447156,6448610..6448768,6452565..6452706,
FT                   6454174..6454329,6456104..6456209,6456620..6456735,
FT                   6461643..6461800,6467658..6467910,6470360..6470526,
FT                   6472240..6472398,6473964..6474113,6476091..6476210,
FT                   6477464..6477559,6480689..6480804,6482008..6482150,
FT                   6482290..6482399,6485560..6485664,6486248..6486376,
FT                   6488010..6488134,6492588..6492746,6496831..6496978,
FT                   6498750..6498902,6508236..6508340,6510563..6510763,
FT                   6515432..6515536,6516033..6516174,6519579..6519700,
FT                   6521442..6521589,6523141..6523283,6531633..6531784,
FT                   6533306..6533368,6535299..6535962)
FT                   /locus_tag="mCG_11385"
FT                   /product="mCG11385"
FT                   /note="gene_id=mCG11385.1 transcript_id=mCT11545.2 created
FT                   on 05-JUN-2002"
FT   CDS             join(6438271..6438274,6438459..6438525,6438771..6438960,
FT                   6440460..6440801,6444020..6444136,6446995..6447156,
FT                   6448610..6448768,6452565..6452706,6454174..6454329,
FT                   6456104..6456209,6456620..6456735,6461643..6461800,
FT                   6467658..6467910,6470360..6470526,6472240..6472398,
FT                   6473964..6474113,6476091..6476210,6477464..6477559,
FT                   6480689..6480804,6482008..6482150,6482290..6482399,
FT                   6485560..6485664,6486248..6486376,6488010..6488134,
FT                   6492588..6492746,6496831..6496978,6498750..6498902,
FT                   6508236..6508340,6510563..6510763,6515432..6515536,
FT                   6516033..6516174,6519579..6519700,6521442..6521589,
FT                   6523141..6523283,6531633..6531784,6533306..6533368,
FT                   6535299..6535398)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11385"
FT                   /product="mCG11385"
FT                   /note="gene_id=mCG11385.1 transcript_id=mCT11545.2
FT                   protein_id=mCP3540.2"
FT                   /db_xref="GOA:G3X9F7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:2384570"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9F7"
FT                   /protein_id="EDL28660.1"
FT                   /translation="MEKKYTGFLKIMSHLILETMSKADYSSLFNDFVESEFFLIDGDSL
FT                   LITCACERSLKPGQSLHFFYLVERYLLDVISKGGQFAIVFFKDAEYAYFNVPELLTLRT
FT                   ALILHLQKNTTVEVWTKFSNCLSEEWNICLGQSCPYFLILADEGLNDLQTHLFNFVVIQ
FT                   AWAAKVNIVLFSGQTSDILRLYAYFMQSSHGMQMFFKENKRMIMIVYKSLIQQLEKYRD
FT                   MALAHLFGDLKFNDMEEKVCETVSLLKQLWPEGSDIRCVFCVTSCSLFLEMYHCYLESR
FT                   EKGASEEMSKVKQKTDNCLTLKDMEDFCKLHCLSVALLLHVPLSQRARSRFITANWIQD
FT                   LKTVLKMKKWCEYFILSNLDMFESWSLNLLHLSDLSDEPLLRNIAFYYENENKEGLDLN
FT                   VGDAIMNEYVHLWDTVSKLVRKFDVGKPIPLRTTKVHFLEKTPSPIKESSQEMMPNLGF
FT                   IPMSCNLVDEFTGDILKDLPFLMSDDPIVTSLVKHKEFDELVHWHSHRPLSDDYDRTKV
FT                   NSGDRRDPNHLKRLQKYHSFQRFYGESLESVTSKTITTQGPKPKKDCIKSKSTKAHETK
FT                   AEIIKRENKKRLIAEEEQKEEQKWNALSFSIEEEMRKNVDSGMKKLEEFLKSCKSRSVK
FT                   AQVERVGLQACLKAWKEHCQAEGETTKDLSIAVNMMKRIHSLLDKHSELLQEADQKLIA
FT                   RCLKYLGFCELAVSLYPTQDASDGIKMKKKNKYSVGIGPARFQLQYMGHYLIREERKDP
FT                   DPRVQDFIPDTWQRELLDVVDNYESAVIVAPTSSGKTYASYYCMEKVLKESDEGVVVYV
FT                   APTKALVNQVAATVEYRYAKNMPAGESLCGVFTRDYRHDALNCQVLITVPACFEILLLA
FT                   PHRQNWVKRIRYVIFDEVHCLGGEIGAEIWEHLLVMIRCPFLALSATISNPQHLTEWLQ
FT                   SVKRYWKQVDSTMEERTVSKRTGTSRGSYYKDQAQARQSYKVRLVLYGERYNDLEKYLC
FT                   SVRQGDVCFDHFHPCAALTIDHIEKYGFPSDLALSPRESIQLYDTMCQVWKSWPQAQSL
FT                   CPENFTQFKNKIVIKKLDARKYEESLKEEFTNWVKNGNEEEARMVLKKLSPDYHEHSGR
FT                   MLDFFPCLVEKLRKMEKLPALFFLFKLNIVEECAENAFEFLEKKQEEKRPPKADKEART
FT                   TANKLRKVKKSLEKQKTVDEKGQKSSRRLDESVMHETEHNYLLQTLEKNLEIPKDCTYA
FT                   NQKAIDDQLLQRVFHRVRFERKGETLKRLAERGIGYHHSSMSAKEKQLVEILFRKGFIR
FT                   VVTATGTLALGINMPCKSVVFAQNSVYLDALNYRQMSGRAGRRGQDLLGDVYFFDIPLP
FT                   KIGKLIKSKVPELRGQFPLSISLILRLMLLASKADDLEDGKAKALSVLKHSLLSFKQPR
FT                   AIDMLKLYFLYSLQFLVKEGHIDQEGNPTGFAGLVSHLHYHEPSNLVFVSFLVKGLFHK
FT                   LCQPTREGPKRFSEDVMEKLVLVLANLFGRRYIPAKFYEVNSKFYQSKVFLDDLPEDFS
FT                   HALLEYNTQVTEDFASFLLMVSRLADMKQEYQLSLSKIEFTGKECEDSPLVSHLMNCKE
FT                   GRVAVSPFVCLSGNFDVDLLSPGVPNHVILHTLGINHTQAPVLWPYALDSQGRKIPLNA
FT                   YALDFYKHGSLIGLVQDNRIHPGEAYSLLKDFNLIIKSISVSLRELCENEEDNVVLAFE
FT                   QLSTSFQEKFELV"
FT   gene            complement(6555343..6621335)
FT                   /gene="Anxa10"
FT                   /locus_tag="mCG_1652"
FT                   /note="gene_id=mCG1652.2"
FT   mRNA            complement(join(6555343..6556056,6558501..6558623,
FT                   6559254..6559312,6561218..6561313,6562464..6562557,
FT                   6562649..6562702,6572784..6572863,6574524..6574614,
FT                   6576108..6576221,6590744..6590838,6594936..6595017,
FT                   6621150..6621256))
FT                   /gene="Anxa10"
FT                   /locus_tag="mCG_1652"
FT                   /product="annexin A10, transcript variant mCT7959"
FT                   /note="gene_id=mCG1652.2 transcript_id=mCT7959.2 created on
FT                   05-JUN-2002"
FT   mRNA            complement(join(6555771..6556056,6558501..6558623,
FT                   6559254..6559312,6561218..6561313,6562464..6562557,
FT                   6562649..6562702,6574504..6574614,6576108..6576221,
FT                   6590744..6590838,6594936..6595017,6621150..6621257))
FT                   /gene="Anxa10"
FT                   /locus_tag="mCG_1652"
FT                   /product="annexin A10, transcript variant mCT169777"
FT                   /note="gene_id=mCG1652.2 transcript_id=mCT169777.0 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(6555988..6556056,6558501..6558623,
FT                   6559254..6559312,6561218..6561313,6562464..6562557,
FT                   6562649..6562702,6572784..6572863,6574524..6574614,
FT                   6576108..6576221,6590744..6590838,6594936..6595017,
FT                   6621150..6621167))
FT                   /codon_start=1
FT                   /gene="Anxa10"
FT                   /locus_tag="mCG_1652"
FT                   /product="annexin A10, isoform CRA_c"
FT                   /note="gene_id=mCG1652.2 transcript_id=mCT7959.2
FT                   protein_id=mCP3547.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q9QZ10"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR008156"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="MGI:MGI:1347090"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZ10"
FT                   /protein_id="EDL28663.1"
FT                   /translation="MFCGEYVQGTIFPAPNFNPMMDAQMLGGALQGFDCNKDMLIDILT
FT                   QRSNAQRQMIAGTYQSMYGRDLISVLKEQLSSHFKEVMVGLMYPPPSYDAHELWHAMKG
FT                   PGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQANR
FT                   EEGYSDPAMAAQDAMVLWEACQQKTGEHKTMMQMILCNKSYPQLWLVFQEFQNISGQDL
FT                   VDAINDCYDGYFQELLVAIVRCIQDKPSYFAYKLYRAIHDFGFHNKTVIRILIARSEID
FT                   LMTIRKRYKERFGKSLFHDIKNFASGHYEKALLAICAGDVEDY"
FT   CDS             complement(join(6555988..6556056,6558501..6558623,
FT                   6559254..6559312,6561218..6561313,6562464..6562557,
FT                   6562649..6562702,6574504..6574614,6576108..6576221,
FT                   6590744..6590838,6594936..6595017,6621150..6621167))
FT                   /codon_start=1
FT                   /gene="Anxa10"
FT                   /locus_tag="mCG_1652"
FT                   /product="annexin A10, isoform CRA_b"
FT                   /note="gene_id=mCG1652.2 transcript_id=mCT169777.0
FT                   protein_id=mCP92771.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D272"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR008156"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="MGI:MGI:1347090"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D272"
FT                   /protein_id="EDL28662.1"
FT                   /translation="MFCGEYVQGTIFPAPNFNPMMDAQMLGGALQGFDCNKDMLIDILT
FT                   QRSNAQRQMIAGTYQSMYGRDLISVLKEQLSSHFKEVMVGLMYPPPSYDAHELWHAMKG
FT                   PGTDENCLIEILASRTNGEIFQMREAYCLRKEIHKYANREEGYSDPAMAAQDAMVLWEA
FT                   CQQKTGEHKTMMQMILCNKSYPQLWLVFQEFQNISGQDLVDAINDCYDGYFQELLVAIV
FT                   RCIQDKPSYFAYKLYRAIHDFGFHNKTVIRILIARSEIDLMTIRKRYKERFGKSLFHDI
FT                   KNFASGHYEKALLAICAGDVEDY"
FT   mRNA            complement(join(6561666..6562557,6562649..6562702,
FT                   6572784..6572863,6574524..6574614,6576108..6576221,
FT                   6590744..6590838,6594936..6595017,6621150..6621335))
FT                   /gene="Anxa10"
FT                   /locus_tag="mCG_1652"
FT                   /product="annexin A10, transcript variant mCT169778"
FT                   /note="gene_id=mCG1652.2 transcript_id=mCT169778.0 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(6562456..6562557,6562649..6562702,
FT                   6572784..6572863,6574524..6574614,6576108..6576221,
FT                   6590744..6590838,6594936..6595017,6621150..6621167))
FT                   /codon_start=1
FT                   /gene="Anxa10"
FT                   /locus_tag="mCG_1652"
FT                   /product="annexin A10, isoform CRA_a"
FT                   /note="gene_id=mCG1652.2 transcript_id=mCT169778.0
FT                   protein_id=mCP92739.0 isoform=CRA_a"
FT                   /protein_id="EDL28661.1"
FT                   /translation="MFCGEYVQGTIFPAPNFNPMMDAQMLGGALQGFDCNKDMLIDILT
FT                   QRSNAQRQMIAGTYQSMYGRDLISVLKEQLSSHFKEVMVGLMYPPPSYDAHELWHAMKG
FT                   PGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQANR
FT                   EEGYSDPAMAAQDAMVLWEACQQKTGEHKTMMQMILCNKSYPQLWLGN"
FT   gene            complement(6691128..6691969)
FT                   /pseudo
FT                   /locus_tag="mCG_51429"
FT                   /note="gene_id=mCG51429.2"
FT   mRNA            complement(6691128..6691969)
FT                   /pseudo
FT                   /locus_tag="mCG_51429"
FT                   /note="gene_id=mCG51429.2 transcript_id=mCT51612.2 created
FT                   on 05-JUN-2002"
FT   gene            complement(6984262..6985937)
FT                   /pseudo
FT                   /locus_tag="mCG_1653"
FT                   /note="gene_id=mCG1653.1"
FT   mRNA            complement(6984262..6985937)
FT                   /pseudo
FT                   /locus_tag="mCG_1653"
FT                   /note="gene_id=mCG1653.1 transcript_id=mCT7960.1 created on
FT                   05-JUN-2002"
FT   gene            7037290..7038248
FT                   /pseudo
FT                   /locus_tag="mCG_48753"
FT                   /note="gene_id=mCG48753.2"
FT   mRNA            7037290..7038248
FT                   /pseudo
FT                   /locus_tag="mCG_48753"
FT                   /note="gene_id=mCG48753.2 transcript_id=mCT48936.2 created
FT                   on 05-JUN-2002"
FT   gene            complement(7044589..7045454)
FT                   /pseudo
FT                   /locus_tag="mCG_1654"
FT                   /note="gene_id=mCG1654.3"
FT   mRNA            complement(7044589..7045454)
FT                   /pseudo
FT                   /locus_tag="mCG_1654"
FT                   /note="gene_id=mCG1654.3 transcript_id=mCT7961.3 created on
FT                   03-JUN-2003"
FT   gene            <7438249..7842387
FT                   /gene="Spock3"
FT                   /locus_tag="mCG_9708"
FT                   /note="gene_id=mCG9708.3"
FT   mRNA            join(<7438249..7438319,7438820..7439008,7593214..7593259,
FT                   7626976..7627090,7704331..7704454,7728458..7728572,
FT                   7814428..7814547,7831176..7831397,7834431..7834493,
FT                   7837716..7837853,7840741..7842382)
FT                   /gene="Spock3"
FT                   /locus_tag="mCG_9708"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 3, transcript variant mCT192567"
FT                   /note="gene_id=mCG9708.3 transcript_id=mCT192567.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<7438250..7438319,7438820..7439017,7593214..7593259,
FT                   7626976..7627090,7704331..7704454,7728458..7728572,
FT                   7814428..7814547,7831176..7831397,7834431..7834493,
FT                   7837716..7837853,7840741..7842381)
FT                   /gene="Spock3"
FT                   /locus_tag="mCG_9708"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 3, transcript variant mCT192565"
FT                   /note="gene_id=mCG9708.3 transcript_id=mCT192565.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(7438250..7438319,7438820..7439008,7593105..7593113,
FT                   7593214..7593259,7626976..7627090,7704331..7704454,
FT                   7728458..7728572,7814428..7814547,7831176..7831397,
FT                   7834431..7834493,7837716..7837853,7840741..7842381)
FT                   /gene="Spock3"
FT                   /locus_tag="mCG_9708"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 3, transcript variant mCT9692"
FT                   /note="gene_id=mCG9708.3 transcript_id=mCT9692.2 created on
FT                   18-SEP-2002"
FT   CDS             join(<7438251..7438319,7438820..7439017,7593214..7593259,
FT                   7626976..7627090,7704331..7704454,7728458..7728572,
FT                   7814428..7814547,7831176..7831397,7834431..7834493,
FT                   7837716..7837853,7840741..7840910)
FT                   /codon_start=1
FT                   /gene="Spock3"
FT                   /locus_tag="mCG_9708"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 3, isoform CRA_b"
FT                   /note="gene_id=mCG9708.3 transcript_id=mCT192565.0
FT                   protein_id=mCP113522.0 isoform=CRA_b"
FT                   /protein_id="EDL28665.1"
FT                   /translation="LHPLAPARLRIRNLLQLGFRERKMLKVSALLCVCAAAWCSQTLAA
FT                   AAAVAVAGGRSDGGNFLDEKQWLTTISQYDKEVGQWNKFRDVSDDDYFRTWNPGKPFDQ
FT                   ALDPAKDPCLKTKCSRHKVCITQDAQTALCISHRRLTHSMKEVGGSHKQWRGLPSSTCK
FT                   PCPIAYASPVCGSDGHSYSSQCKLEYQACVLGKQISIKCEGRCPCPSDKSMNIGRNVKR
FT                   ACSDLEFREVANRLRDWFKALHESGSQNKKTKALLRPERSRFDTSILPICKDSLGWMFN
FT                   RLDTNYDLLLDQSELGSIYLDKNEQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPC
FT                   HTELSNIQKRQGIKKLLGQYIPLCDEDGYYKPTQCHGSVGQCWCVDRYGNEVVGSRING
FT                   VADCAIDFEISGDFASGDFREWTDDEGEEDDIMNDKDDIEDDDEDEGDDDDDGDVHDGY
FT                   I"
FT   CDS             join(<7438251..7438319,7438820..7439008,7593214..7593259,
FT                   7626976..7627090,7704331..7704454,7728458..7728572,
FT                   7814428..7814547,7831176..7831397,7834431..7834493,
FT                   7837716..7837853,7840741..7840910)
FT                   /codon_start=1
FT                   /gene="Spock3"
FT                   /locus_tag="mCG_9708"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 3, isoform CRA_d"
FT                   /note="gene_id=mCG9708.3 transcript_id=mCT192567.0
FT                   protein_id=mCP113524.0 isoform=CRA_d"
FT                   /protein_id="EDL28667.1"
FT                   /translation="LHPLAPARLRIRNLLQLGFRERKMLKVSALLCVCAAAWCSQTLAA
FT                   AAAVAVAGGRSDGGNFLDEKQWLTTISQYDKEVGQWNKFRDDDYFRTWNPGKPFDQALD
FT                   PAKDPCLKTKCSRHKVCITQDAQTALCISHRRLTHSMKEVGGSHKQWRGLPSSTCKPCP
FT                   IAYASPVCGSDGHSYSSQCKLEYQACVLGKQISIKCEGRCPCPSDKSMNIGRNVKRACS
FT                   DLEFREVANRLRDWFKALHESGSQNKKTKALLRPERSRFDTSILPICKDSLGWMFNRLD
FT                   TNYDLLLDQSELGSIYLDKNEQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCHTE
FT                   LSNIQKRQGIKKLLGQYIPLCDEDGYYKPTQCHGSVGQCWCVDRYGNEVVGSRINGVAD
FT                   CAIDFEISGDFASGDFREWTDDEGEEDDIMNDKDDIEDDDEDEGDDDDDGDVHDGYI"
FT   mRNA            join(<7438436..7438548,7438820..7439017,7593214..7593259,
FT                   7626976..7627090,7704331..7704454,7728458..7728572,
FT                   7814428..7814547,7831176..7831397,7834431..7834493,
FT                   7837716..7837853,7840741..7842387)
FT                   /gene="Spock3"
FT                   /locus_tag="mCG_9708"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 3, transcript variant mCT192566"
FT                   /note="gene_id=mCG9708.3 transcript_id=mCT192566.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(7438436..7438548,7438820..7439008,7593105..7593113,
FT                   7593214..7593259,7626976..7627090,7704331..7704454,
FT                   7728458..7728572,7814428..7814547,7831176..7831397,
FT                   7834431..7834493,7837716..7837853,7840741..7842387)
FT                   /gene="Spock3"
FT                   /locus_tag="mCG_9708"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 3, transcript variant mCT173280"
FT                   /note="gene_id=mCG9708.3 transcript_id=mCT173280.0 created
FT                   on 18-SEP-2002"
FT   CDS             join(<7438438..7438548,7438820..7439017,7593214..7593259,
FT                   7626976..7627090,7704331..7704454,7728458..7728572,
FT                   7814428..7814547,7831176..7831397,7834431..7834493,
FT                   7837716..7837853,7840741..7840910)
FT                   /codon_start=1
FT                   /gene="Spock3"
FT                   /locus_tag="mCG_9708"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 3, isoform CRA_c"
FT                   /note="gene_id=mCG9708.3 transcript_id=mCT192566.0
FT                   protein_id=mCP113523.0 isoform=CRA_c"
FT                   /protein_id="EDL28666.1"
FT                   /translation="SGRLRRRRVQQLQQEASCQSRAAFPSGAASSVPALNKMLKVSALL
FT                   CVCAAAWCSQTLAAAAAVAVAGGRSDGGNFLDEKQWLTTISQYDKEVGQWNKFRDVSDD
FT                   DYFRTWNPGKPFDQALDPAKDPCLKTKCSRHKVCITQDAQTALCISHRRLTHSMKEVGG
FT                   SHKQWRGLPSSTCKPCPIAYASPVCGSDGHSYSSQCKLEYQACVLGKQISIKCEGRCPC
FT                   PSDKSMNIGRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKALLRPERSRFDTS
FT                   ILPICKDSLGWMFNRLDTNYDLLLDQSELGSIYLDKNEQCTKAFFNSCDTYKDSLISNN
FT                   EWCYCFQRQQDPPCHTELSNIQKRQGIKKLLGQYIPLCDEDGYYKPTQCHGSVGQCWCV
FT                   DRYGNEVVGSRINGVADCAIDFEISGDFASGDFREWTDDEGEEDDIMNDKDDIEDDDED
FT                   EGDDDDDGDVHDGYI"
FT   CDS             join(7438820..7439008,7593105..7593113,7593214..7593259,
FT                   7626976..7627090,7704331..7704454,7728458..7728572,
FT                   7814428..7814547,7831176..7831397,7834431..7834493,
FT                   7837716..7837853,7840741..7840910)
FT                   /codon_start=1
FT                   /gene="Spock3"
FT                   /locus_tag="mCG_9708"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 3, isoform CRA_a"
FT                   /note="gene_id=mCG9708.3 transcript_id=mCT173280.0
FT                   protein_id=mCP96199.0 isoform=CRA_a"
FT                   /protein_id="EDL28664.1"
FT                   /translation="MLKVSALLCVCAAAWCSQTLAAAAAVAVAGGRSDGGNFLDEKQWL
FT                   TTISQYDKEVGQWNKFRDEVEDDYFRTWNPGKPFDQALDPAKDPCLKTKCSRHKVCITQ
FT                   DAQTALCISHRRLTHSMKEVGGSHKQWRGLPSSTCKPCPIAYASPVCGSDGHSYSSQCK
FT                   LEYQACVLGKQISIKCEGRCPCPSDKSMNIGRNVKRACSDLEFREVANRLRDWFKALHE
FT                   SGSQNKKTKALLRPERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSELGSIYLDKN
FT                   EQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCHTELSNIQKRQGIKKLLGQYIPL
FT                   CDEDGYYKPTQCHGSVGQCWCVDRYGNEVVGSRINGVADCAIDFEISGDFASGDFREWT
FT                   DDEGEEDDIMNDKDDIEDDDEDEGDDDDDGDVHDGYI"
FT   CDS             join(7438820..7439008,7593105..7593113,7593214..7593259,
FT                   7626976..7627090,7704331..7704454,7728458..7728572,
FT                   7814428..7814547,7831176..7831397,7834431..7834493,
FT                   7837716..7837853,7840741..7840910)
FT                   /codon_start=1
FT                   /gene="Spock3"
FT                   /locus_tag="mCG_9708"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 3, isoform CRA_a"
FT                   /note="gene_id=mCG9708.3 transcript_id=mCT9692.2
FT                   protein_id=mCP16752.2 isoform=CRA_a"
FT                   /protein_id="EDL28668.1"
FT                   /translation="MLKVSALLCVCAAAWCSQTLAAAAAVAVAGGRSDGGNFLDEKQWL
FT                   TTISQYDKEVGQWNKFRDEVEDDYFRTWNPGKPFDQALDPAKDPCLKTKCSRHKVCITQ
FT                   DAQTALCISHRRLTHSMKEVGGSHKQWRGLPSSTCKPCPIAYASPVCGSDGHSYSSQCK
FT                   LEYQACVLGKQISIKCEGRCPCPSDKSMNIGRNVKRACSDLEFREVANRLRDWFKALHE
FT                   SGSQNKKTKALLRPERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSELGSIYLDKN
FT                   EQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCHTELSNIQKRQGIKKLLGQYIPL
FT                   CDEDGYYKPTQCHGSVGQCWCVDRYGNEVVGSRINGVADCAIDFEISGDFASGDFREWT
FT                   DDEGEEDDIMNDKDDIEDDDEDEGDDDDDGDVHDGYI"
FT   gene            complement(8186058..>8224365)
FT                   /locus_tag="mCG_1048967"
FT                   /note="gene_id=mCG1048967.0"
FT   mRNA            complement(join(8186058..8186404,8189310..8189449,
FT                   8192562..8192722,8224253..>8224365))
FT                   /locus_tag="mCG_1048967"
FT                   /product="mCG1048967"
FT                   /note="gene_id=mCG1048967.0 transcript_id=mCT166671.0
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(8189430..8189449,8192562..8192722,
FT                   8224253..>8224329))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048967"
FT                   /product="mCG1048967"
FT                   /note="gene_id=mCG1048967.0 transcript_id=mCT166671.0
FT                   protein_id=mCP54234.0"
FT                   /protein_id="EDL28669.1"
FT                   /translation="EIKLCRRRFWSVVFFLAGRENASNNNQKLETTQMFHNRRMDTENV
FT                   VPYTTEYCSAIKNKYILDFAGKWMEVTQTQKNTYDYPPMF"
FT   gene            8262974..8263972
FT                   /pseudo
FT                   /locus_tag="mCG_9709"
FT                   /note="gene_id=mCG9709.1"
FT   mRNA            8262974..8263972
FT                   /pseudo
FT                   /locus_tag="mCG_9709"
FT                   /note="gene_id=mCG9709.1 transcript_id=mCT9693.1 created on
FT                   05-JUN-2002"
FT   gene            complement(<8419151..>8432799)
FT                   /locus_tag="mCG_55083"
FT                   /note="gene_id=mCG55083.2"
FT   mRNA            complement(join(<8419151..8421792,8423957..8424198,
FT                   8431066..8431151,8432722..>8432799))
FT                   /locus_tag="mCG_55083"
FT                   /product="mCG55083"
FT                   /note="gene_id=mCG55083.2 transcript_id=mCT55266.2 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(8419151..8421792,8423957..8424198,
FT                   8431066..8431151,8432722..>8432799))
FT                   /codon_start=1
FT                   /locus_tag="mCG_55083"
FT                   /product="mCG55083"
FT                   /note="gene_id=mCG55083.2 transcript_id=mCT55266.2
FT                   protein_id=mCP37634.2"
FT                   /protein_id="EDL28670.1"
FT                   /translation="NEKLKEIESHVANNLLAAIETSSLSEFHQSSSFLSANKKQRRSNQ
FT                   CKSAHLPYERVLLTSENDDDDDDGADDKWNTKCSNRIISKTSPDTTSLVSRQPLSLHQC
FT                   NLELFLPKEGNQKTCGSGHSEHTSSVDVLPNESHCHSDQSPQSSPSEMKTGPSPNLRRG
FT                   EKLTLKNITQRKKCVSSTVDILYVSDLENQSISSPGSNWNNEINGHTNETSNNTQRNTE
FT                   CFLGLPSESSSEPYVKRMEQVQKTDNFHFHNTVSEAADVELTATDVGKIVIVSKSNKNQ
FT                   IKKKADCRKETFRKVKGASSDKKRESSKRECKDGSEVGAEKETDESRAKRGSGVLDGRG
FT                   DSEEPNCISSTEQPSQVNTQKKITPQNSSDQENIQNKKRRRTYMLDEQEEANPFSRHSV
FT                   KFLQDGKFDLCQKTLHHNLSNPSRQTFVIHKSEKGNLFPNQEDKDTISESLEVTNEFHT
FT                   ADHSIRENVCDHEAQTTLGLRKSVNAQQNLTKKTKQKINRGTKIVSSMKQIYEDNDKDM
FT                   HFLEKGNFPFQTQADKVTTSGSLEATEEFDTPLFFTRVNGSLRDCETQNVMDLHKQITG
FT                   IYPAQNESQMSKNPRQKVNRKTAVISGVNCFSSDKGVHCSEKDKSFLLQKDKDILGTLK
FT                   DLSESDMPALCNQDSAEPYKSEMLLGLKKHDHDMQPACQGDSKVDKKLRKQANRKTEII
FT                   SKITQIHDNDGGSAHDPLNKKLGQKVNISDIISQMNQLYETTIEDGNGFKSSVKDCQGV
FT                   ISCDLGEINSNKKENYDPIQDPCTLVKKTKRKGSCNSGSSLAGDKNRCSLRLTDSSQVS
FT                   VTLDSGLRHHPNEADTSPGEWTNLPKKQKPIVVSSPGDAFSVSAGKARSNPAKAVSEMT
FT                   SKLKKRKTHLGCSPETHGPVEITPNTDLTKAVDSQQTEKENYLEKENYLENEKIAKRKP
FT                   DFCMKVLKPLSQTCSSNIKNSSLDSMCKSSLPLSISSSKNLMLEESSSLESTCIFQVGD
FT                   DAREKITAGTHNPHRTQKSRPGRPEF"
FT   gene            complement(8508245..8698932)
FT                   /gene="Tll1"
FT                   /locus_tag="mCG_22897"
FT                   /note="gene_id=mCG22897.1"
FT   mRNA            complement(join(8508245..8509500,8510797..8511047,
FT                   8518378..8518591,8531605..8531732,8534367..8534492,
FT                   8539965..8540145,8544343..8544503,8546943..8547068,
FT                   8549339..8549534,8563236..8563381,8564356..8564472,
FT                   8567292..8567394,8578496..8578611,8586910..8587034,
FT                   8591473..8591578,8594882..8595060,8610950..8611067,
FT                   8611577..8611729,8614502..8614582,8617931..8618041,
FT                   8698154..8698932))
FT                   /gene="Tll1"
FT                   /locus_tag="mCG_22897"
FT                   /product="tolloid-like"
FT                   /note="gene_id=mCG22897.1 transcript_id=mCT22171.2 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(8509366..8509500,8510797..8511047,
FT                   8518378..8518591,8531605..8531732,8534367..8534492,
FT                   8539965..8540145,8544343..8544503,8546943..8547068,
FT                   8549339..8549534,8563236..8563381,8564356..8564472,
FT                   8567292..8567394,8578496..8578611,8586910..8587034,
FT                   8591473..8591578,8594882..8595060,8610950..8611067,
FT                   8611577..8611729,8614502..8614582,8617931..8618041,
FT                   8698154..8698322))
FT                   /codon_start=1
FT                   /gene="Tll1"
FT                   /locus_tag="mCG_22897"
FT                   /product="tolloid-like"
FT                   /note="gene_id=mCG22897.1 transcript_id=mCT22171.2
FT                   protein_id=mCP16748.2"
FT                   /db_xref="GOA:G3X9F5"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="InterPro:IPR001506"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR015446"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:106923"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9F5"
FT                   /protein_id="EDL28671.1"
FT                   /translation="MGLQALSPRMLLWLVVSGIVFSRVLWVCAGLDYDYTFDGNEEDKT
FT                   EPIDYKDPCKAAVFWGDIALDDEDLNIFQIDRTIDLTQSPFGKLGHITGGFGDHGMPKK
FT                   RGALYQLIERIRRIGSGLEQNNTMKGKAPPKLSEQSEKNRVPRAATSRTERIWPGGVIP
FT                   YVIGGNFTGSQRAMFKQAMRHWEKHTCVTFTERSDEESYIVFTYRPCGCCSYVGRRGNG
FT                   PQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEP
FT                   GEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQA
FT                   RKLYRCPACGETLQESSGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKS
FT                   SLCWYDYIEVRDGYWRKSPLLGRFCGDKVAGVLTSTDSRMWIEFRSSSNWVGKGFAAVY
FT                   EAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIERHDSCAY
FT                   DHLEVRDGASENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEED
FT                   ECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWP
FT                   KEYPPNKNCVWQVIAPSQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCG
FT                   ADIPEVMTSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYT
FT                   CQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWVISAIPGHRI
FT                   TLAFNEFEVEQHQECAYDHLEIFDGETEKSPILGRLCGSKIPDPLMATGNEMFIRFISD
FT                   ASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQLDCEWLLVSERGSRLE
FT                   LSFQTFEVEEEADCGYDYVEVFDGLSSKAVGLGRFCGSGPPEEIYSIGDVALIHFHTDD
FT                   TINKKGFYIRYKSIRYPETMHAKN"
FT   gene            complement(<9095815..9182460)
FT                   /locus_tag="mCG_116595"
FT                   /note="gene_id=mCG116595.1"
FT   mRNA            complement(join(<9095815..9095954,9098260..9098442,
FT                   9100586..9100703,9106748..9106915,9108562..9108758,
FT                   9181939..9182460))
FT                   /locus_tag="mCG_116595"
FT                   /product="mCG116595, transcript variant mCT117718"
FT                   /note="gene_id=mCG116595.1 transcript_id=mCT117718.1
FT                   created on 25-JUN-2002"
FT   mRNA            complement(join(<9095815..9095954,9098260..9098442,
FT                   9100586..9100703,9106748..9106915,9108562..9108758,
FT                   9181939..9182062,9182147..9182351))
FT                   /locus_tag="mCG_116595"
FT                   /product="mCG116595, transcript variant mCT170262"
FT                   /note="gene_id=mCG116595.1 transcript_id=mCT170262.0
FT                   created on 25-JUN-2002"
FT   CDS             complement(join(<9095815..9095954,9098260..9098442,
FT                   9100586..9100703,9106748..9106915,9108562..9108758,
FT                   9181939..9182062,9182147..9182245))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116595"
FT                   /product="mCG116595, isoform CRA_a"
FT                   /note="gene_id=mCG116595.1 transcript_id=mCT170262.0
FT                   protein_id=mCP93180.0 isoform=CRA_a"
FT                   /protein_id="EDL28672.1"
FT                   /translation="MAGRGGRVLLALCAALVAGGWLLTAEAQEPGAPALVSVWLQCTAI
FT                   SRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLC
FT                   NEYQKGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNF
FT                   PDLDRIVYVNEKEGGPNNHLLKNLKKIVDQNSKLAPETKAVIHWIMDIPFVLSANLHGG
FT                   DLVANYPYDETRSGTAHEYSSCPDDAIFQSLARAYSSFNPVMSDPNRPPCRKNDDDSSF
FT                   VDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKSYWEDNKNSLISY
FT                   LEQ"
FT   CDS             complement(join(<9095815..9095954,9098260..9098442,
FT                   9100586..9100703,9106748..9106915,9108562..9108758,
FT                   9181939..9182245))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116595"
FT                   /product="mCG116595, isoform CRA_b"
FT                   /note="gene_id=mCG116595.1 transcript_id=mCT117718.1
FT                   protein_id=mCP53932.1 isoform=CRA_b"
FT                   /protein_id="EDL28673.1"
FT                   /translation="MAGRGGRVLLALCAALVAGGWLLTAEAQEPGAPAAGMRRRRRLQQ
FT                   EDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVHEPGE
FT                   PEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVNLIHSTRIHIMPSLNPDGFE
FT                   KAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNLKKIVDQN
FT                   SKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGTAHEYSSCPDDAIFQSL
FT                   ARAYSSFNPVMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEIT
FT                   VELSCEKFPPEETLKSYWEDNKNSLISYLEQ"
FT   gene            complement(9207802..9223627)
FT                   /gene="Sc4mol"
FT                   /locus_tag="mCG_22899"
FT                   /note="gene_id=mCG22899.2"
FT   mRNA            complement(join(9207802..9208838,9210002..9210156,
FT                   9212233..9212359,9213358..9213506,9217399..9217683,
FT                   9223343..9223627))
FT                   /gene="Sc4mol"
FT                   /locus_tag="mCG_22899"
FT                   /product="sterol-C4-methyl oxidase-like, transcript variant
FT                   mCT22174"
FT                   /note="gene_id=mCG22899.2 transcript_id=mCT22174.2 created
FT                   on 18-SEP-2002"
FT   mRNA            complement(join(9207866..9208838,9210002..9210156,
FT                   9212233..9212359,9223343..>9223417))
FT                   /gene="Sc4mol"
FT                   /locus_tag="mCG_22899"
FT                   /product="sterol-C4-methyl oxidase-like, transcript variant
FT                   mCT173274"
FT                   /note="gene_id=mCG22899.2 transcript_id=mCT173274.0 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(9208643..9208838,9210002..9210156,
FT                   9212233..9212359,9223343..>9223368))
FT                   /codon_start=1
FT                   /gene="Sc4mol"
FT                   /locus_tag="mCG_22899"
FT                   /product="sterol-C4-methyl oxidase-like, isoform CRA_b"
FT                   /note="gene_id=mCG22899.2 transcript_id=mCT173274.0
FT                   protein_id=mCP96193.0 isoform=CRA_b"
FT                   /protein_id="EDL28675.1"
FT                   /translation="TAVCRGDARYLTLARCLGCAVIEDTWHYFLHRLLHHKRIYKYIHK
FT                   VHHEFQAPFGIEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSG
FT                   YDIPLNPLNLVPFYTGARHHDFHHMNFIGNYASTFTWWDKLFGTDAQYHAYIEKSKKLG
FT                   KKSD"
FT   CDS             complement(join(9208643..9208838,9210002..9210156,
FT                   9212233..9212359,9213358..9213506,9217399..9217653))
FT                   /codon_start=1
FT                   /gene="Sc4mol"
FT                   /locus_tag="mCG_22899"
FT                   /product="sterol-C4-methyl oxidase-like, isoform CRA_a"
FT                   /note="gene_id=mCG22899.2 transcript_id=mCT22174.2
FT                   protein_id=mCP16759.1 isoform=CRA_a"
FT                   /protein_id="EDL28674.1"
FT                   /translation="MATNKSVGVFSSASLAVEYVDSLLPENPLQEPFKNAWVYMLDNYT
FT                   KFQIATWGSLIVHEAIYFLFSLPGFLFQFIPYMRKYKIQKDKPETFEGQWKCLKKILFN
FT                   HFFIQLPLICGTYYFTEFFNIPYDWERMPRWYLTLARCLGCAVIEDTWHYFLHRLLHHK
FT                   RIYKYIHKVHHEFQAPFGIEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLL
FT                   ETIDVHSGYDIPLNPLNLVPFYTGARHHDFHHMNFIGNYASTFTWWDKLFGTDAQYHAY
FT                   IEKSKKLGKKSD"
FT   gene            complement(9229505..9342836)
FT                   /gene="Klhl2"
FT                   /locus_tag="mCG_22901"
FT                   /note="gene_id=mCG22901.2"
FT   mRNA            complement(join(9229505..9230804,9232785..9232928,
FT                   9238862..9239002,9239525..9239653,9241559..9241660,
FT                   9242479..9242676,9244115..9244232,9247922..9248071,
FT                   9249563..9249679,9253928..9254037,9269408..9269570,
FT                   9300728..9300849,9312061..9312167,9323497..9323622,
FT                   9342738..9342836))
FT                   /gene="Klhl2"
FT                   /locus_tag="mCG_22901"
FT                   /product="kelch-like 2, Mayven (Drosophila)"
FT                   /note="gene_id=mCG22901.2 transcript_id=mCT22211.2 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(9230776..9230804,9232785..9232928,
FT                   9238862..9239002,9239525..9239653,9241559..9241660,
FT                   9242479..9242676,9244115..9244232,9247922..9248071,
FT                   9249563..9249679,9253928..9254037,9269408..9269570,
FT                   9300728..9300849,9312061..9312167,9323497..9323622,
FT                   9342738..9342763))
FT                   /codon_start=1
FT                   /gene="Klhl2"
FT                   /locus_tag="mCG_22901"
FT                   /product="kelch-like 2, Mayven (Drosophila)"
FT                   /note="gene_id=mCG22901.2 transcript_id=mCT22211.2
FT                   protein_id=mCP16762.2"
FT                   /protein_id="EDL28676.1"
FT                   /translation="METPPLLPACTKQGHQKPLDSKDENPEKHCPLTVNPWHMKKAFKV
FT                   MNELRSQNLLCDVTIVAEDMEIPAHRVVLAACSPYFHAMFTGEMSESRAKRVRIKEVDG
FT                   WTLRMLVDYVYTAEIQVTEENVQVLLPAAGLLQLQDVKKTCCEFLESQLHPVNCLGIRA
FT                   FADMHACTDLLNKANTYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEA
FT                   VIAWVNHDKDVRQEFMARLMEHVRLPLLPREYLVQRVEEEALVKNSSACKDYLIEAMKY
FT                   HLLPTEQRMLMKSVRTRLRTPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELP
FT                   SRRCRAGMVYMAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLN
FT                   GLLYAVGGFDGSTGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDGA
FT                   SRQCLSTVECYNATANEWTYIAEMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYD
FT                   PTTNAWRQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVSSC
FT                   MSTGRSYAGVTVIDKPL"
FT   gene            <9335040..9336198
FT                   /locus_tag="mCG_1048973"
FT                   /note="gene_id=mCG1048973.0"
FT   mRNA            join(<9335040..9335379,9335989..9336198)
FT                   /locus_tag="mCG_1048973"
FT                   /product="mCG1048973"
FT                   /note="gene_id=mCG1048973.0 transcript_id=mCT166677.0
FT                   created on 06-JUN-2002"
FT   CDS             <9335155..9335358
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048973"
FT                   /product="mCG1048973"
FT                   /note="gene_id=mCG1048973.0 transcript_id=mCT166677.0
FT                   protein_id=mCP53943.0"
FT                   /protein_id="EDL28677.1"
FT                   /translation="WTVATLEMGVPADQPMSKLPDLGKDPVSKTKMDSHRRKQTVSTCG
FT                   PQMHVHYACAQMLKRKKIVERG"
FT   gene            complement(<9398482..>9399495)
FT                   /locus_tag="mCG_1048873"
FT                   /note="gene_id=mCG1048873.1"
FT   mRNA            complement(join(<9398482..9398758,9399138..>9399495))
FT                   /locus_tag="mCG_1048873"
FT                   /product="mCG1048873"
FT                   /note="gene_id=mCG1048873.1 transcript_id=mCT166577.1
FT                   created on 06-JUN-2002"
FT   CDS             complement(join(9398482..9398758,9399138..>9399280))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048873"
FT                   /product="mCG1048873"
FT                   /note="gene_id=mCG1048873.1 transcript_id=mCT166577.1
FT                   protein_id=mCP54080.1"
FT                   /protein_id="EDL28678.1"
FT                   /translation="KRNENLHSLPSPNGEVKKKFKDPNVPKTPPSAFFLFCSEYHPKIK
FT                   GKLRAQERIGDVAKKLGEMWNSTEADDKQPYEKKAAKLKEKYKKDIASCRAKGKPDVAK
FT                   NGVVMAEKSKKKKEEEDDEEDEEEEEEEEDEDDDE"
FT   gene            9425554..9431619
FT                   /locus_tag="mCG_116599"
FT                   /note="gene_id=mCG116599.0"
FT   mRNA            join(9425554..9425676,9430051..9430197,9431420..9431619)
FT                   /locus_tag="mCG_116599"
FT                   /product="mCG116599"
FT                   /note="gene_id=mCG116599.0 transcript_id=mCT117722.0
FT                   created on 06-JUN-2002"
FT   CDS             join(9430122..9430197,9431420..9431541)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116599"
FT                   /product="mCG116599"
FT                   /note="gene_id=mCG116599.0 transcript_id=mCT117722.0
FT                   protein_id=mCP53964.1"
FT                   /protein_id="EDL28679.1"
FT                   /translation="MFLWGFRQLEKSGGEKQGSGGTAETVLEIEATLPPAREASFYHLL
FT                   CLYKCPSVHFTDKESAGSRI"
FT   gene            9434955..9456704
FT                   /gene="3110005G23Rik"
FT                   /locus_tag="mCG_22902"
FT                   /note="gene_id=mCG22902.2"
FT   mRNA            join(9434955..9435107,9444175..9444321,9447136..9447400,
FT                   9451969..9452103,9453310..9453412,9456379..9456703)
FT                   /gene="3110005G23Rik"
FT                   /locus_tag="mCG_22902"
FT                   /product="RIKEN cDNA 3110005G23, transcript variant
FT                   mCT22172"
FT                   /note="gene_id=mCG22902.2 transcript_id=mCT22172.2 created
FT                   on 06-JUN-2002"
FT   mRNA            join(<9435028..9435107,9444175..9444321,9447136..9447400,
FT                   9453310..9453412,9456379..9456699)
FT                   /gene="3110005G23Rik"
FT                   /locus_tag="mCG_22902"
FT                   /product="RIKEN cDNA 3110005G23, transcript variant
FT                   mCT192563"
FT                   /note="gene_id=mCG22902.2 transcript_id=mCT192563.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<9435030..9435107,9444175..9444321,9447136..9447400,
FT                   9453310..9453412,9456379..9456502)
FT                   /codon_start=1
FT                   /gene="3110005G23Rik"
FT                   /locus_tag="mCG_22902"
FT                   /product="RIKEN cDNA 3110005G23, isoform CRA_a"
FT                   /note="gene_id=mCG22902.2 transcript_id=mCT192563.0
FT                   protein_id=mCP113508.0 isoform=CRA_a"
FT                   /protein_id="EDL28680.1"
FT                   /translation="ALVERSGWRGIGPRRRVMAAAGRLEDSSLDILQSMDDDPLLDTQP
FT                   LPHHSLQAQFRPRFHPLPTVIIANLLLLIHVVFVVLAFLTGVPCLYPNPTEDKCPENYT
FT                   SPLKVQTAIILGKLILWILHLLFERYVQYHHRKVRSRGYSQIYRSTRHLKTLALTIHSS
FT                   VKIRRFNRAKPLPDVLEEEKIYAYPSNTASETGFRTVSSLEEIVEKQEDIIVYLKRHNA
FT                   LLSKRLLELATQPART"
FT   mRNA            join(<9435055..9435107,9444175..9444321,9447200..9447400,
FT                   9451969..9452103,9453310..9453412,9456379..9456571)
FT                   /gene="3110005G23Rik"
FT                   /locus_tag="mCG_22902"
FT                   /product="RIKEN cDNA 3110005G23, transcript variant
FT                   mCT169780"
FT                   /note="gene_id=mCG22902.2 transcript_id=mCT169780.0 created
FT                   on 06-JUN-2002"
FT   CDS             join(9435081..9435107,9444175..9444321,9447136..9447400,
FT                   9451969..9452103,9453310..9453412,9456379..9456502)
FT                   /codon_start=1
FT                   /gene="3110005G23Rik"
FT                   /locus_tag="mCG_22902"
FT                   /product="RIKEN cDNA 3110005G23, isoform CRA_c"
FT                   /note="gene_id=mCG22902.2 transcript_id=mCT22172.2
FT                   protein_id=mCP16769.2 isoform=CRA_c"
FT                   /protein_id="EDL28682.1"
FT                   /translation="MAAAGRLEDSSLDILQSMDDDPLLDTQPLPHHSLQAQFRPRFHPL
FT                   PTVIIANLLLLIHVVFVVLAFLTGVPCLYPNPTEDKCPENYTSPLKVQTAIILGKLILW
FT                   ILHLLFERYVQYHHRKVRSRGYSQIYRSTRHLKTLALTIHSSGNTALLLLLCVQHSFPE
FT                   PSKLYLELILAVLALELICSLSCLILYIVKIRRFNRAKPLPDVLEEEKIYAYPSNTASE
FT                   TGFRTVSSLEEIVEKQEDIIVYLKRHNALLSKRLLELATQPART"
FT   CDS             join(<9444264..9444321,9447200..9447400,9451969..9452103,
FT                   9453310..9453412,9456379..9456502)
FT                   /codon_start=1
FT                   /gene="3110005G23Rik"
FT                   /locus_tag="mCG_22902"
FT                   /product="RIKEN cDNA 3110005G23, isoform CRA_d"
FT                   /note="gene_id=mCG22902.2 transcript_id=mCT169780.0
FT                   protein_id=mCP92756.0 isoform=CRA_d"
FT                   /protein_id="EDL28683.1"
FT                   /translation="TQIPSSPHGHHSEPSVAYTYKCPENYTSPLKVQTAIILGKLILWI
FT                   LHLLFERYVQYHHRKVRSRGYSQIYRSTRHLKTLALTIHSSGNTALLLLLCVQHSFPEP
FT                   SKLYLELILAVLALELICSLSCLILYIVKIRRFNRAKPLPDVLEEEKIYAYPSNTASET
FT                   GFRTVSSLEEIVEKQEDIIVYLKRHNALLSKRLLELATQPART"
FT   mRNA            join(<9447329..9447400,9451969..9452303,9453310..9453412,
FT                   9456379..9456704)
FT                   /gene="3110005G23Rik"
FT                   /locus_tag="mCG_22902"
FT                   /product="RIKEN cDNA 3110005G23, transcript variant
FT                   mCT169781"
FT                   /note="gene_id=mCG22902.2 transcript_id=mCT169781.0 created
FT                   on 06-JUN-2002"
FT   CDS             join(<9447331..9447400,9451969..9452228)
FT                   /codon_start=1
FT                   /gene="3110005G23Rik"
FT                   /locus_tag="mCG_22902"
FT                   /product="RIKEN cDNA 3110005G23, isoform CRA_b"
FT                   /note="gene_id=mCG22902.2 transcript_id=mCT169781.0
FT                   protein_id=mCP92778.0 isoform=CRA_b"
FT                   /protein_id="EDL28681.1"
FT                   /translation="RGYSQIYRSTRHLKTLALTIHSSGNTALLLLLCVQHSFPEPSKLY
FT                   LELILAVLALELICSLSCLILYIGENGSRCPATSACLLCLPLVCTVREAQPVLADVFPL
FT                   SRGLL"
FT   gene            complement(<9469520..>9470923)
FT                   /locus_tag="mCG_59146"
FT                   /note="gene_id=mCG59146.0"
FT   mRNA            complement(<9469520..>9470923)
FT                   /locus_tag="mCG_59146"
FT                   /product="mCG59146"
FT                   /note="gene_id=mCG59146.0 transcript_id=mCT59329.0 created
FT                   on 06-JUN-2002"
FT   CDS             complement(9469520..9470923)
FT                   /codon_start=1
FT                   /locus_tag="mCG_59146"
FT                   /product="mCG59146"
FT                   /note="gene_id=mCG59146.0 transcript_id=mCT59329.0
FT                   protein_id=mCP37625.0"
FT                   /db_xref="GOA:B2RTB3"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR003879"
FT                   /db_xref="InterPro:IPR006574"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:2685640"
FT                   /db_xref="UniProtKB/TrEMBL:B2RTB3"
FT                   /protein_id="EDL28684.1"
FT                   /translation="MAHVEVLARLQKETKCPICLDDLTDPVTVECGHNFCRSCIKDFWA
FT                   GQQATSSCPVCRHQCQHRNLRSNAQLGNMIETAQLLQGMENKRHESSTSCERHNQALTL
FT                   FCEDDLQLLCDQCVEPESHGRHQVLSITEAASLHRKHLQDYSKLLKWEVKEIQGLMSAL
FT                   NKRTVTLREQAEAQRSQLTSECEKLMRFLDQEERAAFSRLEDEEMRLEKRLLDNIAALE
FT                   HHGSSLRDLLRHLMLTGELSEAKMLSTVKDFYLNCRRQLISPSIFPVQLRRVEYSFPLQ
FT                   YSALQKVIQHFTDNVTLDLKTAHPNLLISKDRTCVTFTKKRQRIPGSSSFTKSPVVLGI
FT                   PHFNSGRHFWEVQVGKKPKWAIGICKADSSIGERQSPNPWGYWRIVWQGDSFNVSGADP
FT                   DSRLKAARATSIGVFLDYELGEVSFYGMPEKCHLYTFRDTFSGPVCPYFYIGPQSEPLR
FT                   LCSATDSEC"
FT   gene            complement(9486395..9488971)
FT                   /locus_tag="mCG_1048889"
FT                   /note="gene_id=mCG1048889.1"
FT   mRNA            complement(9486395..9488971)
FT                   /locus_tag="mCG_1048889"
FT                   /product="mCG1048889"
FT                   /note="gene_id=mCG1048889.1 transcript_id=mCT166593.1
FT                   created on 13-JUN-2003"
FT   CDS             complement(9487317..9488717)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048889"
FT                   /product="mCG1048889"
FT                   /note="gene_id=mCG1048889.1 transcript_id=mCT166593.1
FT                   protein_id=mCP53952.0"
FT                   /protein_id="EDL28685.1"
FT                   /translation="MDSTALKILQDKCICYICSDFMEDPVTSRCGHNFCFACLRLLWDD
FT                   LQGNIFCPVCQTPFPPKSFSRNYQFRNMTETIRLLQKRQSKRKRQEEHTVCPKHDQPLV
FT                   LFCVRDRDVLCTQCSLSVEHQGHYTCPIKKASSYHRKVLESAIATLKFGVKQVEEKLAV
FT                   QHRRVLGLREEAQYQKIEIRYEIGQIKLFLQSEYEAHLNESHMEELRSFSELNGYLETL
FT                   LDHVSTAKDLLKEVEAIHERSDVTLLRAYHKLQNLKSPKPWLFRTKQYGLSLPAQYSGL
FT                   SRIIKQFQADVTFDRDTAHPQLVISEDRKSVFYKEAWPCVCASPQKFHLWPALLGCKGF
FT                   DSGRQYWEVKVGDKPRWTLGVCQAHFSGDWSNQSSGFWAIGRYAENSYVTYGPLRTEFL
FT                   PVVRPSKVGIFLDYELGELSFYNMNDRSLLYTFRNSFTSTLWPYFYIGTDSESLEILTH
FT                   PTPDTGSY"
FT   gene            complement(9500129..>9526456)
FT                   /locus_tag="mCG_22896"
FT                   /note="gene_id=mCG22896.2"
FT   mRNA            complement(join(9500129..9502043,9505489..9505560))
FT                   /locus_tag="mCG_22896"
FT                   /product="mCG22896, transcript variant mCT22170"
FT                   /note="gene_id=mCG22896.2 transcript_id=mCT22170.1 created
FT                   on 06-JUN-2002"
FT   CDS             complement(9500365..9501750)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22896"
FT                   /product="mCG22896, isoform CRA_b"
FT                   /note="gene_id=mCG22896.2 transcript_id=mCT22170.1
FT                   protein_id=mCP16777.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q8JZK6"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR003879"
FT                   /db_xref="InterPro:IPR006574"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="MGI:MGI:2387432"
FT                   /db_xref="UniProtKB/TrEMBL:Q8JZK6"
FT                   /protein_id="EDL28687.1"
FT                   /translation="MELAAGLADLQAEARCSVCKEYLKNPGTMECGHKVCLSCTSVFWE
FT                   DLKGSVPCPSCHLNCPGRNFLSNQPPGEFTEVAILPPERTSRSGRQEGEHPWEKPQQVS
FT                   CPLRSFPPNHFVWPVENAIVCHRKQIDCYIKLWREMVEPIQKAISTQRKGSLELRKRTE
FT                   CRRERVRSQYEQNRLFLQVERKKILGHLQSEEMDGLSKLNKNLAKLSDHASLLKSLLKD
FT                   LKSQCEKSELALLASVKDWYERYKQSGWPEMALVTLKGYDYRLPLQYSDLDRIIKRFQV
FT                   DVILDPETANYKLTVSKDKKTVKYGSWERVPYSSRKFCFDPAVLGSEGYSSDRQYWEVD
FT                   VELKMEWVLGVCREPFPRSRYAERFSDEQFSVQDGLWGVGLDNSQTYVALGGEKIHLLP
FT                   KVSPTRIGIFLDSEMYEVSFYNLRDKSLLYRFSDLPRGTFWPYFYTGYDYEPLKICTVA
FT                   DLE"
FT   mRNA            complement(join(9501797..9502032,9525063..9525160,
FT                   9526296..>9526456))
FT                   /locus_tag="mCG_22896"
FT                   /product="mCG22896, transcript variant mCT169779"
FT                   /note="gene_id=mCG22896.2 transcript_id=mCT169779.0 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(9525072..9525160,9526296..>9526455))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22896"
FT                   /product="mCG22896, isoform CRA_a"
FT                   /note="gene_id=mCG22896.2 transcript_id=mCT169779.0
FT                   protein_id=mCP92761.0 isoform=CRA_a"
FT                   /protein_id="EDL28686.1"
FT                   /translation="SYCSLACKKKEKQKERKRRKEKRERKEKMRFQPLFWVFFIFAMSL
FT                   LFISEQKPVNFPRRRKLYRHNCFRRRCIPLHSRVPFP"
FT   gene            complement(9576911..>9624470)
FT                   /locus_tag="mCG_140493"
FT                   /note="gene_id=mCG140493.0"
FT   mRNA            complement(join(9576911..9577951,9599785..9599918,
FT                   9624167..>9624470))
FT                   /locus_tag="mCG_140493"
FT                   /product="mCG140493"
FT                   /note="gene_id=mCG140493.0 transcript_id=mCT169783.0
FT                   created on 07-JUN-2002"
FT   CDS             complement(join(9577934..9577951,9599785..9599918,
FT                   9624167..>9624308))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140493"
FT                   /product="mCG140493"
FT                   /note="gene_id=mCG140493.0 transcript_id=mCT169783.0
FT                   protein_id=mCP92763.0"
FT                   /protein_id="EDL28688.1"
FT                   /translation="SQHLQDLEESKRECLLTAQPSPDPTRERLSNQPHGLRPGFSRERN
FT                   VSGENTVSLPWSYHSPTWRWRSFYWLSSSFPCLLWLPSTPALMRGMKTMTST"
FT   gene            complement(9584992..9585463)
FT                   /pseudo
FT                   /locus_tag="mCG_146378"
FT                   /note="gene_id=mCG146378.0"
FT   mRNA            complement(9584992..9585463)
FT                   /pseudo
FT                   /locus_tag="mCG_146378"
FT                   /note="gene_id=mCG146378.0 transcript_id=mCT186581.0
FT                   created on 16-JUL-2003"
FT   gene            complement(9625960..9627246)
FT                   /pseudo
FT                   /locus_tag="mCG_22903"
FT                   /note="gene_id=mCG22903.1"
FT   mRNA            complement(9625960..9627246)
FT                   /pseudo
FT                   /locus_tag="mCG_22903"
FT                   /note="gene_id=mCG22903.1 transcript_id=mCT22212.1 created
FT                   on 07-JUN-2002"
FT   gene            9679076..9679428
FT                   /pseudo
FT                   /locus_tag="mCG_65511"
FT                   /note="gene_id=mCG65511.2"
FT   mRNA            9679076..9679428
FT                   /pseudo
FT                   /locus_tag="mCG_65511"
FT                   /note="gene_id=mCG65511.2 transcript_id=mCT65694.2 created
FT                   on 07-JUN-2002"
FT   gene            complement(9772268..9772744)
FT                   /pseudo
FT                   /locus_tag="mCG_57951"
FT                   /note="gene_id=mCG57951.2"
FT   mRNA            complement(9772268..9772744)
FT                   /pseudo
FT                   /locus_tag="mCG_57951"
FT                   /note="gene_id=mCG57951.2 transcript_id=mCT58134.2 created
FT                   on 07-JUN-2002"
FT   gene            <10100216..10442081
FT                   /locus_tag="mCG_145458"
FT                   /note="gene_id=mCG145458.0"
FT   mRNA            join(<10100216..10100362,10352402..10352478,
FT                   10440800..10442081)
FT                   /locus_tag="mCG_145458"
FT                   /product="mCG145458"
FT                   /note="gene_id=mCG145458.0 transcript_id=mCT184882.0
FT                   created on 05-JUN-2003"
FT   gene            complement(<10296765..>10297178)
FT                   /locus_tag="mCG_49770"
FT                   /note="gene_id=mCG49770.2"
FT   mRNA            complement(<10296765..>10297178)
FT                   /locus_tag="mCG_49770"
FT                   /product="mCG49770"
FT                   /note="gene_id=mCG49770.2 transcript_id=mCT49953.2 created
FT                   on 07-JUN-2002"
FT   CDS             complement(<10296765..10297178)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49770"
FT                   /product="mCG49770"
FT                   /note="gene_id=mCG49770.2 transcript_id=mCT49953.2
FT                   protein_id=mCP37601.2"
FT                   /protein_id="EDL28690.1"
FT                   /translation="MVESIRRGTLQRKLVYWSLALKSSSHREDPALLLPRGVLNVASVC
FT                   LQIRYPSVASGLHSIINGYEQITALSVETEYTFPLAEKVKAFMANPSTLVAAAPVGKPR
FT                   LLCSPAKAEAKKELEESDEDIGFSLLEYSPQSCQ"
FT   CDS             <10441471..10441698
FT                   /codon_start=1
FT                   /locus_tag="mCG_145458"
FT                   /product="mCG145458"
FT                   /note="gene_id=mCG145458.0 transcript_id=mCT184882.0
FT                   protein_id=mCP105392.0"
FT                   /protein_id="EDL28689.1"
FT                   /translation="CLGIHCSSFLMTCVWDFGRDVCSFAFYSRKNCLKLNTVSNILYNT
FT                   SRMYPEEVGGIGSPSFKFKMLEKSDARSLF"
FT   gene            <10867070..10950739
FT                   /locus_tag="mCG_21061"
FT                   /note="gene_id=mCG21061.2"
FT   mRNA            join(<10867070..10867296,10899392..10899572,
FT                   10938172..10938319,10950064..10950738)
FT                   /locus_tag="mCG_21061"
FT                   /product="mCG21061, transcript variant mCT19618"
FT                   /note="gene_id=mCG21061.2 transcript_id=mCT19618.1 created
FT                   on 25-JUN-2002"
FT   CDS             join(<10867070..10867296,10899392..10899572,
FT                   10938172..10938319,10950064..10950362)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21061"
FT                   /product="mCG21061, isoform CRA_b"
FT                   /note="gene_id=mCG21061.2 transcript_id=mCT19618.1
FT                   protein_id=mCP16763.1 isoform=CRA_b"
FT                   /protein_id="EDL28692.1"
FT                   /translation="DFPDSMNLTMSNMTSSHICCNFLNMWKKSKISTMYYLNQDAKLSN
FT                   LFLQASSPTTGTAPRSQSRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQS
FT                   CLHQWIKSSDTRCCELCKYDFIMETKLKPLRKWEKLQMTTSERRKIFCSVTFHVIAVTC
FT                   VVWSLYVLIDRTAEEIKQGNDNGVLEWPFWTKLVVVAIGFTGGLVFMYVQCKVYVQLWR
FT                   RLKAYNRVIFVQNCPDTANKLEKNFPCNVNTEIKDAVVVPVPQTGSNTLPTAEGAPPEV
FT                   IPV"
FT   mRNA            join(<10867077..10867296,10899392..10899572,
FT                   10938172..10938307,10950064..10950739)
FT                   /locus_tag="mCG_21061"
FT                   /product="mCG21061, transcript variant mCT170283"
FT                   /note="gene_id=mCG21061.2 transcript_id=mCT170283.0 created
FT                   on 25-JUN-2002"
FT   CDS             join(<10867079..10867296,10899392..10899572,
FT                   10938172..10938307,10950064..10950362)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21061"
FT                   /product="mCG21061, isoform CRA_a"
FT                   /note="gene_id=mCG21061.2 transcript_id=mCT170283.0
FT                   protein_id=mCP93201.0 isoform=CRA_a"
FT                   /protein_id="EDL28691.1"
FT                   /translation="DSMNLTMSNMTSSHICCNFLNMWKKSKISTMYYLNQDAKLSNLFL
FT                   QASSPTTGTAPRSQSRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLH
FT                   QWIKSSDTRCCELCKYDFIMETKLKPLRKWEKLQMTTSERRKIFCSVTFHVIAVTCVVW
FT                   SLYVLIDRTAEEIKQGVLEWPFWTKLVVVAIGFTGGLVFMYVQCKVYVQLWRRLKAYNR
FT                   VIFVQNCPDTANKLEKNFPCNVNTEIKDAVVVPVPQTGSNTLPTAEGAPPEVIPV"
FT   gene            complement(10957566..10968380)
FT                   /gene="1810029B16Rik"
FT                   /locus_tag="mCG_21060"
FT                   /note="gene_id=mCG21060.2"
FT   mRNA            complement(join(10957566..10958767,10959873..10959915,
FT                   10962206..10962354,10963329..10963413,10964372..10964409,
FT                   10965923..10966035,10968285..10968380))
FT                   /gene="1810029B16Rik"
FT                   /locus_tag="mCG_21060"
FT                   /product="RIKEN cDNA 1810029B16, transcript variant
FT                   mCT19617"
FT                   /note="gene_id=mCG21060.2 transcript_id=mCT19617.2 created
FT                   on 10-JUN-2002"
FT   mRNA            complement(join(10958314..10958767,10959873..10959915,
FT                   10962206..10962354,10963329..10963413,10964372..10964465,
FT                   10965923..10966035,10968285..>10968377))
FT                   /gene="1810029B16Rik"
FT                   /locus_tag="mCG_21060"
FT                   /product="RIKEN cDNA 1810029B16, transcript variant
FT                   mCT169999"
FT                   /note="gene_id=mCG21060.2 transcript_id=mCT169999.0 created
FT                   on 10-JUN-2002"
FT   CDS             complement(join(10958533..10958767,10959873..10959915,
FT                   10962206..10962354,10963329..10963413,10964372..10964409,
FT                   10965923..10966035,10968285..10968287))
FT                   /codon_start=1
FT                   /gene="1810029B16Rik"
FT                   /locus_tag="mCG_21060"
FT                   /product="RIKEN cDNA 1810029B16, isoform CRA_b"
FT                   /note="gene_id=mCG21060.2 transcript_id=mCT19617.2
FT                   protein_id=mCP16757.1 isoform=CRA_b"
FT                   /protein_id="EDL28694.1"
FT                   /translation="MPKGLKGKMVGREKKVIHPYSRKAAQITRESHKQDKKERLKTEKA
FT                   LRLNLIGDKLQWFHSHLDMKKTRYSKKDACELVERYLDRFSSELEQIELQNSIKDRQGR
FT                   RHHSREAVIKQTLERERQQYEGYGFEIPDILDSNTLQTFREWDFDLKKLPNIKMRKLCA
FT                   DDAVPKKRKQKNILNIEKDLGELELSGPTGATTDGKLEPASESSDTDEEMTPVPVSPH"
FT   CDS             complement(join(10958533..10958767,10959873..10959915,
FT                   10962206..10962354,10963329..10963413,10964372..10964465,
FT                   10965923..>10965973))
FT                   /codon_start=1
FT                   /gene="1810029B16Rik"
FT                   /locus_tag="mCG_21060"
FT                   /product="RIKEN cDNA 1810029B16, isoform CRA_a"
FT                   /note="gene_id=mCG21060.2 transcript_id=mCT169999.0
FT                   protein_id=mCP92753.0 isoform=CRA_a"
FT                   /protein_id="EDL28693.1"
FT                   /translation="KSSSDYKRVSQTRQEGKISKLLLWKISNFSAPFGSRLKTEKALRL
FT                   NLIGDKLQWFHSHLDMKKTRYSKKDACELVERYLDRFSSELEQIELQNSIKDRQGRRHH
FT                   SREAVIKQTLERERQQYEGYGFEIPDILDSNTLQTFREWDFDLKKLPNIKMRKLCADDA
FT                   VPKKRKQKNILNIEKDLGELELSGPTGATTDGKLEPASESSDTDEEMTPVPVSPH"
FT   gene            <10976891..10978778
FT                   /locus_tag="mCG_144779"
FT                   /note="gene_id=mCG144779.0"
FT   mRNA            join(<10976891..10977057,10977218..10977303,
FT                   10977611..10978778)
FT                   /locus_tag="mCG_144779"
FT                   /product="mCG144779"
FT                   /note="gene_id=mCG144779.0 transcript_id=mCT184203.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<10977281..10977303,10977611..10977845)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144779"
FT                   /product="mCG144779"
FT                   /note="gene_id=mCG144779.0 transcript_id=mCT184203.0
FT                   protein_id=mCP105390.0"
FT                   /protein_id="EDL28695.1"
FT                   /translation="KWTKPLNRNQVFSFVLQKKFQTDHICILPGESKNRKVIQSGLREE
FT                   NTGESPPSAGRELETARVQYRSCHLPPSSAASALLPHPLI"
FT   gene            <10993585..10995605
FT                   /gene="Tktl2"
FT                   /locus_tag="mCG_51526"
FT                   /note="gene_id=mCG51526.1"
FT   mRNA            <10993585..10995605
FT                   /gene="Tktl2"
FT                   /locus_tag="mCG_51526"
FT                   /product="transketolase-like 2"
FT                   /note="gene_id=mCG51526.1 transcript_id=mCT51709.2 created
FT                   on 10-JUN-2002"
FT   CDS             <10993587..10995506
FT                   /codon_start=1
FT                   /gene="Tktl2"
FT                   /locus_tag="mCG_51526"
FT                   /product="transketolase-like 2"
FT                   /note="gene_id=mCG51526.1 transcript_id=mCT51709.2
FT                   protein_id=mCP37589.1"
FT                   /protein_id="EDL28696.1"
FT                   /translation="LALRTAAELPAAMALARDAKLESDTFQVLQDVANRLRIHSIRATC
FT                   ACSSGHPTSCCSVAEIMAVLFFHTMRYKQADPEHPDNDRFVLSKGHAAPILYAVWVEVG
FT                   RICESDLLNLRKIHCDLEGHPTPRLSFVDVATGSLGQGLGAACGMAYTGKYFDKASYRV
FT                   FCLMGDGESSEGSVWEALAFASHYNLDNLVAIFDVNRLGQSGTAPLEHCTAVYEKRCQA
FT                   FGWNTYVVDGHDVEALCQAFWKAAQVKNKPTALIAKTFKGRGIPNVEDAENWHGKPIPK
FT                   DRADGIVKLIENRIQTNRNLTPKPPIEDSPRISMSNTKMTSLPVYKLGDMIATREAYGL
FT                   ALAKLGQSNQRVIVLDGDTKNSTFSEVFKKEHPERFIECFIAEQNMVSVALGCATRGRT
FT                   IAFVSTFAAFLTRAFDQIRMGAISQTNINFVGSHCGVSVGEDGPSQMALEDLAMFRSIP
FT                   NCTVFYPSDAVSTEHAVYLAANTKGMCFIRTTRPKTAVIYTAEENFVIGQAKVIRQSAV
FT                   DKVTVIGAGVTLHEALVAAEELSQQGIFIRVIDLFTIKPLDAVTIIQSAKATGGQIITV
FT                   EDHYREGGIGEAVCAAISREPDIVVRQLAVTEVPRSGKPSELLDMFGISARHIIAAVKD
FT                   TVMK"
FT   gene            complement(11159879..11168008)
FT                   /gene="Npy5r"
FT                   /locus_tag="mCG_21059"
FT                   /note="gene_id=mCG21059.1"
FT   mRNA            complement(join(11159879..11162060,11167877..11168008))
FT                   /gene="Npy5r"
FT                   /locus_tag="mCG_21059"
FT                   /product="neuropeptide Y receptor Y5, transcript variant
FT                   mCT19616"
FT                   /note="gene_id=mCG21059.1 transcript_id=mCT19616.1 created
FT                   on 10-JUN-2002"
FT   mRNA            complement(join(<11160651..11162063,11167877..11167948))
FT                   /gene="Npy5r"
FT                   /locus_tag="mCG_21059"
FT                   /product="neuropeptide Y receptor Y5, transcript variant
FT                   mCT169998"
FT                   /note="gene_id=mCG21059.1 transcript_id=mCT169998.0 created
FT                   on 10-JUN-2002"
FT   CDS             complement(11160651..11162051)
FT                   /codon_start=1
FT                   /gene="Npy5r"
FT                   /locus_tag="mCG_21059"
FT                   /product="neuropeptide Y receptor Y5, isoform CRA_a"
FT                   /note="gene_id=mCG21059.1 transcript_id=mCT169998.0
FT                   protein_id=mCP92755.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q543U8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000393"
FT                   /db_xref="InterPro:IPR000611"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:108082"
FT                   /db_xref="UniProtKB/TrEMBL:Q543U8"
FT                   /protein_id="EDL28697.1"
FT                   /translation="MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARN
FT                   TAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNL
FT                   AFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHM
FT                   IKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVES
FT                   WPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLH
FT                   PSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVR
FT                   SQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAV
FT                   SWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRA
FT                   LIHCLHMS"
FT   CDS             complement(11160651..11162051)
FT                   /codon_start=1
FT                   /gene="Npy5r"
FT                   /locus_tag="mCG_21059"
FT                   /product="neuropeptide Y receptor Y5, isoform CRA_a"
FT                   /note="gene_id=mCG21059.1 transcript_id=mCT19616.1
FT                   protein_id=mCP16756.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q543U8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000393"
FT                   /db_xref="InterPro:IPR000611"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:108082"
FT                   /db_xref="UniProtKB/TrEMBL:Q543U8"
FT                   /protein_id="EDL28698.1"
FT                   /translation="MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARN
FT                   TAFPVWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNL
FT                   AFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHM
FT                   IKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVES
FT                   WPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLH
FT                   PSKKSRDQAKPPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVR
FT                   SQLSPSSKVIPGVPICFEVKPEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAV
FT                   SWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRA
FT                   LIHCLHMS"
FT   gene            11177368..11186008
FT                   /gene="Npy1r"
FT                   /locus_tag="mCG_115236"
FT                   /note="gene_id=mCG115236.1"
FT   mRNA            join(11177368..11177434,11183679..11184521,
FT                   11184632..11186008)
FT                   /gene="Npy1r"
FT                   /locus_tag="mCG_115236"
FT                   /product="neuropeptide Y receptor Y1, transcript variant
FT                   mCT169988"
FT                   /note="gene_id=mCG115236.1 transcript_id=mCT169988.0
FT                   created on 19-JUN-2003"
FT   mRNA            join(11181353..11181432,11183679..11184521,
FT                   11184632..11186008)
FT                   /gene="Npy1r"
FT                   /locus_tag="mCG_115236"
FT                   /product="neuropeptide Y receptor Y1, transcript variant
FT                   mCT169989"
FT                   /note="gene_id=mCG115236.1 transcript_id=mCT169989.0
FT                   created on 19-JUN-2003"
FT   CDS             join(11183826..11184521,11184632..11185084)
FT                   /codon_start=1
FT                   /gene="Npy1r"
FT                   /locus_tag="mCG_115236"
FT                   /product="neuropeptide Y receptor Y1, isoform CRA_a"
FT                   /note="gene_id=mCG115236.1 transcript_id=mCT169988.0
FT                   protein_id=mCP92781.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V1K5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000351"
FT                   /db_xref="InterPro:IPR000611"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:104963"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V1K5"
FT                   /protein_id="EDL28699.1"
FT                   /translation="MNSTLFSKVENHSIHYNASENSPLLAFENDDCHLPLAVIFTLALA
FT                   YGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDH
FT                   WVFGETMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYIGITVIWV
FT                   LAVASSLPFVIYQILTDEPFQNVSLAAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGP
FT                   LCFIFICYFKIYIRLKRRNNMMDKIRDSKYRSSETKRINIMLLSIVVAFAVCWLPLTIF
FT                   NTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFR
FT                   SRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKISMNDNEKV"
FT   CDS             join(11183826..11184521,11184632..11185084)
FT                   /codon_start=1
FT                   /gene="Npy1r"
FT                   /locus_tag="mCG_115236"
FT                   /product="neuropeptide Y receptor Y1, isoform CRA_a"
FT                   /note="gene_id=mCG115236.1 transcript_id=mCT169989.0
FT                   protein_id=mCP92736.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V1K5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000351"
FT                   /db_xref="InterPro:IPR000611"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:104963"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V1K5"
FT                   /protein_id="EDL28700.1"
FT                   /translation="MNSTLFSKVENHSIHYNASENSPLLAFENDDCHLPLAVIFTLALA
FT                   YGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDH
FT                   WVFGETMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYIGITVIWV
FT                   LAVASSLPFVIYQILTDEPFQNVSLAAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGP
FT                   LCFIFICYFKIYIRLKRRNNMMDKIRDSKYRSSETKRINIMLLSIVVAFAVCWLPLTIF
FT                   NTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFR
FT                   SRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKISMNDNEKV"
FT   gene            <11260067..11275545
FT                   /locus_tag="mCG_140546"
FT                   /note="gene_id=mCG140546.0"
FT   mRNA            join(<11260067..11260264,11274378..11274545,
FT                   11275311..11275545)
FT                   /locus_tag="mCG_140546"
FT                   /product="mCG140546"
FT                   /note="gene_id=mCG140546.0 transcript_id=mCT169990.0
FT                   created on 10-JUN-2002"
FT   CDS             join(<11260207..11260264,11274378..11274545,
FT                   11275311..11275405)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140546"
FT                   /product="mCG140546"
FT                   /note="gene_id=mCG140546.0 transcript_id=mCT169990.0
FT                   protein_id=mCP92762.0"
FT                   /protein_id="EDL28701.1"
FT                   /translation="NIQEQVSPGSWRYSDQATSGTLGPPHLLPGTDSDFAACSFLSLYG
FT                   DFSIFHFLYRKTTIIVMKTCLHRVHWEKEGDQDIDLSAPSPAPCLPGCWQASHHDDDGL
FT                   HL"
FT   gene            11331366..11375939
FT                   /locus_tag="mCG_52162"
FT                   /note="gene_id=mCG52162.2"
FT   mRNA            join(11331366..11332128,11345748..11346410,
FT                   11349902..11350064,11363041..11363134,11364973..11365055,
FT                   11368818..11368978,11371140..11371191,11373148..11373250,
FT                   11374437..11375939)
FT                   /locus_tag="mCG_52162"
FT                   /product="mCG52162"
FT                   /note="gene_id=mCG52162.2 transcript_id=mCT52345.2 created
FT                   on 10-JUN-2002"
FT   CDS             join(11332001..11332128,11345748..11346410,
FT                   11349902..11350064,11363041..11363134,11364973..11365055,
FT                   11368818..11368978,11371140..11371191,11373148..11373250,
FT                   11374437..11374939)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52162"
FT                   /product="mCG52162"
FT                   /note="gene_id=mCG52162.2 transcript_id=mCT52345.2
FT                   protein_id=mCP37592.2 partial"
FT                   /protein_id="EDL28702.1"
FT                   /translation="MGLIIITEEAGRISTMTTGIMMAGAMTTITEGTVVEVGSGPHQSV
FT                   RVRLPEKRAGFSVAELASLASEETLALLCGPGGAMEVVEAAAQLQTLKFGGSGQGSAAP
FT                   QPPEDRREAPPPGVQPPPPAPNSDPGGRPPPPPAPNSDPGGRPPPPPAPNSDPGGRPPP
FT                   LPAPNSDPGGRPPPPPAPNSDPGGRPPPPPAPNSDAGGRPPPPPAPNSDPGGRPTPPLP
FT                   ALNWDAGGRPPPPGGAWVTGRNAAEPPPVLQASDSSDSDSDSETDSDSSSSSSSSSSSS
FT                   SSCVSFPPVLSDGDEDFQLEKENKNFPLKTKDELLLNELPSVEELTVILPEDIALKPLG
FT                   KVSSIIEQLVIIESVTNIPPVNEDTVIFKSDRQAAGKIFEIFGPVAHPFYVLRFNSSDH
FT                   IESKGIKINDTMYFAPSMKDFTQYIFTEKLKQDRGSDASWKNDQEPPPEVLDFSDDEKE
FT                   KEAKQRKKSQIQGRKKLKSELNESGEDFGEVHENWNAYSSSEHSKGYHHREFSRGFARG
FT                   RYSRRSHGRPPPQQYYNSDHMASQESLGFTPQRQDNPVMPHYPFPPPMFDMHNFXXXXX
FT                   XXPRLRPHQAWGGLHLAWPLILCLTYHTPCPHHLFLHHLHLPLPLLGKIILLILGLIFS
FT                   CMLVFQRNMIKKKI"
FT   gene            complement(11536404..11536917)
FT                   /pseudo
FT                   /locus_tag="mCG_50139"
FT                   /note="gene_id=mCG50139.1"
FT   mRNA            complement(11536404..11536917)
FT                   /pseudo
FT                   /locus_tag="mCG_50139"
FT                   /note="gene_id=mCG50139.1 transcript_id=mCT50322.2 created
FT                   on 10-JUN-2002"
FT   gene            complement(11831093..11843892)
FT                   /locus_tag="mCG_140550"
FT                   /note="gene_id=mCG140550.1"
FT   mRNA            complement(join(11831093..11831842,11836284..11836453,
FT                   11839586..11839747,11843758..11843892))
FT                   /locus_tag="mCG_140550"
FT                   /product="mCG140550"
FT                   /note="gene_id=mCG140550.1 transcript_id=mCT170003.1
FT                   created on 18-JUN-2003"
FT   CDS             complement(join(11831595..11831842,11836284..11836383))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140550"
FT                   /product="mCG140550"
FT                   /note="gene_id=mCG140550.1 transcript_id=mCT170003.1
FT                   protein_id=mCP92737.1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C1Z1"
FT                   /protein_id="EDL28703.1"
FT                   /translation="MRYDHPPDNGFKRYRTDSETVPRHFAPVSRTLRGLNRYKNMEIFQ
FT                   CILSDHHGIRLIFNNNINNGKPTFTWKMINTLLNDTLVKEGIKKEIKDFLEFNENEVTT
FT                   YPNLWDTMKAF"
FT   gene            11969970..11971316
FT                   /gene="Nat1"
FT                   /locus_tag="mCG_5308"
FT                   /note="gene_id=mCG5308.0"
FT   mRNA            11969970..11971316
FT                   /gene="Nat1"
FT                   /locus_tag="mCG_5308"
FT                   /product="N-acetyltransferase 1 (arylamine
FT                   N-acetyltransferase)"
FT                   /note="gene_id=mCG5308.0 transcript_id=mCT4318.0 created on
FT                   12-JUN-2002"
FT   CDS             11970186..11971058
FT                   /codon_start=1
FT                   /gene="Nat1"
FT                   /locus_tag="mCG_5308"
FT                   /product="N-acetyltransferase 1 (arylamine
FT                   N-acetyltransferase)"
FT                   /note="gene_id=mCG5308.0 transcript_id=mCT4318.0
FT                   protein_id=mCP16746.1"
FT                   /db_xref="GOA:Q546L3"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="MGI:MGI:97279"
FT                   /db_xref="UniProtKB/TrEMBL:Q546L3"
FT                   /protein_id="EDL28704.1"
FT                   /translation="MDIEAYFERIGYKNSVNKLDLATLTEVLQHQMRAVPFENLNMHCG
FT                   EAMHLDLQDIFDHIVRKKRGGWCLQVNHLLYWALTKMGFETTMLGGYVYITPVSKYSSE
FT                   MVHLLVQVTISDRKYIVDSAYGGSYQMWEPLELTSGKDQPQVPAIFLLTEENGTWYLDQ
FT                   IRREQYVPNEEFVNSDLLEKNKYRKIYSFTLEPRVIEDFEYVNSYLQTSPASVFVSTSF
FT                   CSLQTSEGVHCLVGSTFTSRRFSYKDDVDLVEFKYVNEEEIEDVLKTAFGISLERKFVP
FT                   KHGELVFTI"
FT   gene            11974078..11981788
FT                   /gene="Nat2"
FT                   /locus_tag="mCG_5309"
FT                   /note="gene_id=mCG5309.1"
FT   mRNA            join(11974078..11974114,11980446..11981788)
FT                   /gene="Nat2"
FT                   /locus_tag="mCG_5309"
FT                   /product="N-acetyltransferase 2 (arylamine
FT                   N-acetyltransferase), transcript variant mCT170001"
FT                   /note="gene_id=mCG5309.1 transcript_id=mCT170001.0 created
FT                   on 12-JUN-2002"
FT   mRNA            join(11974160..11974285,11980446..11981782)
FT                   /gene="Nat2"
FT                   /locus_tag="mCG_5309"
FT                   /product="N-acetyltransferase 2 (arylamine
FT                   N-acetyltransferase), transcript variant mCT170002"
FT                   /note="gene_id=mCG5309.1 transcript_id=mCT170002.0 created
FT                   on 12-JUN-2002"
FT   mRNA            11980236..11981553
FT                   /gene="Nat2"
FT                   /locus_tag="mCG_5309"
FT                   /product="N-acetyltransferase 2 (arylamine
FT                   N-acetyltransferase), transcript variant mCT4319"
FT                   /note="gene_id=mCG5309.1 transcript_id=mCT4319.1 created on
FT                   12-JUN-2002"
FT   CDS             11980452..11981324
FT                   /codon_start=1
FT                   /gene="Nat2"
FT                   /locus_tag="mCG_5309"
FT                   /product="N-acetyltransferase 2 (arylamine
FT                   N-acetyltransferase), isoform CRA_a"
FT                   /note="gene_id=mCG5309.1 transcript_id=mCT170001.0
FT                   protein_id=mCP92750.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q78ZC4"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="MGI:MGI:109201"
FT                   /db_xref="UniProtKB/TrEMBL:Q78ZC4"
FT                   /protein_id="EDL28705.1"
FT                   /translation="MDIEAYFERIGYQSTRSKLDLKTLTEILQHQIRAIPFENLNIHCG
FT                   ESMELSLEAIFDQIVRKKRGGWCLQVNHLLYWALTKLGFETTMLGGYVFNTPANKYSSG
FT                   MIHLLVQVTISGKDYIVDAGFGRSYQMWEPLELTSGKDQPQVPAIFRLTEENGTWYLDQ
FT                   IRREQYVPNQEFINSDLLEKNKYRKIYSFTLEPRTIEDFESMNTYLQTSPASVFTSKSF
FT                   CSLQTPEGVHCLVGSTLTYRRFSYKDNVDLVEFKSLTEEEIEDVLRTIFGVSLERKLVP
FT                   KHGDRFFTI"
FT   CDS             11980452..11981324
FT                   /codon_start=1
FT                   /gene="Nat2"
FT                   /locus_tag="mCG_5309"
FT                   /product="N-acetyltransferase 2 (arylamine
FT                   N-acetyltransferase), isoform CRA_a"
FT                   /note="gene_id=mCG5309.1 transcript_id=mCT170002.0
FT                   protein_id=mCP92745.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q78ZC4"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="MGI:MGI:109201"
FT                   /db_xref="UniProtKB/TrEMBL:Q78ZC4"
FT                   /protein_id="EDL28706.1"
FT                   /translation="MDIEAYFERIGYQSTRSKLDLKTLTEILQHQIRAIPFENLNIHCG
FT                   ESMELSLEAIFDQIVRKKRGGWCLQVNHLLYWALTKLGFETTMLGGYVFNTPANKYSSG
FT                   MIHLLVQVTISGKDYIVDAGFGRSYQMWEPLELTSGKDQPQVPAIFRLTEENGTWYLDQ
FT                   IRREQYVPNQEFINSDLLEKNKYRKIYSFTLEPRTIEDFESMNTYLQTSPASVFTSKSF
FT                   CSLQTPEGVHCLVGSTLTYRRFSYKDNVDLVEFKSLTEEEIEDVLRTIFGVSLERKLVP
FT                   KHGDRFFTI"
FT   CDS             11980452..11981324
FT                   /codon_start=1
FT                   /gene="Nat2"
FT                   /locus_tag="mCG_5309"
FT                   /product="N-acetyltransferase 2 (arylamine
FT                   N-acetyltransferase), isoform CRA_a"
FT                   /note="gene_id=mCG5309.1 transcript_id=mCT4319.1
FT                   protein_id=mCP16745.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q78ZC4"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="MGI:MGI:109201"
FT                   /db_xref="UniProtKB/TrEMBL:Q78ZC4"
FT                   /protein_id="EDL28707.1"
FT                   /translation="MDIEAYFERIGYQSTRSKLDLKTLTEILQHQIRAIPFENLNIHCG
FT                   ESMELSLEAIFDQIVRKKRGGWCLQVNHLLYWALTKLGFETTMLGGYVFNTPANKYSSG
FT                   MIHLLVQVTISGKDYIVDAGFGRSYQMWEPLELTSGKDQPQVPAIFRLTEENGTWYLDQ
FT                   IRREQYVPNQEFINSDLLEKNKYRKIYSFTLEPRTIEDFESMNTYLQTSPASVFTSKSF
FT                   CSLQTPEGVHCLVGSTLTYRRFSYKDNVDLVEFKSLTEEEIEDVLRTIFGVSLERKLVP
FT                   KHGDRFFTI"
FT   gene            complement(11993215..11994881)
FT                   /locus_tag="mCG_1048875"
FT                   /note="gene_id=mCG1048875.1"
FT   mRNA            complement(11993215..11994881)
FT                   /locus_tag="mCG_1048875"
FT                   /product="mCG1048875, transcript variant mCT166579"
FT                   /note="gene_id=mCG1048875.1 transcript_id=mCT166579.1
FT                   created on 12-JUN-2002"
FT   mRNA            complement(join(11993216..11993299,11993336..>11993878))
FT                   /locus_tag="mCG_1048875"
FT                   /product="mCG1048875, transcript variant mCT169983"
FT                   /note="gene_id=mCG1048875.1 transcript_id=mCT169983.0
FT                   created on 12-JUN-2002"
FT   mRNA            complement(join(11993219..11993775,11993977..>11994051))
FT                   /locus_tag="mCG_1048875"
FT                   /product="mCG1048875, transcript variant mCT169984"
FT                   /note="gene_id=mCG1048875.1 transcript_id=mCT169984.0
FT                   created on 12-JUN-2002"
FT   CDS             complement(11993447..11994805)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048875"
FT                   /product="mCG1048875, isoform CRA_c"
FT                   /note="gene_id=mCG1048875.1 transcript_id=mCT166579.1
FT                   protein_id=mCP54088.0 isoform=CRA_c"
FT                   /db_xref="GOA:D3YVN7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:3642279"
FT                   /db_xref="UniProtKB/TrEMBL:D3YVN7"
FT                   /protein_id="EDL28710.1"
FT                   /translation="MAAATLLRATPRFSGLCASPTPFLQGRLRPLKAPASPFLCRGLAV
FT                   EAKKTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERAR
FT                   GITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDSPMPQTRE
FT                   HLLLAKQIGVEHVVVYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALC
FT                   ALEQRDPELGVKSVQKLLDAVDTYIPVPTRDLDKPFLLPVESVYSIPGRGTVVTGTLER
FT                   GILKKGDECELLGHNKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVM
FT                   VKPGSIQPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRVILPPGKELAM
FT                   PGEDLKLSLILRQPMILEKGQRFTLRDGNKTIGTGLVTDVPAMTEEDKNIKWS"
FT   CDS             complement(join(11993447..11993775,11993977..>11994049))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048875"
FT                   /product="mCG1048875, isoform CRA_d"
FT                   /note="gene_id=mCG1048875.1 transcript_id=mCT169984.0
FT                   protein_id=mCP92735.0 isoform=CRA_d"
FT                   /protein_id="EDL28711.1"
FT                   /translation="DLDKPFLLPVESVYSIPGRGTVVTGSIQPHQKVEAQVYILSKEEG
FT                   GRHKPFVSHFMPVMFSLTWDMACRVILPPGKELAMPGEDLKLSLILRQPMILEKGQRFT
FT                   LRDGNKTIGTGLVTDVPAMTEEDKNIKWS"
FT   CDS             complement(11993447..>11993878)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048875"
FT                   /product="mCG1048875, isoform CRA_a"
FT                   /note="gene_id=mCG1048875.1 transcript_id=mCT169983.0
FT                   protein_id=mCP92776.0 isoform=CRA_a"
FT                   /protein_id="EDL28708.1"
FT                   /translation="HKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIQPHQKVEA
FT                   QVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRVILPPGKELAMPGEDLKLSLILRQP
FT                   MILEKGQRFTLRDGNKTIGTGLVTDVPAMTEEDKNIKWS"
FT   mRNA            complement(join(<11993694..11994012,11994101..>11994195))
FT                   /locus_tag="mCG_1048875"
FT                   /product="mCG1048875, transcript variant mCT169985"
FT                   /note="gene_id=mCG1048875.1 transcript_id=mCT169985.0
FT                   created on 12-JUN-2002"
FT   CDS             complement(join(<11993694..11994012,11994101..>11994116))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048875"
FT                   /product="mCG1048875, isoform CRA_b"
FT                   /note="gene_id=mCG1048875.1 transcript_id=mCT169985.0
FT                   protein_id=mCP92767.0 isoform=CRA_b"
FT                   /protein_id="EDL28709.1"
FT                   /translation="ARREVIYSIPGRGTVVTGTLERGILKKGDECELLGHNKNIRTVVT
FT                   GIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIQPHQKVEAQVYILSKEE
FT                   GGRHKPFV"
FT   gene            12003182..12028008
FT                   /gene="Nat3"
FT                   /locus_tag="mCG_5307"
FT                   /note="gene_id=mCG5307.1"
FT   mRNA            join(12003182..12003250,12003340..12003502,
FT                   12026849..12028008)
FT                   /gene="Nat3"
FT                   /locus_tag="mCG_5307"
FT                   /product="N-acetyltransferase 3"
FT                   /note="gene_id=mCG5307.1 transcript_id=mCT170000.0 created
FT                   on 19-JUN-2003"
FT   CDS             join(12003356..12003502,12026849..12027727)
FT                   /codon_start=1
FT                   /gene="Nat3"
FT                   /locus_tag="mCG_5307"
FT                   /product="N-acetyltransferase 3"
FT                   /note="gene_id=mCG5307.1 transcript_id=mCT170000.0
FT                   protein_id=mCP92766.0"
FT                   /protein_id="EDL28712.1"
FT                   /translation="MNKRCRRATRVAVLQPLVTGTISLQGPRHERRVADGQAVAVRRLE
FT                   RTQLGTMDIEAYFERIGYQKSSNKLDLQTLTEILQHQIRAIPFENLNIHCGKTMELSLE
FT                   DTFHQIVRKKRGGWCLQVNHLLYWALAMIGFETTMLGGCVYVPSACKYSNTMIHLLLQV
FT                   TISGKTYIVDSAFPFSCQLWEPLELTSGKDQPQVPAIFHLREENGTWYLEQTKRQEYVS
FT                   NQEFIDSNFLEKNTHRKIYSFTLEPRTIEDFWSISTYYQVSRTSVMTNTSLCSLHTKDG
FT                   VHGLMGTILAYKKFNYKDNIDLVEFKTLKEEEIEEVLKSVFGIHLETKLVPKCGNVFFT
FT                   I"
FT   gene            complement(12065018..12065302)
FT                   /pseudo
FT                   /locus_tag="mCG_1048894"
FT                   /note="gene_id=mCG1048894.1"
FT   mRNA            complement(12065018..12065302)
FT                   /pseudo
FT                   /locus_tag="mCG_1048894"
FT                   /note="gene_id=mCG1048894.1 transcript_id=mCT166598.1
FT                   created on 13-JUN-2002"
FT   gene            complement(12158904..12530524)
FT                   /gene="4931420C21Rik"
FT                   /locus_tag="mCG_145698"
FT                   /note="gene_id=mCG145698.0"
FT   mRNA            complement(join(12158904..12166852,12183350..12183493,
FT                   12189567..12189711,12190463..12190620,12211501..12211571,
FT                   12227933..12228126,12260432..12260475,12353040..12353129,
FT                   12374224..12374282,12376366..12376478,12378593..12378673,
FT                   12378790..12378996,12430575..12430967,12433477..12434542,
FT                   12470891..12470999,12530394..12530524))
FT                   /gene="4931420C21Rik"
FT                   /locus_tag="mCG_145698"
FT                   /product="RIKEN cDNA 4931420C21, transcript variant
FT                   mCT185239"
FT                   /note="gene_id=mCG145698.0 transcript_id=mCT185239.0
FT                   created on 13-JUN-2003"
FT   CDS             complement(join(12166637..12166852,12183350..12183493,
FT                   12189567..12189711,12190463..12190620,12211501..12211571,
FT                   12227933..12228126,12260432..12260475,12353040..12353129,
FT                   12374224..12374282,12376366..12376478,12378593..12378673,
FT                   12378790..12378996,12430575..12430967,12433477..12434542,
FT                   12470891..12470999,12530394..12530414))
FT                   /codon_start=1
FT                   /gene="4931420C21Rik"
FT                   /locus_tag="mCG_145698"
FT                   /product="RIKEN cDNA 4931420C21, isoform CRA_a"
FT                   /note="gene_id=mCG145698.0 transcript_id=mCT185239.0
FT                   protein_id=mCP106497.0 isoform=CRA_a"
FT                   /protein_id="EDL28713.1"
FT                   /translation="MEGRNAAAEPFVWVNSASAHSQSVAKAKYEFLFGKSEEKTPDSSD
FT                   HGGSTLLPPTVTNEFPEYGTMEEGGEGLRASLDFDAKSPPCRLPGQQAVHLLAGQDSIL
FT                   NSVTEGPNDAPQCHPQEQSLQPIDSLISALKATEARIASGTFQATKVLDKDANFSVYQV
FT                   DKELSTASHKPQRAHRTFPVGPGKSPDIPLSAEVPTEENLSLHIQEDLSALLPEEAQAH
FT                   RSQITNYRRQGPLRVPESACPVSSSSAGSHNPVDRVGALREQRSDLGREHPRGYDRGGS
FT                   MGRQGRIKHVEFQGVEILWTGEEAESRHPPERTASPVSKEFAKRPSHSSPACGVCSTST
FT                   HLTGDVWDETCKAPSERPGTSAGTLSPMPLGESGEDDVFLRESKEHLEENFAIQGDKER
FT                   ILDQEEHLRGDDDILGPGYTEDSTDVYSSQFETILDNTSLYYSAESLETLYSEPDSYFS
FT                   FEMPLTPMIQQRIKEGGQFLERTSVGGQHDVLSVSADGGIVMGYSAGITNGLHDSANSV
FT                   YTRGPQEIAFWGSRDRCFAEGKTTGVDAGSEMGSTDILEKETTESLSNGTNSNVEAAKR
FT                   LAKRLYHLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFLKAFSLV
FT                   GETQERERVLIHFSNRYFSCNPDTITSKDGVHCLTCAMMLLNTDLHGHNIGKKMTCQEF
FT                   ITNLQGVNEGGDFSKDLLKALYNSIKNEKLEWAVDDEEKKKSPSEGTDEKANGTHPKTI
FT                   SRIGSTTNPFLDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVL
FT                   YLQKDEYKPEKSLSDEDLKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSP
FT                   EEMQGWINKINCVAAVFSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQ
FT                   ITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTRYEIYVSVLKEGGKELLTTDGN
FT                   EPVGLKKSHSSPSLNPDASPVTAKVKRNVSERKDHRPETPGIKQKVT"
FT   mRNA            complement(join(12373755..12374282,12376366..12376403,
FT                   12378593..12378673,12378790..12378996,12421838..>12422032))
FT                   /gene="4931420C21Rik"
FT                   /locus_tag="mCG_145698"
FT                   /product="RIKEN cDNA 4931420C21, transcript variant
FT                   mCT185238"
FT                   /note="gene_id=mCG145698.0 transcript_id=mCT185238.0
FT                   created on 13-JUN-2003"
FT   CDS             complement(join(12374206..12374282,12376366..12376403,
FT                   12378593..12378673,12378790..12378996,12421838..>12421890))
FT                   /codon_start=1
FT                   /gene="4931420C21Rik"
FT                   /locus_tag="mCG_145698"
FT                   /product="RIKEN cDNA 4931420C21, isoform CRA_b"
FT                   /note="gene_id=mCG145698.0 transcript_id=mCT185238.0
FT                   protein_id=mCP106496.0 isoform=CRA_b"
FT                   /protein_id="EDL28714.1"
FT                   /translation="QLGVRNESYFLFISILNSRDRCFAEGKTTGVDAGSEMGSTDILEK
FT                   ETTESLSNGTNSNVEAAKRLAKRLYHLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDF
FT                   TGMTLDQSLRYFSCNPDTITSKDGVHCLTCAMMLLNTDLHGHVSVCL"
FT   gene            <12548112..12562187
FT                   /locus_tag="mCG_1048989"
FT                   /note="gene_id=mCG1048989.0"
FT   mRNA            join(<12548112..12548565,12562152..12562187)
FT                   /locus_tag="mCG_1048989"
FT                   /product="mCG1048989"
FT                   /note="gene_id=mCG1048989.0 transcript_id=mCT166693.0
FT                   created on 13-JUN-2002"
FT   CDS             <12548209..12548358
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048989"
FT                   /product="mCG1048989"
FT                   /note="gene_id=mCG1048989.0 transcript_id=mCT166693.0
FT                   protein_id=mCP54124.0"
FT                   /protein_id="EDL28715.1"
FT                   /translation="RHAPSLTPDCHFFSLLAHSIVSNLVQQYLSSHVLVSRTVVLNLPN
FT                   SETL"
FT   gene            12744795..12818443
FT                   /locus_tag="mCG_16915"
FT                   /note="gene_id=mCG16915.2"
FT   mRNA            join(12744795..12745115,12750478..12750856,
FT                   12762755..12762911,12765100..12765271,12800050..12800158,
FT                   12801836..12802036,12816702..12816922,12817403..12818443)
FT                   /locus_tag="mCG_16915"
FT                   /product="mCG16915"
FT                   /note="gene_id=mCG16915.2 transcript_id=mCT14696.2 created
FT                   on 13-JUN-2002"
FT   CDS             join(12750676..12750856,12762755..12762911,
FT                   12765100..12765271,12800050..12800158,12801836..12802036,
FT                   12816702..12816922,12817403..12817495)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16915"
FT                   /product="mCG16915"
FT                   /note="gene_id=mCG16915.2 transcript_id=mCT14696.2
FT                   protein_id=mCP16749.2"
FT                   /protein_id="EDL28716.1"
FT                   /translation="MLRQILSDMFIDPDLLAELSEEQKQILFYKMREEQIRRWKEREAA
FT                   MERKESLPVKSRPKKENGKSVHWKLGADKQVWVWVMGEHHLDKPYDVLCDEILAEREHL
FT                   RAAKDSELRKTQSLELANSLKIKSQNCDLQAMKKTEPQNVTRKAASEEASGQGPRAIPT
FT                   RKDDKAQTKPVKEKDHEEMKQTEDEKTKQIYKSWKEDSEWQASLRKSKAADEKRRSLAK
FT                   QAREDYKRLSQRGRSGDGLQNPLTGPQKPRRPPLPPKPQFLQPLGIPPKSLGILTLKKA
FT                   NELLSTGVPGSFLIRVSEKIKGYALSYLSEEGCKHFLIDASANSYSFLGVDQLQHATLA
FT                   DLVEYHKEEPITSLGKELLLYPCGQQDKLPDYLELFQ"
FT   gene            complement(12828517..>12931865)
FT                   /locus_tag="mCG_16912"
FT                   /note="gene_id=mCG16912.1"
FT   mRNA            complement(join(12828517..12829452,12832807..12832888,
FT                   12843284..12843378,12844203..12844381,12859429..12859530,
FT                   12872064..12872280,12931238..>12931865))
FT                   /locus_tag="mCG_16912"
FT                   /product="mCG16912"
FT                   /note="gene_id=mCG16912.1 transcript_id=mCT14694.2 created
FT                   on 13-JUN-2002"
FT   CDS             complement(join(12829163..12829452,12832807..12832888,
FT                   12843284..12843378,12844203..12844381,12859429..12859530,
FT                   12872064..12872280,12931238..12931865))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16912"
FT                   /product="mCG16912"
FT                   /note="gene_id=mCG16912.1 transcript_id=mCT14694.2
FT                   protein_id=mCP16771.2"
FT                   /protein_id="EDL28717.1"
FT                   /translation="MVRRGLLGWISRVVILLVLLCCAISVLYMLACTPKGDQEQLGLPR
FT                   ANGPTGKDGYQAVLQEREEQHRNYVNSLKRQIAQLKDELQARSEQFRSGQDQASDATSL
FT                   RSGWDREPKAQADLLAFLRGQVDKAEVHAGVKLATEYAAVPFDSFTLQKVYQLETGLTR
FT                   HPEEKPVRKDKRDELVEAIESALESLNSPVESSPHQRPYTAADFIEGIYRTERDKGTLY
FT                   ELTFKGDHKHEFQRLVLFRPFGPIMKVKKEKLNLANTLINVIVPLARRVDKFRHFMQNF
FT                   REMCIQQDGRVHLTVVYFGKEEMNEVKGILENTSKAANFRNFTFIQLNGEFSRGKGLDV
FT                   GARFWKGSNVLLFFCDVDIYFTSEFLNTCRLNTQPGKKVFYPVLFSQYNPGVIYGHHDA
FT                   VPPLGQQLVIKKETGFWRDFGFGMTCQYRSDFINIGGFDLDIKGWGGEDVHLYRKYLHS
FT                   NLIVVRTPVRGLFHLWHEKHCMDELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAH
FT                   LRKQKQKASSKKT"
FT   gene            <12839186..12846558
FT                   /locus_tag="mCG_140549"
FT                   /note="gene_id=mCG140549.0"
FT   mRNA            join(<12839186..12839256,12839959..12840067,
FT                   12842663..12842844,12846280..12846558)
FT                   /locus_tag="mCG_140549"
FT                   /product="mCG140549, transcript variant mCT169995"
FT                   /note="gene_id=mCG140549.0 transcript_id=mCT169995.0
FT                   created on 19-JUN-2003"
FT   mRNA            join(<12839186..12839256,12839959..12840067,
FT                   12842660..12842935)
FT                   /locus_tag="mCG_140549"
FT                   /product="mCG140549, transcript variant mCT169996"
FT                   /note="gene_id=mCG140549.0 transcript_id=mCT169996.0
FT                   created on 19-JUN-2003"
FT   CDS             join(<12842673..12842844,12846280..12846332)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140549"
FT                   /product="mCG140549, isoform CRA_a"
FT                   /note="gene_id=mCG140549.0 transcript_id=mCT169995.0
FT                   protein_id=mCP92743.0 isoform=CRA_a"
FT                   /protein_id="EDL28718.1"
FT                   /translation="QRLNRSYRSVVPQPIACAARTLAEKSLHYFLESYLYGDTSDANIY
FT                   PVPGCVAVVMGWDLKGSFGVLSWKSMGPA"
FT   CDS             <12842673..12842894
FT                   /codon_start=1
FT                   /locus_tag="mCG_140549"
FT                   /product="mCG140549, isoform CRA_b"
FT                   /note="gene_id=mCG140549.0 transcript_id=mCT169996.0
FT                   protein_id=mCP92749.0 isoform=CRA_b"
FT                   /protein_id="EDL28719.1"
FT                   /translation="QRLNRSYRSVVPQPIACAARTLAEKSLHYFLESYLYGDTSDANIY
FT                   PVPGCVAVVMGWGEPGDRIRSFLSTDSL"
FT   gene            <12927457..12928991
FT                   /locus_tag="mCG_140547"
FT                   /note="gene_id=mCG140547.0"
FT   mRNA            join(<12927457..12927541,12928461..12928991)
FT                   /locus_tag="mCG_140547"
FT                   /product="mCG140547"
FT                   /note="gene_id=mCG140547.0 transcript_id=mCT169992.0
FT                   created on 13-JUN-2002"
FT   CDS             join(<12927528..12927541,12928461..12928725)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140547"
FT                   /product="mCG140547"
FT                   /note="gene_id=mCG140547.0 transcript_id=mCT169992.0
FT                   protein_id=mCP92759.0"
FT                   /protein_id="EDL28720.1"
FT                   /translation="GGLVRCRWKKSEPRLRRSSIIQSNHLSATRTGIPTSSSVVSQLIL
FT                   AVTGISLSSEIILFQFLPRIGLKFYFLHLLISNTSYHVAIKDAPIML"
FT   gene            <12929407..12930066
FT                   /locus_tag="mCG_140548"
FT                   /note="gene_id=mCG140548.0"
FT   mRNA            join(<12929407..12929618,12929753..12930066)
FT                   /locus_tag="mCG_140548"
FT                   /product="mCG140548"
FT                   /note="gene_id=mCG140548.0 transcript_id=mCT169993.0
FT                   created on 13-JUN-2002"
FT   CDS             join(<12929513..12929618,12929753..12929790)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140548"
FT                   /product="mCG140548"
FT                   /note="gene_id=mCG140548.0 transcript_id=mCT169993.0
FT                   protein_id=mCP92747.0"
FT                   /protein_id="EDL28721.1"
FT                   /translation="KFMNVKRYKEKNHKIAKCLKRTEEIIKCVCVCVCVLCTIIPDFVC
FT                   MW"
FT   gene            complement(13010098..13014316)
FT                   /locus_tag="mCG_147973"
FT                   /note="gene_id=mCG147973.1"
FT   mRNA            complement(join(13010098..13014122,13014240..13014316))
FT                   /locus_tag="mCG_147973"
FT                   /product="mCG147973"
FT                   /note="gene_id=mCG147973.1 transcript_id=mCT188236.1
FT                   created on 23-APR-2004"
FT   CDS             complement(13010966..13011244)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147973"
FT                   /product="mCG147973"
FT                   /note="gene_id=mCG147973.1 transcript_id=mCT188236.1
FT                   protein_id=mCP108240.1"
FT                   /protein_id="EDL28722.1"
FT                   /translation="MKDLVQTWVGSMHSAPGSVNYIFSGSLSLLSSSLRSEGKDLVETS
FT                   HLELCIPQCPAPLCLSVSVSVSVSVSVSLSLSLSLSLSVCVCVCVCV"
FT   gene            complement(13030789..>13195900)
FT                   /locus_tag="mCG_1048990"
FT                   /note="gene_id=mCG1048990.1"
FT   mRNA            complement(join(13030789..13030940,13114995..13115131,
FT                   13179819..13180122,13195812..>13195900))
FT                   /locus_tag="mCG_1048990"
FT                   /product="mCG1048990"
FT                   /note="gene_id=mCG1048990.1 transcript_id=mCT166694.1
FT                   created on 13-JUN-2002"
FT   CDS             complement(join(13115113..13115131,13179819..>13180012))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048990"
FT                   /product="mCG1048990"
FT                   /note="gene_id=mCG1048990.1 transcript_id=mCT166694.1
FT                   protein_id=mCP54125.1"
FT                   /protein_id="EDL28723.1"
FT                   /translation="GAEAEAPSVLVFLEGRSTHSTLFLLHFVTPQPWGLSIASQWLENI
FT                   CSFQNRSLLIEQNTRWQQRRFLEHA"
FT   gene            <13266386..13298794
FT                   /gene="Ints10"
FT                   /locus_tag="mCG_16909"
FT                   /note="gene_id=mCG16909.2"
FT   mRNA            join(<13266386..13266494,13267433..13267572,
FT                   13271992..13272073,13272560..13272700,13274527..13274698,
FT                   13276966..13277135,13277908..13278041,13280182..13280335,
FT                   13281554..13281636,13283194..13283346,13283885..13283993,
FT                   13288906..13288985,13290273..13290435,13291575..13291668,
FT                   13296678..13298793)
FT                   /gene="Ints10"
FT                   /locus_tag="mCG_16909"
FT                   /product="integrator complex subunit 10, transcript variant
FT                   mCT14690"
FT                   /note="gene_id=mCG16909.2 transcript_id=mCT14690.2 created
FT                   on 13-JUN-2002"
FT   CDS             join(<13266386..13266494,13267433..13267572,
FT                   13271992..13272073,13272560..13272700,13274527..13274698,
FT                   13276966..13277135,13277908..13278041,13280182..13280335,
FT                   13281554..13281636,13283194..13283346,13283885..13283993,
FT                   13288906..13288985,13290273..13290435,13291575..13291668,
FT                   13296678..13296834)
FT                   /codon_start=1
FT                   /gene="Ints10"
FT                   /locus_tag="mCG_16909"
FT                   /product="integrator complex subunit 10, isoform CRA_b"
FT                   /note="gene_id=mCG16909.2 transcript_id=mCT14690.2
FT                   protein_id=mCP16754.2 isoform=CRA_b"
FT                   /protein_id="EDL28725.1"
FT                   /translation="NRFVNFPDQPVVWREISIITSALRNDSQDKQTQFLRSLFETLPGR
FT                   VQCEMLLKVTEQCFNTLERSEMLLLLLRRFPETVVQHGVGLGEALLEAETIEEQDSPVN
FT                   CFRKLFVCDVLPLIINNHDVRLPANLLYKYLNKAAEFYINYVTRSTQSENQHQGAQDTS
FT                   DLMSPSKRSSQKYIIEGLTEKSSHIVDPWERLFKILNVVGMRCEWQMDKGRRSCSDLLH
FT                   RMKELCRYMNSFDSEAHTNYKNQVLYSTMLVFFKSAFQYVSSIQPSLFQGPNAPSQVPL
FT                   VLLEDVANVYGDVEIDRSKHIHKKRKLAEGREKTMSSDDEECSAKGRNRHIVVSKADLS
FT                   NSIEVLESFKLARESWELLYSLEFLDKEFTRICLAWKTDTWLWLRIFLTDMIIYQGQYK
FT                   KAIASLHHLAALQGSLSQPQITGQGTLEHQRALIQLATCHFALGEYRMTCEKVLDLMCY
FT                   MVLPIQDGGKPQEEPSKVKPKCRKGLDLKLLPCTSKAIMPYCLHLMLACFKLRAFTDSR
FT                   DDMALGHVIVLLQQEWPRGENLFLKAISKICQQGNFQYENFFSYVTNIDMLEEFAYLRT
FT                   QEGGKIHLELLPNQGMLIKHHTVTRGITKGVKEDFRLAMERQVSRCGENLMAVLHRFCI
FT                   NEKILLLQTLT"
FT   mRNA            join(<13266387..13266494,13267433..13267572,
FT                   13271992..13272073,13272560..13272700,13274527..13274698,
FT                   13276966..13277135,13277908..13278041,13280182..13280335,
FT                   13281554..13281636,13283194..13283346,13283885..13283993,
FT                   13288906..13288985,13290273..13290435,13291575..13291668,
FT                   13294469..13294546,13296678..13298794)
FT                   /gene="Ints10"
FT                   /locus_tag="mCG_16909"
FT                   /product="integrator complex subunit 10, transcript variant
FT                   mCT192551"
FT                   /note="gene_id=mCG16909.2 transcript_id=mCT192551.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<13266389..13266494,13267433..13267572,
FT                   13271992..13272073,13272560..13272700,13274527..13274698,
FT                   13276966..13277135,13277908..13278041,13280182..13280335,
FT                   13281554..13281636,13283194..13283346,13283885..13283993,
FT                   13288906..13288985,13290273..13290435,13291575..13291668,
FT                   13294469..13294546,13296678..13296834)
FT                   /codon_start=1
FT                   /gene="Ints10"
FT                   /locus_tag="mCG_16909"
FT                   /product="integrator complex subunit 10, isoform CRA_a"
FT                   /note="gene_id=mCG16909.2 transcript_id=mCT192551.0
FT                   protein_id=mCP113507.0 isoform=CRA_a"
FT                   /protein_id="EDL28724.1"
FT                   /translation="RFVNFPDQPVVWREISIITSALRNDSQDKQTQFLRSLFETLPGRV
FT                   QCEMLLKVTEQCFNTLERSEMLLLLLRRFPETVVQHGVGLGEALLEAETIEEQDSPVNC
FT                   FRKLFVCDVLPLIINNHDVRLPANLLYKYLNKAAEFYINYVTRSTQSENQHQGAQDTSD
FT                   LMSPSKRSSQKYIIEGLTEKSSHIVDPWERLFKILNVVGMRCEWQMDKGRRSCSDLLHR
FT                   MKELCRYMNSFDSEAHTNYKNQVLYSTMLVFFKSAFQYVSSIQPSLFQGPNAPSQVPLV
FT                   LLEDVANVYGDVEIDRSKHIHKKRKLAEGREKTMSSDDEECSAKGRNRHIVVSKADLSN
FT                   SIEVLESFKLARESWELLYSLEFLDKEFTRICLAWKTDTWLWLRIFLTDMIIYQGQYKK
FT                   AIASLHHLAALQGSLSQPQITGQGTLEHQRALIQLATCHFALGEYRMTCEKVLDLMCYM
FT                   VLPIQDGGKPQEEPSKVKPKCRKGLDLKLLPCTSKAIMPYCLHLMLACFKLRAFTDSRD
FT                   DMALGHVIVLLQQEWPRGENLFLKAISKICQQGNFQYENFFSYVTNIDMLEEFAYLRTQ
FT                   EGGKIHLELLPNQGMLIKPSSPPMGLLQQEFLPVLQPSIQTADRHHTVTRGITKGVKED
FT                   FRLAMERQVSRCGENLMAVLHRFCINEKILLLQTLT"
FT   gene            13268553..13269176
FT                   /pseudo
FT                   /locus_tag="mCG_140544"
FT                   /note="gene_id=mCG140544.0"
FT   mRNA            13268553..13269176
FT                   /pseudo
FT                   /locus_tag="mCG_140544"
FT                   /note="gene_id=mCG140544.0 transcript_id=mCT169986.0
FT                   created on 13-JUN-2002"
FT   gene            13349507..13376381
FT                   /gene="Lpl"
FT                   /locus_tag="mCG_16917"
FT                   /note="gene_id=mCG16917.2"
FT   mRNA            join(13349507..13349833,13356519..13356679,
FT                   13361667..13361846,13363704..13363815,13364742..13364975,
FT                   13365679..13365921,13368488..13368608,13370134..13370316,
FT                   13371302..13371403,13373510..13374458,13374625..13375866)
FT                   /gene="Lpl"
FT                   /locus_tag="mCG_16917"
FT                   /product="lipoprotein lipase, transcript variant mCT14698"
FT                   /note="gene_id=mCG16917.2 transcript_id=mCT14698.2 created
FT                   on 14-JUN-2002"
FT   mRNA            join(13349550..13349833,13356519..13356679,
FT                   13361667..13361846,13363704..13363815,13364742..13364975,
FT                   13365679..13365921,13368488..13368608,13370134..13370316,
FT                   13371302..13371403,13373510..13373571,13376172..13376381)
FT                   /gene="Lpl"
FT                   /locus_tag="mCG_16917"
FT                   /product="lipoprotein lipase, transcript variant mCT169997"
FT                   /note="gene_id=mCG16917.2 transcript_id=mCT169997.0 created
FT                   on 14-JUN-2002"
FT   CDS             join(13349746..13349833,13356519..13356679,
FT                   13361667..13361846,13363704..13363815,13364742..13364975,
FT                   13365679..13365921,13368488..13368608,13370134..13370316,
FT                   13371302..13371403,13373510)
FT                   /codon_start=1
FT                   /gene="Lpl"
FT                   /locus_tag="mCG_16917"
FT                   /product="lipoprotein lipase, isoform CRA_a"
FT                   /note="gene_id=mCG16917.2 transcript_id=mCT169997.0
FT                   protein_id=mCP92775.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FJQ8"
FT                   /db_xref="InterPro:IPR000734"
FT                   /db_xref="InterPro:IPR001024"
FT                   /db_xref="InterPro:IPR002330"
FT                   /db_xref="InterPro:IPR008976"
FT                   /db_xref="InterPro:IPR013818"
FT                   /db_xref="InterPro:IPR016272"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="MGI:MGI:96820"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJQ8"
FT                   /protein_id="EDL28726.1"
FT                   /translation="MESKALLLVVLGVWLQSLTAFRGGVAAADAGRDFSDIESKFALRT
FT                   PEDTAEDTCHLIPGLADSVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREP
FT                   DSNVIVVDWLYRAQQHYPVSAGYTKLVGNDVARFINWMEEEFNYPLDNVHLLGYSLGAH
FT                   AAGVAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIG
FT                   IQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLN
FT                   EENPSKAYRCNSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKV
FT                   FHYQVKIHFSGTENGKQHNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDI
FT                   GELLMMKLKWMSDSYFSWPDWWSSPSFVIERIRVKAGETQKKVIFCAREKVSHLQKGKD
FT                   SAVFVKCHDKSLKKSG"
FT   CDS             join(13349746..13349833,13356519..13356679,
FT                   13361667..13361846,13363704..13363815,13364742..13364975,
FT                   13365679..13365921,13368488..13368608,13370134..13370316,
FT                   13371302..13371403,13373510)
FT                   /codon_start=1
FT                   /gene="Lpl"
FT                   /locus_tag="mCG_16917"
FT                   /product="lipoprotein lipase, isoform CRA_a"
FT                   /note="gene_id=mCG16917.2 transcript_id=mCT14698.2
FT                   protein_id=mCP16774.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FJQ8"
FT                   /db_xref="InterPro:IPR000734"
FT                   /db_xref="InterPro:IPR001024"
FT                   /db_xref="InterPro:IPR002330"
FT                   /db_xref="InterPro:IPR008976"
FT                   /db_xref="InterPro:IPR013818"
FT                   /db_xref="InterPro:IPR016272"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="MGI:MGI:96820"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJQ8"
FT                   /protein_id="EDL28727.1"
FT                   /translation="MESKALLLVVLGVWLQSLTAFRGGVAAADAGRDFSDIESKFALRT
FT                   PEDTAEDTCHLIPGLADSVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREP
FT                   DSNVIVVDWLYRAQQHYPVSAGYTKLVGNDVARFINWMEEEFNYPLDNVHLLGYSLGAH
FT                   AAGVAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIG
FT                   IQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLN
FT                   EENPSKAYRCNSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKV
FT                   FHYQVKIHFSGTENGKQHNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDI
FT                   GELLMMKLKWMSDSYFSWPDWWSSPSFVIERIRVKAGETQKKVIFCAREKVSHLQKGKD
FT                   SAVFVKCHDKSLKKSG"
FT   gene            complement(13511573..13564846)
FT                   /gene="Slc18a1"
FT                   /locus_tag="mCG_16914"
FT                   /note="gene_id=mCG16914.2"
FT   mRNA            complement(join(13511573..13512770,13514112..13514245,
FT                   13514453..13514572,13514849..13514912,13516576..13516627,
FT                   13517787..13517865,13525703..13525798,13525876..13525936,
FT                   13539654..13539697,13539916..13540005,13541500..13541592,
FT                   13542504..13542587,13546345..13546403,13547818..13548172,
FT                   13549296..13549567,13551453..13551527,13564591..13564846))
FT                   /gene="Slc18a1"
FT                   /locus_tag="mCG_16914"
FT                   /product="solute carrier family 18 (vesicular monoamine),
FT                   member 1"
FT                   /note="gene_id=mCG16914.2 transcript_id=mCT14693.2 created
FT                   on 14-JUN-2002"
FT   CDS             complement(join(13512660..13512770,13514112..13514245,
FT                   13514453..13514572,13514849..13514912,13516576..13516627,
FT                   13517787..13517865,13525703..13525798,13525876..13525936,
FT                   13539654..13539697,13539916..13540005,13541500..13541592,
FT                   13542504..13542587,13546345..13546403,13547818..13548172,
FT                   13549296..13549419))
FT                   /codon_start=1
FT                   /gene="Slc18a1"
FT                   /locus_tag="mCG_16914"
FT                   /product="solute carrier family 18 (vesicular monoamine),
FT                   member 1"
FT                   /note="gene_id=mCG16914.2 transcript_id=mCT14693.2
FT                   protein_id=mCP16780.2"
FT                   /db_xref="GOA:Q32XG7"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:106684"
FT                   /db_xref="UniProtKB/TrEMBL:Q32XG7"
FT                   /protein_id="EDL28728.1"
FT                   /translation="MFQVVLGAPQRLLKEGRQSRKLVLVVVFVALLLDNMLLTVVVPIV
FT                   PTFLYATEFKDINSSLLRGPSVSSQQALTSPAFSTTFSFFDNTTMTVEEHVPFRVAWIN
FT                   GTIPPPVTEAGSVPKNNCLQGIEFLEEENVRIGILFASKALMQLLVNPFVGPLTNRIGY
FT                   HIPMFVGFMIMFLSTLMFAFSGTYALLFVARTLQGIGSSFSSVAGLGMLASVYTDNYER
FT                   GRAMGIALGGLALGLLVGAPFGSVMYEFVGKSSPFLILAFLALLDGALQFCILWPSKVS
FT                   PESAMGTPLLTLLKDPYILVAAGSICLANMGVAILEPTLPIWMMQTMCSPEWQLGLAFL
FT                   PASVAYLIGTNLFGVLANKMGRWLCSLVGMVAVGISLLCVPLAHNIFGLIGPNAGLGFA
FT                   IGMVDSSLMPIMGYLVDLRHTSVYGSVYAIADVAFCVGFAIGPSTGGVIVPVIGFPWLM
FT                   VIIGTINIIYAPLCCFLQNPPAKEEELAILNQECPTETQMYTIQRPTKEFPLGENSDDP
FT                   GSEE"
FT   gene            <13518616..13537770
FT                   /locus_tag="mCG_140545"
FT                   /note="gene_id=mCG140545.0"
FT   mRNA            join(<13518616..13518639,13518838..13518885,
FT                   13537436..13537770)
FT                   /locus_tag="mCG_140545"
FT                   /product="mCG140545"
FT                   /note="gene_id=mCG140545.0 transcript_id=mCT169987.0
FT                   created on 14-JUN-2002"
FT   CDS             join(<13518637..13518639,13518838..13518885,
FT                   13537436..13537675)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140545"
FT                   /product="mCG140545"
FT                   /note="gene_id=mCG140545.0 transcript_id=mCT169987.0
FT                   protein_id=mCP92740.0"
FT                   /protein_id="EDL28729.1"
FT                   /translation="KVFYVAHQLCQCPLSNQSIYFEEGGRGRKGERGGRGERGGGAGGR
FT                   GGGAGRGGGGGRGGEEEEKEEEEEEEEEEEEEEEEEEEEEEEEEEMKYGRL"
FT   gene            13564382..13589754
FT                   /gene="Atp6v1b2"
FT                   /locus_tag="mCG_16916"
FT                   /note="gene_id=mCG16916.2"
FT   mRNA            join(13564382..13564538,13571745..13571800,
FT                   13576867..13576965,13577438..13577531,13577666..13577743,
FT                   13577953..13578092,13578264..13578365,13578883..13578980,
FT                   13579148..13579271,13581860..13582010,13583633..13583715,
FT                   13584334..13584438,13585929..13586058,13588478..13589754)
FT                   /gene="Atp6v1b2"
FT                   /locus_tag="mCG_16916"
FT                   /product="ATPase, H+ transporting, lysosomal V1 subunit B2"
FT                   /note="gene_id=mCG16916.2 transcript_id=mCT14697.2 created
FT                   on 14-JUN-2002"
FT   CDS             join(13564403..13564538,13571745..13571800,
FT                   13576867..13576965,13577438..13577531,13577666..13577743,
FT                   13577953..13578092,13578264..13578365,13578883..13578980,
FT                   13579148..13579271,13581860..13582010,13583633..13583715,
FT                   13584334..13584438,13585929..13586058,13588478..13588617)
FT                   /codon_start=1
FT                   /gene="Atp6v1b2"
FT                   /locus_tag="mCG_16916"
FT                   /product="ATPase, H+ transporting, lysosomal V1 subunit B2"
FT                   /note="gene_id=mCG16916.2 transcript_id=mCT14697.2
FT                   protein_id=mCP16768.1"
FT                   /protein_id="EDL28730.1"
FT                   /translation="MALRAMRGIVNGAAPELPVPTGGPMAGAREQALAVSRNYLSQPRL
FT                   TYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSG
FT                   IDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCR
FT                   IYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDY
FT                   SEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTT
FT                   AEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGR
FT                   VEGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLS
FT                   RLMKSAIGEGMTRKDHADVSNQLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKF
FT                   EKNFITQGPYENRTVYETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH"
FT   gene            complement(13610934..>13617047)
FT                   /gene="Lzts1"
FT                   /locus_tag="mCG_16913"
FT                   /note="gene_id=mCG16913.1"
FT   mRNA            complement(join(13610934..13612253,13614446..13615243,
FT                   13616703..>13617047))
FT                   /gene="Lzts1"
FT                   /locus_tag="mCG_16913"
FT                   /product="leucine zipper, putative tumor suppressor 1"
FT                   /note="gene_id=mCG16913.1 transcript_id=mCT14695.1 created
FT                   on 14-JUN-2002"
FT   CDS             complement(join(13611597..13612253,13614446..13615243,
FT                   13616703..13617047))
FT                   /codon_start=1
FT                   /gene="Lzts1"
FT                   /locus_tag="mCG_16913"
FT                   /product="leucine zipper, putative tumor suppressor 1"
FT                   /note="gene_id=mCG16913.1 transcript_id=mCT14695.1
FT                   protein_id=mCP16779.1"
FT                   /db_xref="MGI:MGI:2684762"
FT                   /db_xref="UniProtKB/TrEMBL:A0PJT4"
FT                   /protein_id="EDL28731.1"
FT                   /translation="MGSVSSLISGHSFHSKHCRASQYKLRKSSHLKKLNRYSDGLLRFG
FT                   FSQDSGRGKSSSKMGKSEDFFYIKVSQKARGSHRPDYTALSSGDMGGQTGVDFDPATPP
FT                   KLMPFSNQLEMSSDKGAVRPTAFKPVLPRSGAILHSSPESTSHQLHPMPPDKPKEQELK
FT                   PGLCSGALSDSGRNSMSSLPTHSTTSSYQLDPLVTPVGPTSRFGGSAHNITQGIILQDS
FT                   NMMSLKALSFSDGGSKLAHPGKADKGASCVRSPLSTDECTIQELEQKLLQRETALQKLQ
FT                   RSFDEKEFASGQTFEERPRRTRDELECLEPKSKLKPPSQKSQRTQQVLQLQVLQLQQEK
FT                   RQLRQELESLMKEQDLLETKLRSYEREKTNFAPALEETQWEVCQKSGEISLLKQQLKES
FT                   QLEVNTKASEILSLKAQLKDTRGKLDGMELKTQDLESALRTKGLELEVCENELQRKKNE
FT                   AELLREKVNLLEQELMELRAQAALHPAPLGPPGVGLTFSEDIPALQRELDRLRAELKEE
FT                   RQGHDQMSSGFQHERLVWKEEKEKVIQYQRQLQQSYLAMYQRNQRLEKALQQLARGDGP
FT                   GEPFEIDLEGADIPYEDIIATEI"
FT   gene            <13686836..13708363
FT                   /locus_tag="mCG_140597"
FT                   /note="gene_id=mCG140597.0"
FT   mRNA            join(<13686836..13686945,13704194..13704320,
FT                   13704523..13704580,13705694..13708363)
FT                   /locus_tag="mCG_140597"
FT                   /product="mCG140597"
FT                   /note="gene_id=mCG140597.0 transcript_id=mCT170188.0
FT                   created on 17-JUN-2002"
FT   CDS             join(<13686838..13686945,13704194..13704320,
FT                   13704523..13704580,13705694..13706831)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140597"
FT                   /product="mCG140597"
FT                   /note="gene_id=mCG140597.0 transcript_id=mCT170188.0
FT                   protein_id=mCP93058.0"
FT                   /protein_id="EDL28732.1"
FT                   /translation="PGARLQAPFRSWENASGSLRVTGSVRGARELGSHAMDALTYDDVH
FT                   INFTPEEWALLDHTQRNLYTDVMLETYKNLVAIGYKPEDKIIEHLQNFRIPGRHKGSLT
FT                   REKPYEYTQCGKASTRHIGLQRHERIHTGEKPYKCNQCGKAFVDYCTLQKHERTHTGEK
FT                   AYECNECGKGFTQQAYLQNHKRTHTGEKPYECYECGKGFAHYSTLRKHGSTHTGEKPYE
FT                   CNECGKAFAQQSHLQNHKRTHTGEKPYECNECGKAFSQHSSLQNHKRTHTGEKPYECNE
FT                   CGKAFSQYSNLRKHKRTHTGEKPYECNECGKAFSQHSSLQQHKRTHTGEIPYECNECGK
FT                   AFSQHSSLQMHKRTHTGEKPYECKQCGKAFSQHSSLRKHKRTHTGQKPYECSQCGKAFS
FT                   RHSSLQQHKRTHTGEKPYECNECGKAFTQQGHLQKHKRTHTGEKPYECNQCGKAFSEPS
FT                   SLQMHKRTHNGEKLDVCN"
FT   gene            <13748550..>13782282
FT                   /gene="D130040H23Rik"
FT                   /locus_tag="mCG_140598"
FT                   /note="gene_id=mCG140598.0"
FT   mRNA            join(<13748550..13748661,13768915..13768975,
FT                   13769283..13769535,13779466..13779592,13779971..13780034,
FT                   13781193..>13782282)
FT                   /gene="D130040H23Rik"
FT                   /locus_tag="mCG_140598"
FT                   /product="RIKEN cDNA D130040H23, transcript variant
FT                   mCT170190"
FT                   /note="gene_id=mCG140598.0 transcript_id=mCT170190.0
FT                   created on 17-JUN-2002"
FT   mRNA            join(<13748568..13748683,13768915..13768975,
FT                   13779466..13779592,13779971..13780034,13781193..>13782282)
FT                   /gene="D130040H23Rik"
FT                   /locus_tag="mCG_140598"
FT                   /product="RIKEN cDNA D130040H23, transcript variant
FT                   mCT170189"
FT                   /note="gene_id=mCG140598.0 transcript_id=mCT170189.0
FT                   created on 17-JUN-2002"
FT   CDS             join(<13748637..13748683,13768915..13768975,
FT                   13779466..13779592,13779971..13780034,13781193..13782282)
FT                   /codon_start=1
FT                   /gene="D130040H23Rik"
FT                   /locus_tag="mCG_140598"
FT                   /product="RIKEN cDNA D130040H23, isoform CRA_b"
FT                   /note="gene_id=mCG140598.0 transcript_id=mCT170189.0
FT                   protein_id=mCP93038.0 isoform=CRA_b"
FT                   /protein_id="EDL28734.1"
FT                   /translation="ARAWERRYGERGAVACSQKMASEPLSLELLTVASPHDSVTYDDVH
FT                   VNFTGEEWVLLDASQKSLYRDVMLETYSNLTAIGYKWKDNDIEEHFCQNSRIHRRHERG
FT                   PGEKPYEYTQCGKAFAQHSHLQGHERILTGKKPYECNQCGKAFICHSSLSNHEKHHTGE
FT                   KPYKCIECGKAFSQQSHLQIHKRIHTGEKPYECNQCAKAFSQQSHLQKHKRTHTGEKPY
FT                   KCNQCNKDFSQQSHLQIHRRTHTGEKPYKCNQCDKVFSQQTHLQRHKRTHTGEKPYKCN
FT                   QCGKAFAHHSYLEKHQRTHTGEKPYQCNQCGKAFAHHSYLQKHKRTHTGEKPYQCNQCG
FT                   KTFACHRSLQIHERIHTGEKPYECCQCGKTFAHHNYLRNHKRTHTGENPYKCKECGKAF
FT                   ACHSHLQRHERVHTGEKPYECSQCGKAFACHSSLQNHEKNHIEEKLYELCKQYGNAFVH
FT                   HSYL"
FT   CDS             join(<13769464..13769535,13779466..13779592,
FT                   13779971..13780034,13781193..13782282)
FT                   /codon_start=1
FT                   /gene="D130040H23Rik"
FT                   /locus_tag="mCG_140598"
FT                   /product="RIKEN cDNA D130040H23, isoform CRA_c"
FT                   /note="gene_id=mCG140598.0 transcript_id=mCT170190.0
FT                   protein_id=mCP93044.0 isoform=CRA_c"
FT                   /protein_id="EDL28735.1"
FT                   /translation="PCATVLHIQIPPGLPGEPTHWRAQDSVTYDDVHVNFTGEEWVLLD
FT                   ASQKSLYRDVMLETYSNLTAIGYKWKDNDIEEHFCQNSRIHRRHERGPGEKPYEYTQCG
FT                   KAFAQHSHLQGHERILTGKKPYECNQCGKAFICHSSLSNHEKHHTGEKPYKCIECGKAF
FT                   SQQSHLQIHKRIHTGEKPYECNQCAKAFSQQSHLQKHKRTHTGEKPYKCNQCNKDFSQQ
FT                   SHLQIHRRTHTGEKPYKCNQCDKVFSQQTHLQRHKRTHTGEKPYKCNQCGKAFAHHSYL
FT                   EKHQRTHTGEKPYQCNQCGKAFAHHSYLQKHKRTHTGEKPYQCNQCGKTFACHRSLQIH
FT                   ERIHTGEKPYECCQCGKTFAHHNYLRNHKRTHTGENPYKCKECGKAFACHSHLQRHERV
FT                   HTGEKPYECSQCGKAFACHSSLQNHEKNHIEEKLYELCKQYGNAFVHHSYL"
FT   mRNA            join(<13779466..13779592,13780589..13781003,
FT                   13781193..>13782282)
FT                   /gene="D130040H23Rik"
FT                   /locus_tag="mCG_140598"
FT                   /product="RIKEN cDNA D130040H23, transcript variant
FT                   mCT170187"
FT                   /note="gene_id=mCG140598.0 transcript_id=mCT170187.0
FT                   created on 17-JUN-2002"
FT   CDS             join(<13779466..13779592,13780589..13781003,
FT                   13781193..13782282)
FT                   /codon_start=1
FT                   /gene="D130040H23Rik"
FT                   /locus_tag="mCG_140598"
FT                   /product="RIKEN cDNA D130040H23, isoform CRA_a"
FT                   /note="gene_id=mCG140598.0 transcript_id=mCT170187.0
FT                   protein_id=mCP93057.0 isoform=CRA_a"
FT                   /protein_id="EDL28733.1"
FT                   /translation="DSVTYDDVHVNFTGEEWVLLDASQKSLYRDVMLETYSNLTAIGIS
FT                   YVTLDKSHVSIRDMERRKCTSLGPRAMRSHVVVPILSRLCECDISRQLICVSNFIGNTL
FT                   TSSNAEKPWEEKEYGNSSVCLGLFCKDSMTHVIGKCYECNHCGKSLSSSSCLQRCGKTH
FT                   VKKDVINVNHVLKTMHHRHERGPGEKPYEYTQCGKAFAQHSHLQGHERILTGKKPYECN
FT                   QCGKAFICHSSLSNHEKHHTGEKPYKCIECGKAFSQQSHLQIHKRIHTGEKPYECNQCA
FT                   KAFSQQSHLQKHKRTHTGEKPYKCNQCNKDFSQQSHLQIHRRTHTGEKPYKCNQCDKVF
FT                   SQQTHLQRHKRTHTGEKPYKCNQCGKAFAHHSYLEKHQRTHTGEKPYQCNQCGKAFAHH
FT                   SYLQKHKRTHTGEKPYQCNQCGKTFACHRSLQIHERIHTGEKPYECCQCGKTFAHHNYL
FT                   RNHKRTHTGENPYKCKECGKAFACHSHLQRHERVHTGEKPYECSQCGKAFACHSSLQNH
FT                   EKNHIEEKLYELCKQYGNAFVHHSYL"
FT   gene            13808488..13808986
FT                   /pseudo
FT                   /locus_tag="mCG_49374"
FT                   /note="gene_id=mCG49374.2"
FT   mRNA            13808488..13808986
FT                   /pseudo
FT                   /locus_tag="mCG_49374"
FT                   /note="gene_id=mCG49374.2 transcript_id=mCT49557.2 created
FT                   on 17-JUN-2002"
FT   gene            complement(13850332..>13856047)
FT                   /locus_tag="mCG_117755"
FT                   /note="gene_id=mCG117755.0"
FT   mRNA            complement(join(13850332..13853356,13854507..13854567,
FT                   13854755..13854881,13855935..>13856047))
FT                   /locus_tag="mCG_117755"
FT                   /product="mCG117755"
FT                   /note="gene_id=mCG117755.0 transcript_id=mCT118900.0
FT                   created on 17-JUN-2002"
FT   CDS             complement(join(13851079..13853356,13854507..13854567,
FT                   13854755..13854881,13855935..>13855988))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117755"
FT                   /product="mCG117755"
FT                   /note="gene_id=mCG117755.0 transcript_id=mCT118900.0
FT                   protein_id=mCP54051.0"
FT                   /protein_id="EDL28736.1"
FT                   /translation="DSVHLDLSDSSSHVLGLKDAVTYDDVHINFTQEEWVLLDLSQKRL
FT                   YKDVILETYRNLTAIGYKWEEYNIEEYCQNSRIHGRQERSHPEDKLYEYRQCGKVFACH
FT                   SHLQSHERIRAGEESCECNQCNNHSTLQNPEKNHTEERLYECNECGKAFSQQSHLQIHT
FT                   RTHHGQKIYECKQCCKAFACCSSLQKHEKDHTRDTTYESKQSGIDFSHQSYLYKHKRTY
FT                   IVQKHYKCTQCDKVFSKRSNFQRHKRLHTGEKPYECNQCGKGFALPRYLRKHRRTHIGE
FT                   KPYECNQCGKAFTQSSGLQNHERIHTGEKPYECNQCGKAFAHHSSLQKHEKTHTGEKPY
FT                   ECNQCGKAFEQQIYLQIHERIHTGEKPYVCNQCGKAFAYHSHLKVHGRAHTGEKPYECN
FT                   QCGRAFAYSSSLQIHEIIHTAEKPYECKQCGRAFAHQSYLQKHERTHTGEKPYKCKQCG
FT                   KAFVQQIHLQVHGRIHTGEKPYECNQCGRAFAYSSSLKKHEIVHTGEKPYECNQCGKAF
FT                   AYPRYLQKHERTHTGEKPYECNQCGKAFAHHSYLQKHERIHTGEKPYECNQCGKAFAHH
FT                   SNFQNHERTHTGEKPYECNQCGKAFSKQTLLQLHKRTHTGEKPYVCNQCGKAFAYHSHL
FT                   KVHGRAHTGEKPYECNQCGRAFAYNSSLQIHEIVHTAEKPYECKQCGRAFAHQSYLQKH
FT                   ERTHTGEKPYKCNQCGKAFAQQIHLQVHGRIHTGEKPYECNQCGRAFAYSSSLKKHEIV
FT                   HTGEKPYECNQCGKAFAHLRYLRKHERTHTEEKPYESNQCGKTFAHNNNLQHHERIHTE
FT                   EKPYEHSQCRKPFSYHSSLQIHTSEKH"
FT   gene            complement(13894930..>13896841)
FT                   /locus_tag="mCG_117757"
FT                   /note="gene_id=mCG117757.1"
FT   mRNA            complement(join(13894930..13895055,13895587..13895861,
FT                   13896121..13896383,13896436..>13896673))
FT                   /locus_tag="mCG_117757"
FT                   /product="mCG117757, transcript variant mCT118902"
FT                   /note="gene_id=mCG117757.1 transcript_id=mCT118902.0
FT                   created on 17-JUN-2002"
FT   mRNA            complement(join(<13894999..13895055,13895587..13895861,
FT                   13896054..>13896841))
FT                   /locus_tag="mCG_117757"
FT                   /product="mCG117757, transcript variant mCT170191"
FT                   /note="gene_id=mCG117757.1 transcript_id=mCT170191.0
FT                   created on 17-JUN-2002"
FT   CDS             complement(join(13894999..13895055,13895587..13895861,
FT                   13896054..>13896609))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117757"
FT                   /product="mCG117757, isoform CRA_b"
FT                   /note="gene_id=mCG117757.1 transcript_id=mCT170191.0
FT                   protein_id=mCP93040.0 isoform=CRA_b"
FT                   /protein_id="EDL28738.1"
FT                   /translation="VRGNKPPIFRPFPRKHRIHVLEAPGDIEPTQSTCAADCRAPADAE
FT                   PNSSTCAAVNGAPVNVEPTPSQLAPHSGAPADVEPTTSQCAPDCEDPAVIEPTHSTCAA
FT                   DSRAPADIEPTPSQLAPDRGAPADVEPTHSTCAADTRIPADIEPSPSQCAPDSPAPSDI
FT                   EQITSPCPSDSSESDEKYDLETGEEPSPVADLDEDIAEDFYDALESADLTGHSGSTVQV
FT                   PGFLWEPDMLLLPVMPLMWFFTFLLSMMMWIRNGIPKCAMKKMAKDLPPREKINPMPLE
FT                   LNTPTHTDICTQSV"
FT   CDS             complement(join(13894999..13895055,13895587..13895861,
FT                   13896121..>13896124))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117757"
FT                   /product="mCG117757, isoform CRA_a"
FT                   /note="gene_id=mCG117757.1 transcript_id=mCT118902.0
FT                   protein_id=mCP54057.0 isoform=CRA_a"
FT                   /protein_id="EDL28737.1"
FT                   /translation="YCEEPSPVADLDEDIAEDFYDALESADLTGHSGSTVQVPGFLWEP
FT                   DMLLLPVMPLMWFFTFLLSMMMWIRNGIPKCAMKKMAKDLPPREKINPMPLELNTPTHT
FT                   DICTQSV"
FT   gene            complement(13902480..13904426)
FT                   /locus_tag="mCG_147970"
FT                   /note="gene_id=mCG147970.0"
FT   mRNA            complement(join(13902480..13902851,13902902..13903897,
FT                   13904391..13904426))
FT                   /locus_tag="mCG_147970"
FT                   /product="mCG147970"
FT                   /note="gene_id=mCG147970.0 transcript_id=mCT188233.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(13903375..13903506)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147970"
FT                   /product="mCG147970"
FT                   /note="gene_id=mCG147970.0 transcript_id=mCT188233.0
FT                   protein_id=mCP108237.0"
FT                   /protein_id="EDL28739.1"
FT                   /translation="MIQQSPKCLYPQQNAHKFYLPLGTPISGSYMRGSLWFLSFICF"
FT   gene            14012920..14013238
FT                   /pseudo
FT                   /locus_tag="mCG_1048897"
FT                   /note="gene_id=mCG1048897.1"
FT   mRNA            14012920..14013238
FT                   /pseudo
FT                   /locus_tag="mCG_1048897"
FT                   /note="gene_id=mCG1048897.1 transcript_id=mCT166601.1
FT                   created on 17-JUN-2002"
FT   gene            complement(14014247..14021133)
FT                   /locus_tag="mCG_147974"
FT                   /note="gene_id=mCG147974.0"
FT   mRNA            complement(join(14014247..14016058,14016377..14016799,
FT                   14017676..14017755,14020149..14020646,14020975..14021133))
FT                   /locus_tag="mCG_147974"
FT                   /product="mCG147974"
FT                   /note="gene_id=mCG147974.0 transcript_id=mCT188237.0
FT                   created on 13-JAN-2004"
FT   gene            complement(14018086..>14061407)
FT                   /locus_tag="mCG_130373"
FT                   /note="gene_id=mCG130373.0"
FT   mRNA            complement(join(14018086..14018453,14046776..14047074,
FT                   14052399..14052440,14061334..>14061407))
FT                   /locus_tag="mCG_130373"
FT                   /product="mCG130373"
FT                   /note="gene_id=mCG130373.0 transcript_id=mCT131696.1
FT                   created on 18-JUN-2002"
FT   CDS             complement(join(14018399..14018453,14046776..14047074,
FT                   14052399..14052440,14061334..>14061405))
FT                   /codon_start=1
FT                   /locus_tag="mCG_130373"
FT                   /product="mCG130373"
FT                   /note="gene_id=mCG130373.0 transcript_id=mCT131696.1
FT                   protein_id=mCP53982.1"
FT                   /protein_id="EDL28741.1"
FT                   /translation="AVWEVHGAEMAAEQQEALREFVAVKLTAEVNNPGVMSSLHSDIDS
FT                   GDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREERAQYTLMAQAVDRGTNKPLEPP
FT                   SEFIDKVQDINDNPPEFLHEIYHTSVPERFNVGSLWGLTLPWKAKLWLLIP"
FT   CDS             complement(join(14020508..14020646,14020975..14021042))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147974"
FT                   /product="mCG147974"
FT                   /note="gene_id=mCG147974.0 transcript_id=mCT188237.0
FT                   protein_id=mCP108241.0"
FT                   /protein_id="EDL28740.1"
FT                   /translation="MADSSCWGQTRVQKGFQDWAAPGVSLHQDMEKPKPFQEEKVGVVS
FT                   LGVYKGRGDFFFNKNSSVWTELI"
FT   gene            complement(14087845..>14102772)
FT                   /locus_tag="mCG_58990"
FT                   /note="gene_id=mCG58990.2"
FT   mRNA            complement(join(14087845..14089647,14090586..14090646,
FT                   14090940..14091066,14096536..14096893,14102657..>14102772))
FT                   /locus_tag="mCG_58990"
FT                   /product="mCG58990, transcript variant mCT59173"
FT                   /note="gene_id=mCG58990.2 transcript_id=mCT59173.2 created
FT                   on 18-JUN-2002"
FT   mRNA            complement(join(14088532..14089647,14090586..14090646,
FT                   14090940..14091066,14096536..14096893,14102299..>14102345))
FT                   /locus_tag="mCG_58990"
FT                   /product="mCG58990, transcript variant mCT170215"
FT                   /note="gene_id=mCG58990.2 transcript_id=mCT170215.0 created
FT                   on 18-JUN-2002"
FT   CDS             complement(join(14088606..14089647,14090586..14090646,
FT                   14090940..14091066,14096536..>14096670))
FT                   /codon_start=1
FT                   /locus_tag="mCG_58990"
FT                   /product="mCG58990, isoform CRA_a"
FT                   /note="gene_id=mCG58990.2 transcript_id=mCT170215.0
FT                   protein_id=mCP93048.0 isoform=CRA_a"
FT                   /protein_id="EDL28742.1"
FT                   /translation="RPLKKLSRCLLSPQCQVEAPESSSLRGWSLFIMETAIVGLSRPDQ
FT                   GLVSFEDLVVHFTQDEWDLLAPSQKTLYGDVMLETFRNFTDTGCEWEDQKIEDHFEEPE
FT                   INLRNIVTHSEYTQYEHEEYEEKPPDSNFLTSVEGYMETHTVNGPSECEVCLKSYGLYH
FT                   LTYNGHHNYEYKECVGSQPVRKSYECNQCGKTLSSYNSLQRHQKIHIEERPYKCQQCTK
FT                   AFRCLNALQSHERIHTGEKPYECKHCGTAFSRLTHLRLHEKVHTGEKHYECKQCNIVFK
FT                   SQSSYHRHKIMHGETFYNCKECGKSFIYPSLLQMHERTHTGEKPYECKLCGKTFRYHSS
FT                   IRLHERTHTGEKPYECKHCGKAFTRQSYLQFHERSHTGEKPYECKECGKAFRHHSYLRL
FT                   HERRHTGEKPYQCGQCGRSFSRQSSFKRHQSVHAVENPYKCQQYLIPLSLFPSNA"
FT   CDS             complement(join(14088606..14089647,14090586..14090646,
FT                   14090940..14091066,14096536..>14096670))
FT                   /codon_start=1
FT                   /locus_tag="mCG_58990"
FT                   /product="mCG58990, isoform CRA_a"
FT                   /note="gene_id=mCG58990.2 transcript_id=mCT59173.2
FT                   protein_id=mCP34713.2 isoform=CRA_a"
FT                   /protein_id="EDL28743.1"
FT                   /translation="RPLKKLSRCLLSPQCQVEAPESSSLRGWSLFIMETAIVGLSRPDQ
FT                   GLVSFEDLVVHFTQDEWDLLAPSQKTLYGDVMLETFRNFTDTGCEWEDQKIEDHFEEPE
FT                   INLRNIVTHSEYTQYEHEEYEEKPPDSNFLTSVEGYMETHTVNGPSECEVCLKSYGLYH
FT                   LTYNGHHNYEYKECVGSQPVRKSYECNQCGKTLSSYNSLQRHQKIHIEERPYKCQQCTK
FT                   AFRCLNALQSHERIHTGEKPYECKHCGTAFSRLTHLRLHEKVHTGEKHYECKQCNIVFK
FT                   SQSSYHRHKIMHGETFYNCKECGKSFIYPSLLQMHERTHTGEKPYECKLCGKTFRYHSS
FT                   IRLHERTHTGEKPYECKHCGKAFTRQSYLQFHERSHTGEKPYECKECGKAFRHHSYLRL
FT                   HERRHTGEKPYQCGQCGRSFSRQSSFKRHQSVHAVENPYKCQQYLIPLSLFPSNA"
FT   gene            <14131712..>14141397
FT                   /locus_tag="mCG_23318"
FT                   /note="gene_id=mCG23318.3"
FT   mRNA            join(<14131712..14131820,14136490..14136616,
FT                   14136801..14140116)
FT                   /locus_tag="mCG_23318"
FT                   /product="mCG23318, transcript variant mCT192556"
FT                   /note="gene_id=mCG23318.3 transcript_id=mCT192556.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<14131714..14131820,14136490..14136616,
FT                   14136801..14136861,14140170..>14141397)
FT                   /locus_tag="mCG_23318"
FT                   /product="mCG23318, transcript variant mCT23092"
FT                   /note="gene_id=mCG23318.3 transcript_id=mCT23092.2 created
FT                   on 18-JUN-2002"
FT   CDS             join(<14131788..14131820,14136490..14136616,
FT                   14136801..14136861,14140170..14141397)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23318"
FT                   /product="mCG23318, isoform CRA_b"
FT                   /note="gene_id=mCG23318.3 transcript_id=mCT23092.2
FT                   protein_id=mCP13290.2 isoform=CRA_b"
FT                   /protein_id="EDL28745.1"
FT                   /translation="GERGRARSRAMASVSFEDVAVHFTQDEWALLDSSQKSLYRDVMLE
FT                   TCRSLATIGYKWEDQNLEDHCINPGRNLRSYMFQTFCENEGDDQGGENLPWKPNLSMNM
FT                   RCSTGLTPWDHSMWGKASPSYSSSRHTTPHSQCTAHEQEKYVTKQYNSDSLRTFQRYMR
FT                   THVVNGPCECEVCLKYFGFPGTLEIHQETQSENNPYQYKEYGKTSVDISSLCTHGGAQA
FT                   VGKGYECNQCGKALSSYSSLRRHERIHTEKKPYKCKQCGKAFRYHSYLHLHERIHTGEK
FT                   PYECKRCGKAFIFPGALQVHEKIHTGEKRHECKHCGKAFRRHSDLQVHEKIHTGEKPYV
FT                   CKQCGRAFRLNSHRQRHEQTHTEDRPFICKQCGRSFECYSNLELHEKIHTGDRPFVCTE
FT                   CGKAFGCYSNLQLHEKIHTGDRPFVCKECGKAFICHGHLQRHETTHTGEKPYGCKQCGK
FT                   AFSRNSHLQRHERTHRQMSTCPRK"
FT   CDS             <14138956..14139345
FT                   /codon_start=1
FT                   /locus_tag="mCG_23318"
FT                   /product="mCG23318, isoform CRA_a"
FT                   /note="gene_id=mCG23318.3 transcript_id=mCT192556.0
FT                   protein_id=mCP113519.0 isoform=CRA_a"
FT                   /protein_id="EDL28744.1"
FT                   /translation="TFIEKGQALFAPAFLLAANMLLNFSSFVLHGVDGSTHPLHNESEH
FT                   FLIHGNLEQFHEEMLIGHKSLPLLIVSHMSLVYLAPALPQLALVFYHFVVHGCQLLVAW
FT                   VQEPWLGVVRERRKNRHTFNETVIR"
FT   gene            complement(14182159..>14193794)
FT                   /locus_tag="mCG_23322"
FT                   /note="gene_id=mCG23322.2"
FT   mRNA            complement(join(14182159..14184713,14185130..14185190,
FT                   14185358..14185484,14187705..14188003,14191147..14191254,
FT                   14193745..>14193794))
FT                   /locus_tag="mCG_23322"
FT                   /product="mCG23322, transcript variant mCT170214"
FT                   /note="gene_id=mCG23322.2 transcript_id=mCT170214.0 created
FT                   on 18-JUN-2002"
FT   mRNA            complement(join(14182159..14184713,14185130..14185190,
FT                   14185358..14185484,14187705..14188003,14193613..>14193777))
FT                   /locus_tag="mCG_23322"
FT                   /product="mCG23322, transcript variant mCT23096"
FT                   /note="gene_id=mCG23322.2 transcript_id=mCT23096.2 created
FT                   on 18-JUN-2002"
FT   mRNA            complement(join(14182650..14184713,14185130..14185190,
FT                   14185358..14185484,14187705..14188003,14191147..14191254,
FT                   14193613..>14193745))
FT                   /locus_tag="mCG_23322"
FT                   /product="mCG23322, transcript variant mCT192552"
FT                   /note="gene_id=mCG23322.2 transcript_id=mCT192552.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(14182650..14184713,14185358..14185484,
FT                   14187705..14188003,14193613..>14193720))
FT                   /locus_tag="mCG_23322"
FT                   /product="mCG23322, transcript variant mCT192553"
FT                   /note="gene_id=mCG23322.2 transcript_id=mCT192553.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(14183351..14184713,14185130..14185190,
FT                   14185358..14185484,14187705..>14187770))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23322"
FT                   /product="mCG23322, isoform CRA_a"
FT                   /note="gene_id=mCG23322.2 transcript_id=mCT192552.0
FT                   protein_id=mCP113520.0 isoform=CRA_a"
FT                   /protein_id="EDL28746.1"
FT                   /translation="RSSPGVLFIMEAAIVGLSRPDEGLVSFEDLVVHFTQDEWDLLAPS
FT                   QKTLYGDVMLETFRNFTAVGYEWEDEAIEDHCEDPEVNLRNIVTHSEYTQYEHEEYEEK
FT                   PPDSNFLTSVEGLEETKTSSGPSVCEVCLKTFGLYHLTYNGHHNYDYKELRGGHTEEND
FT                   SEGNQCEKTSGSLQKEDKIHTGKKLYVCQECGKAFRYPSALQLHERIHTGEKPYECKDC
FT                   GKAFRGLSALHLHERIHTGEKPYECKQCGRAFTYLSALQLHERIHTEERPCECKQCGKT
FT                   FRYSRALKLHERIHTGEKPYECKQCGKFFRSHRTLKLHKRIHTGEKPYECKECGKAFRW
FT                   LTSLKLHEKIHTGEKPYECQECGKAFRCQASYHRHKITHGGETLYECKECGKSFIYPSL
FT                   LQVHERTHTGEKPFECKLCGKAFRCQSSLRLHERTHTGEKPYECKHCGKAFSSYNYLRF
FT                   HERSHTGEKPYECKECGKTFTHRSYLRSHERRHTGEKPYQCGQCGRSFSRHSSFKRHQS
FT                   VHGESPYEQYLIPLSPFPSKE"
FT   CDS             complement(join(14183351..14184713,14185130..14185190,
FT                   14185358..14185484,14187705..>14187770))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23322"
FT                   /product="mCG23322, isoform CRA_a"
FT                   /note="gene_id=mCG23322.2 transcript_id=mCT170214.0
FT                   protein_id=mCP93039.0 isoform=CRA_a"
FT                   /protein_id="EDL28748.1"
FT                   /translation="RSSPGVLFIMEAAIVGLSRPDEGLVSFEDLVVHFTQDEWDLLAPS
FT                   QKTLYGDVMLETFRNFTAVGYEWEDEAIEDHCEDPEVNLRNIVTHSEYTQYEHEEYEEK
FT                   PPDSNFLTSVEGLEETKTSSGPSVCEVCLKTFGLYHLTYNGHHNYDYKELRGGHTEEND
FT                   SEGNQCEKTSGSLQKEDKIHTGKKLYVCQECGKAFRYPSALQLHERIHTGEKPYECKDC
FT                   GKAFRGLSALHLHERIHTGEKPYECKQCGRAFTYLSALQLHERIHTEERPCECKQCGKT
FT                   FRYSRALKLHERIHTGEKPYECKQCGKFFRSHRTLKLHKRIHTGEKPYECKECGKAFRW
FT                   LTSLKLHEKIHTGEKPYECQECGKAFRCQASYHRHKITHGGETLYECKECGKSFIYPSL
FT                   LQVHERTHTGEKPFECKLCGKAFRCQSSLRLHERTHTGEKPYECKHCGKAFSSYNYLRF
FT                   HERSHTGEKPYECKECGKTFTHRSYLRSHERRHTGEKPYQCGQCGRSFSRHSSFKRHQS
FT                   VHGESPYEQYLIPLSPFPSKE"
FT   CDS             complement(join(14183351..14184713,14185130..14185190,
FT                   14185358..14185484,14187705..>14187770))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23322"
FT                   /product="mCG23322, isoform CRA_a"
FT                   /note="gene_id=mCG23322.2 transcript_id=mCT23096.2
FT                   protein_id=mCP13269.2 isoform=CRA_a"
FT                   /protein_id="EDL28749.1"
FT                   /translation="RSSPGVLFIMEAAIVGLSRPDEGLVSFEDLVVHFTQDEWDLLAPS
FT                   QKTLYGDVMLETFRNFTAVGYEWEDEAIEDHCEDPEVNLRNIVTHSEYTQYEHEEYEEK
FT                   PPDSNFLTSVEGLEETKTSSGPSVCEVCLKTFGLYHLTYNGHHNYDYKELRGGHTEEND
FT                   SEGNQCEKTSGSLQKEDKIHTGKKLYVCQECGKAFRYPSALQLHERIHTGEKPYECKDC
FT                   GKAFRGLSALHLHERIHTGEKPYECKQCGRAFTYLSALQLHERIHTEERPCECKQCGKT
FT                   FRYSRALKLHERIHTGEKPYECKQCGKFFRSHRTLKLHKRIHTGEKPYECKECGKAFRW
FT                   LTSLKLHEKIHTGEKPYECQECGKAFRCQASYHRHKITHGGETLYECKECGKSFIYPSL
FT                   LQVHERTHTGEKPFECKLCGKAFRCQSSLRLHERTHTGEKPYECKHCGKAFSSYNYLRF
FT                   HERSHTGEKPYECKECGKTFTHRSYLRSHERRHTGEKPYQCGQCGRSFSRHSSFKRHQS
FT                   VHGESPYEQYLIPLSPFPSKE"
FT   CDS             complement(join(14183351..14184713,14185358..>14185437))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23322"
FT                   /product="mCG23322, isoform CRA_b"
FT                   /note="gene_id=mCG23322.2 transcript_id=mCT192553.0
FT                   protein_id=mCP113521.0 isoform=CRA_b"
FT                   /protein_id="EDL28747.1"
FT                   /translation="VGFAGSFPEDSLRRCDAGDLQELHCRRNIVTHSEYTQYEHEEYEE
FT                   KPPDSNFLTSVEGLEETKTSSGPSVCEVCLKTFGLYHLTYNGHHNYDYKELRGGHTEEN
FT                   DSEGNQCEKTSGSLQKEDKIHTGKKLYVCQECGKAFRYPSALQLHERIHTGEKPYECKD
FT                   CGKAFRGLSALHLHERIHTGEKPYECKQCGRAFTYLSALQLHERIHTEERPCECKQCGK
FT                   TFRYSRALKLHERIHTGEKPYECKQCGKFFRSHRTLKLHKRIHTGEKPYECKECGKAFR
FT                   WLTSLKLHEKIHTGEKPYECQECGKAFRCQASYHRHKITHGGETLYECKECGKSFIYPS
FT                   LLQVHERTHTGEKPFECKLCGKAFRCQSSLRLHERTHTGEKPYECKHCGKAFSSYNYLR
FT                   FHERSHTGEKPYECKECGKTFTHRSYLRSHERRHTGEKPYQCGQCGRSFSRHSSFKRHQ
FT                   SVHGESPYEQYLIPLSPFPSKE"
FT   gene            complement(<14219250..>14267945)
FT                   /gene="D330038O06Rik"
FT                   /locus_tag="mCG_23319"
FT                   /note="gene_id=mCG23319.2"
FT   mRNA            complement(join(<14219250..14219869,14221061..14221187,
FT                   14243253..14243388,14244244..14244304,14245732..14245858,
FT                   14251401..14251515))
FT                   /gene="D330038O06Rik"
FT                   /locus_tag="mCG_23319"
FT                   /product="RIKEN cDNA D330038O06, transcript variant
FT                   mCT23093"
FT                   /note="gene_id=mCG23319.2 transcript_id=mCT23093.2 created
FT                   on 18-JUN-2002"
FT   CDS             complement(join(14219250..14219869,14221061..14221187,
FT                   14243253..14243388,14244244..14244304,14245732..14245858,
FT                   14251401..14251403))
FT                   /codon_start=1
FT                   /gene="D330038O06Rik"
FT                   /locus_tag="mCG_23319"
FT                   /product="RIKEN cDNA D330038O06, isoform CRA_b"
FT                   /note="gene_id=mCG23319.2 transcript_id=mCT23093.2
FT                   protein_id=mCP13291.2 isoform=CRA_b"
FT                   /protein_id="EDL28751.1"
FT                   /translation="MDLVSFEDVAVHFTQDEWDLLDPFQKSLYRDVMLETCRNLAAIGY
FT                   IWEEQNVEDDCKNFGRIQRHVISDSEYLLDEQEGYGNKPYDSSSLTSIQGHMGAHTVNG
FT                   PCECEASVSFEDVAVHFTQDEWALLDSSQKSLYRDVMLEICRSLATIGTHQEAHSGKTP
FT                   YQYKECGKNSVCAHGGSPTMGKFYECNICGKALSSSTALQRHELIHTERFYECTYCGKA
FT                   FRYPKYLRLHERIHTGEKPYECKQCGKAFRFPGALPLHEKIHTGEKPYKCKQCGKAFRF
FT                   PGSLPLHEKIHTGEKPYECKQCGKAFRRHYHLQLHEKIHTGEKPYECKQCGKAFRRHSH
FT                   LQRHERTHGGEKPFECE"
FT   mRNA            complement(join(14239967..14240106,14243253..14243388,
FT                   14244244..14244304,14245732..14245858,14255109..14255268,
FT                   14267923..>14267945))
FT                   /gene="D330038O06Rik"
FT                   /locus_tag="mCG_23319"
FT                   /product="RIKEN cDNA D330038O06, transcript variant
FT                   mCT170213"
FT                   /note="gene_id=mCG23319.2 transcript_id=mCT170213.0 created
FT                   on 18-JUN-2002"
FT   CDS             complement(join(14240050..14240106,14243253..14243388,
FT                   14244244..14244304,14245732..14245858,14255109..>14255150))
FT                   /codon_start=1
FT                   /gene="D330038O06Rik"
FT                   /locus_tag="mCG_23319"
FT                   /product="RIKEN cDNA D330038O06, isoform CRA_a"
FT                   /note="gene_id=mCG23319.2 transcript_id=mCT170213.0
FT                   protein_id=mCP93063.0 isoform=CRA_a"
FT                   /protein_id="EDL28750.1"
FT                   /translation="QYRWDLLQRKISKQDLVSFEDVAVHFTQDEWDLLDPFQKSLYRDV
FT                   MLETCRNLAAIGYIWEEQNVEDDCKNFGRIQRHVISDSEYLLDEQEGYGNKPYDSSSLT
FT                   SIQGHMGAHTVNGPCECERPLSSQEHPLKRQQYATA"
FT   gene            14268008..14284518
FT                   /gene="Atp13a1"
FT                   /locus_tag="mCG_23321"
FT                   /note="gene_id=mCG23321.1"
FT   mRNA            join(14268008..14268411,14270519..14270608,
FT                   14270700..14270890,14273349..14273421,14273600..14273755,
FT                   14273852..14273921,14273995..14274101,14274477..14274606,
FT                   14274711..14274766,14275157..14275283,14275354..14275491,
FT                   14275582..14275702,14276091..14276248,14276532..14276707,
FT                   14276782..14276892,14277672..14277797,14278804..14278912,
FT                   14280230..14280429,14280510..14280606,14281990..14282147,
FT                   14282218..14282332,14282416..14282612,14283531..14283673,
FT                   14283767..14283878,14283962..14284105,14284189..14284518)
FT                   /gene="Atp13a1"
FT                   /locus_tag="mCG_23321"
FT                   /product="ATPase type 13A1"
FT                   /note="gene_id=mCG23321.1 transcript_id=mCT23095.1 created
FT                   on 18-JUN-2002"
FT   CDS             join(14268025..14268411,14270519..14270608,
FT                   14270700..14270890,14273349..14273421,14273600..14273755,
FT                   14273852..14273921,14273995..14274101,14274477..14274606,
FT                   14274711..14274766,14275157..14275283,14275354..14275491,
FT                   14275582..14275702,14276091..14276248,14276532..14276707,
FT                   14276782..14276892,14277672..14277797,14278804..14278912,
FT                   14280230..14280429,14280510..14280606,14281990..14282147,
FT                   14282218..14282332,14282416..14282612,14283531..14283673,
FT                   14283767..14283878,14283962..14284105,14284189..14284299)
FT                   /codon_start=1
FT                   /gene="Atp13a1"
FT                   /locus_tag="mCG_23321"
FT                   /product="ATPase type 13A1"
FT                   /note="gene_id=mCG23321.1 transcript_id=mCT23095.1
FT                   protein_id=mCP13309.2"
FT                   /db_xref="GOA:Q9EPE9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="MGI:MGI:2180801"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EPE9"
FT                   /protein_id="EDL28752.1"
FT                   /translation="MAVVGNAVPCGARPGGARDNGSPQPGSRLRPGLAAGPALIANGDE
FT                   LVAAVWPYRRLALLRRLTVLPFAGLLYPAWLGAAASGCWGWGSSWTQIPEAALLALATI
FT                   CLAHALTVLSGHWSVHAHCALTCTPEYDPNKVTFVKVVPTPNNGSTELVALHRDKGEDG
FT                   LEVLSFEFQKIKYSYDALEKKQFLPVAFPVGNAFSYYQSNRGFQEDSEIRAAEKKFGSN
FT                   KAEMVVPDFSELFKERATAPFFVFQVFCVGLWCLDEYWYYSVFTLSMLVAFEASLVQQQ
FT                   MRNMSEIRKMGNKPHMIQVYRSRKWRPVASDDIVPGDIVSIGRSPQENLVPCDVLLLRG
FT                   RCIVDEAMLTGESVPQMKEPIEDLSPDRVLDLQADARLHVIFGGTKVVQHIPPQKATSG
FT                   LKPVDNGCVAFVLRTGFNTSQGRLLRTILFGVKRVTANNLETFIFILFLLVFAIAAAAY
FT                   VWVEGTKDPSRNRYKLFLECTLILTSVVPPELPIELSLAVNTSLIALAKLYMYCTEPFR
FT                   IPFAGKVEVCCFDKTGTLTSDSLVVRGVAGLRDGKEVTPVSSIPIETHRALASCHSLMQ
FT                   LDDGTLVGDPLEKAMLTAVDWTLTKDEKVFPRSIKTQGLKIHQRFHFASALKRMSVLAS
FT                   YEKLGSTDLCYIAAVKGAPETLHSMFSQCPPDYHHIHTEISREGARVLALGYKELGHLT
FT                   HQQAREIKREALECSLKFVGFIVVSCPLKADSKAVIREIQNASHRVVMITGDNPLTACH
FT                   VAQELHFIDKAHTLILHPPSEKGQPCEWRSIDSSIVLPLTLGSPKALALEHALCLTGDG
FT                   LAHLQAVDPQQLLCLIPHVQVFARVAPKQKEFVITSLKELGYVTLMCGDGTNDVGALKH
FT                   ADVGVALLANAPERVVERRRRPRDSPVLSNSGPRVSRSTKQKSALLSPEEPPASHRDRL
FT                   SQVLRDLEEESTPIVKLGDASIAAPFTSKLSSIQCICHVIKQGRCTLVTTLQMFKILAL
FT                   NALILAYSQSVLYLEGVKFSDFQATLQGLLLAGCFLFISRSKPLKTLSRERPLPNIFNL
FT                   YTILTVMLQFSVHFLSLVYLYREAQARSPEKQEQFVDLYKEFEPSLVNSTVYIMAMAMQ
FT                   MATFAINYKGPPFMESLPENKPLVWSLAVSLLAIIGLLLGSSPDFNSQFGLVDIPVEFK
FT                   LVIGQVLALDFCLALLADRVLQFFLGTPKLRVPS"
FT   gene            <14285460..14298535
FT                   /gene="Gmip"
FT                   /locus_tag="mCG_130358"
FT                   /note="gene_id=mCG130358.1"
FT   mRNA            join(<14285460..14285590,14286516..14286600,
FT                   14287372..14287459,14287544..14287601,14287900..14288025,
FT                   14288110..14288174,14288275..14288382,14290360..14290440,
FT                   14290526..14290696,14290782..14290919,14291139..14291335,
FT                   14292179..14292288,14292359..14292436,14292796..14292873,
FT                   14292954..14293108,14293482..14293670,14293748..14293885,
FT                   14293978..14294174,14294465..14294852,14297178..14297244,
FT                   14297341..14298535)
FT                   /gene="Gmip"
FT                   /locus_tag="mCG_130358"
FT                   /product="Gem-interacting protein, transcript variant
FT                   mCT131681"
FT                   /note="gene_id=mCG130358.1 transcript_id=mCT131681.1
FT                   created on 18-JUN-2002"
FT   CDS             join(<14285461..14285590,14286516..14286600,
FT                   14287372..14287459,14287544..14287601,14287900..14288025,
FT                   14288110..14288174,14288275..14288382,14290360..14290440,
FT                   14290526..14290696,14290782..14290919,14291139..14291335,
FT                   14292179..14292288,14292359..14292436,14292796..14292873,
FT                   14292954..14293108,14293482..14293670,14293748..14293885,
FT                   14293978..14294174,14294465..14294852,14297178..14297244,
FT                   14297341..14297720)
FT                   /codon_start=1
FT                   /gene="Gmip"
FT                   /locus_tag="mCG_130358"
FT                   /product="Gem-interacting protein, isoform CRA_a"
FT                   /note="gene_id=mCG130358.1 transcript_id=mCT131681.1
FT                   protein_id=mCP54223.1 isoform=CRA_a"
FT                   /protein_id="EDL28753.1"
FT                   /translation="LGRQRQEIGLVPGGAQPCPFLSIAARSPPHPLPPGIAMDSAETEL
FT                   TPAPEGRKRYSDIFQSLDNLEISLGNVTFDPLAGDPVRREDLEPDKADTATVVTEENSE
FT                   ASSWRDLSPEGPAPLTEEELDLRLIRTKGGVDAALEYAKAWSRYAKELLAWTDKRANYE
FT                   LEFAKSIMKLAEAGKVSILQQSQMPLQYIYTLFLEHDLSLGALALETVAQQKRDYYQPL
FT                   AAKRMEIEKWRKEFKEQWLKEQKRMNEAVQALRRSELQYIQRREDLRARSQGSPEDPPS
FT                   QASPGSNKQQERRRRSREEAQAKAHEAEALYQACVREANSRQQDLETTKRRIVSHVRKL
FT                   VLQGDEVLRRVTLGLFELRGAQAERGPRSFSALAECCVPFEPGQRYQEFVRTLQPGAPP
FT                   PPSPAFCFQEFTAVVHSFPQDTKKKFSGPLPPRLEEEGSPEPGPWEVASLGSQGIPGSD
FT                   VDSVGGGSESRSLDSPTSSPGAGARRLVKASSTGTESSDDFEERDPDLGDGIENGVGSP
FT                   FRKWTLSTAAQTHRLRRLRGPAKCRECEAFMVSGTECEECFLTCHKRCLETLLILCGHR
FT                   RLPARMSLFGVDFLQLPRDFPEEVPFVITRCTAEIEHRALGLQGIYRVSGSRVRVERLC
FT                   QAFENGRALVELSGNSPHDITSVLKRFLQELTDPVVPFHLYDAFISLAKTLHADPGDDP
FT                   GTPNPSPEIIRSLKTLLVQLPDSNYSTLRHLVAHLFRVAARFEENKMSANNLGIVFGPT
FT                   LLRPPDGPRATGASPVACLLDSGHQAQLVEFLIVHYEQIFGMDELPLASEPLTQDPGLA
FT                   PACLESSPQHPASLLAQDTQPLTIALDSSPDPKHHSALEKCPEVTPPELATLQRDQREE
FT                   EVEDTRDGAGDGSSHCPEDLALGAQSRGHFSRQPVKYSRGGVRPVTHQLSSLALVASKL
FT                   CEETPVTVSAVHRGSLRVRGLGPAAACPEGSPLRRNPLPKHFEITQETARLLSKLNSDA
FT                   VSRTTCCADPEPEESEEHL"
FT   mRNA            join(<14285489..14285590,14286516..14286598,
FT                   14287372..14287459,14287544..14287601,14287900..14288025,
FT                   14288110..14288174,14288275..14288382,14290360..14290440,
FT                   14290526..14290696,14290782..14290919,14291139..14291335,
FT                   14292179..14292288,14292359..14292436,14292796..14292873,
FT                   14292954..14293108,14293482..14293670,14293748..14293885,
FT                   14293978..14294174,14294465..14294852,14297178..14297244,
FT                   14297341..14298421)
FT                   /gene="Gmip"
FT                   /locus_tag="mCG_130358"
FT                   /product="Gem-interacting protein, transcript variant
FT                   mCT192555"
FT                   /note="gene_id=mCG130358.1 transcript_id=mCT192555.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<14286522..14286598,14287372..14287459,
FT                   14287544..14287601,14287900..14288025,14288110..14288174,
FT                   14288275..14288382,14290360..14290440,14290526..14290696,
FT                   14290782..14290919,14291139..14291335,14292179..14292288,
FT                   14292359..14292436,14292796..14292873,14292954..14293108,
FT                   14293482..14293670,14293748..14293885,14293978..14294174,
FT                   14294465..14294852,14297178..14297244,14297341..14297720)
FT                   /codon_start=1
FT                   /gene="Gmip"
FT                   /locus_tag="mCG_130358"
FT                   /product="Gem-interacting protein, isoform CRA_b"
FT                   /note="gene_id=mCG130358.1 transcript_id=mCT192555.0
FT                   protein_id=mCP113505.0 isoform=CRA_b"
FT                   /protein_id="EDL28754.1"
FT                   /translation="PQLLRAGRDTVTSSRAWTTSRYHWGTTFDPLAGDPVRREDLEPDK
FT                   ADTATVVTEENSEASSWRDLSPEGPAPLTEEELDLRLIRTKGGVDAALEYAKAWSRYAK
FT                   ELLAWTDKRANYELEFAKSIMKLAEAGKVSILQQSQMPLQYIYTLFLEHDLSLGALALE
FT                   TVAQQKRDYYQPLAAKRMEIEKWRKEFKEQWLKEQKRMNEAVQALRRSELQYIQRREDL
FT                   RARSQGSPEDPPSQASPGSNKQQERRRRSREEAQAKAHEAEALYQACVREANSRQQDLE
FT                   TTKRRIVSHVRKLVLQGDEVLRRVTLGLFELRGAQAERGPRSFSALAECCVPFEPGQRY
FT                   QEFVRTLQPGAPPPPSPAFCFQEFTAVVHSFPQDTKKKFSGPLPPRLEEEGSPEPGPWE
FT                   VASLGSQGIPGSDVDSVGGGSESRSLDSPTSSPGAGARRLVKASSTGTESSDDFEERDP
FT                   DLGDGIENGVGSPFRKWTLSTAAQTHRLRRLRGPAKCRECEAFMVSGTECEECFLTCHK
FT                   RCLETLLILCGHRRLPARMSLFGVDFLQLPRDFPEEVPFVITRCTAEIEHRALGLQGIY
FT                   RVSGSRVRVERLCQAFENGRALVELSGNSPHDITSVLKRFLQELTDPVVPFHLYDAFIS
FT                   LAKTLHADPGDDPGTPNPSPEIIRSLKTLLVQLPDSNYSTLRHLVAHLFRVAARFEENK
FT                   MSANNLGIVFGPTLLRPPDGPRATGASPVACLLDSGHQAQLVEFLIVHYEQIFGMDELP
FT                   LASEPLTQDPGLAPACLESSPQHPASLLAQDTQPLTIALDSSPDPKHHSALEKCPEVTP
FT                   PELATLQRDQREEEVEDTRDGAGDGSSHCPEDLALGAQSRGHFSRQPVKYSRGGVRPVT
FT                   HQLSSLALVASKLCEETPVTVSAVHRGSLRVRGLGPAAACPEGSPLRRNPLPKHFEITQ
FT                   ETARLLSKLNSDAVSRTTCCADPEPEESEEHL"
FT   gene            14299338..14304849
FT                   /gene="Edg4"
FT                   /locus_tag="mCG_23088"
FT                   /note="gene_id=mCG23088.1"
FT   mRNA            join(14299338..14299434,14300281..14301018,
FT                   14303018..14304849)
FT                   /gene="Edg4"
FT                   /locus_tag="mCG_23088"
FT                   /product="endothelial differentiation, lysophosphatidic
FT                   acid G-protein-coupled receptor 4"
FT                   /note="gene_id=mCG23088.1 transcript_id=mCT23104.2 created
FT                   on 18-JUN-2002"
FT   CDS             join(14300286..14301018,14303018..14303331)
FT                   /codon_start=1
FT                   /gene="Edg4"
FT                   /locus_tag="mCG_23088"
FT                   /product="endothelial differentiation, lysophosphatidic
FT                   acid G-protein-coupled receptor 4"
FT                   /note="gene_id=mCG23088.1 transcript_id=mCT23104.2
FT                   protein_id=mCP13263.1"
FT                   /db_xref="GOA:Q6P290"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR004065"
FT                   /db_xref="InterPro:IPR004066"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1858422"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P290"
FT                   /protein_id="EDL28755.1"
FT                   /translation="MGQCYYNETIGFFYNNSGKELSLHWRPKDVVVVALGLTVSVLVLL
FT                   TNLLVIAAIASNRRFHQPIYYLLGNLAAADLFAGMAYLFLMFHTGPRTARLSIKGWFLR
FT                   QGLLDTSLTASVATLLAIAVERHRSVMAVQLHSRLPRGRVVTLIVGVWAAALGLGLLPA
FT                   HFWHCLCDLDSCSRMVPLFSRSYLAAWALSSLLVFLLMVAVYTRIFFYVRRRVERMAEH
FT                   VSCHPRYRETTLSLVKTVVIILGAFVVCWTPGQVVLLLDGLDCKSCNVLAVEKYFLLLA
FT                   EANSLVNAVVYSCRDAEMRRTFRRLLCCMCLRWSSHKSARYSASAQTGASTRIMLPENG
FT                   RPLMDSTL"
FT   gene            <14309386..14356884
FT                   /locus_tag="mCG_23084"
FT                   /note="gene_id=mCG23084.2"
FT   mRNA            join(<14309386..14309578,14343455..14343528,
FT                   14354622..14354775,14355171..14355277,14356588..14356884)
FT                   /locus_tag="mCG_23084"
FT                   /product="mCG23084, transcript variant mCT23099"
FT                   /note="gene_id=mCG23084.2 transcript_id=mCT23099.2 created
FT                   on 30-SEP-2002"
FT   mRNA            join(<14309401..14309578,14343455..14343528,
FT                   14355171..14355277,14356588..14356864)
FT                   /locus_tag="mCG_23084"
FT                   /product="mCG23084, transcript variant mCT170193"
FT                   /note="gene_id=mCG23084.2 transcript_id=mCT170193.0 created
FT                   on 30-SEP-2002"
FT   mRNA            join(<14309422..14309578,14343455..14343528,
FT                   14349500..14349616,14351093..14351228,14354622..14354775,
FT                   14355171..14355277,14356588..14356883)
FT                   /locus_tag="mCG_23084"
FT                   /product="mCG23084, transcript variant mCT170194"
FT                   /note="gene_id=mCG23084.2 transcript_id=mCT170194.0 created
FT                   on 30-SEP-2002"
FT   CDS             join(<14309433..14309578,14343455..14343528,
FT                   14355171..14355277,14356588..14356680)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23084"
FT                   /product="mCG23084, isoform CRA_e"
FT                   /note="gene_id=mCG23084.2 transcript_id=mCT170193.0
FT                   protein_id=mCP93051.0 isoform=CRA_e"
FT                   /protein_id="EDL28760.1"
FT                   /translation="PMAAPLRPVPPQPAPRRLPTTAPLGHDTSDVLQQIMAITDQSLDE
FT                   AQARKHALNCHRMKSALFSVLCEIKGKTGPCGPLPLTNGSDVVLTLRTLAFLQPPTGGV
FT                   CLQPLVHSNWQRAAPQPASSPAGESGSFNSDAASN"
FT   mRNA            join(<14309453..14309578,14343455..14343528,
FT                   14351093..14351228,14354622..14354775,14355171..14355277,
FT                   14356588..14356805)
FT                   /locus_tag="mCG_23084"
FT                   /product="mCG23084, transcript variant mCT170196"
FT                   /note="gene_id=mCG23084.2 transcript_id=mCT170196.0 created
FT                   on 30-SEP-2002"
FT   mRNA            join(<14309475..14309578,14343455..14343528,
FT                   14351093..14351228,14355171..14355231)
FT                   /locus_tag="mCG_23084"
FT                   /product="mCG23084, transcript variant mCT170195"
FT                   /note="gene_id=mCG23084.2 transcript_id=mCT170195.0 created
FT                   on 30-SEP-2002"
FT   mRNA            join(<14309505..14309578,14343455..14343528,
FT                   14348914..14349152,14349426..14349616,14351093..14351228,
FT                   14354622..14354775,14355171..14355277,14356588..14356884)
FT                   /locus_tag="mCG_23084"
FT                   /product="mCG23084, transcript variant mCT170197"
FT                   /note="gene_id=mCG23084.2 transcript_id=mCT170197.0 created
FT                   on 30-SEP-2002"
FT   CDS             join(<14309505..14309578,14343455..14343528,
FT                   14348914..14349152,14349426..14349616,14351093..14351228,
FT                   14354622..14354775,14355171..14355277,14356588..14356680)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23084"
FT                   /product="mCG23084, isoform CRA_c"
FT                   /note="gene_id=mCG23084.2 transcript_id=mCT170197.0
FT                   protein_id=mCP93061.0 isoform=CRA_c"
FT                   /protein_id="EDL28758.1"
FT                   /translation="GHDTSDVLQQIMAITDQSLDEAQARKHALNCHRMKSALFSVLCEI
FT                   KGKTAVSIQFQEEDPPDAQLLRLDNMLLAEGVSRPEKRGRGAAAGSTATPGGCPNDNSI
FT                   EHSDYRAKLSQIRQIYHSELEKYEQACREFTTHVTNLLREQSRVRPVSCREMEHMVNTI
FT                   QSKFSAIQRQLKQSTCEAVMTLRSRFLDARRKRRNFSKQATDVLNEYFYSHLSNPYPSE
FT                   ETKEELARKGGITVSQVSNWFGNKRIRYKKNTGKFQEEATMYTGKASTVTKARRPRGQS
FT                   SCQSTPSPGPCGPLPLTNGSDVVLTLRTLAFLQPPTGGVCLQPLVHSNWQRAAPQPASS
FT                   PAGESGSFNSDAASN"
FT   CDS             join(<14309513..14309578,14343455..14343528,
FT                   14349500..14349616,14351093..14351228,14354622..14354775,
FT                   14355171..14355277,14356588..14356680)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23084"
FT                   /product="mCG23084, isoform CRA_a"
FT                   /note="gene_id=mCG23084.2 transcript_id=mCT170194.0
FT                   protein_id=mCP93054.0 isoform=CRA_a"
FT                   /protein_id="EDL28756.1"
FT                   /translation="HERRPAADHGHHRPEPGRGSGQKACPELPSDEVCSLQCALRDQGE
FT                   DWEMEHMVNTIQSKFSAIQRQLKQSTCEAVMTLRSRFLDARRKRRNFSKQATDVLNEYF
FT                   YSHLSNPYPSEETKEELARKGGITVSQVSNWFGNKRIRYKKNTGKFQEEATMYTGKAST
FT                   VTKARRPRGQSSCQSTPSPGPCGPLPLTNGSDVVLTLRTLAFLQPPTGGVCLQPLVHSN
FT                   WQRAAPQPASSPAGESGSFNSDAASN"
FT   CDS             join(<14309513..14309578,14343455..14343528,
FT                   14351093..14351228,14354622..14354775,14355171..14355277,
FT                   14356588..14356680)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23084"
FT                   /product="mCG23084, isoform CRA_f"
FT                   /note="gene_id=mCG23084.2 transcript_id=mCT170196.0
FT                   protein_id=mCP93050.0 isoform=CRA_f"
FT                   /protein_id="EDL28761.1"
FT                   /translation="HERRPAADHGHHRPEPGRGSGQKACPELPSDEVCSLQCALRDQGE
FT                   DWRKRRNFSKQATDVLNEYFYSHLSNPYPSEETKEELARKGGITVSQVSNWFGNKRIRY
FT                   KKNTGKFQEEATMYTGKASTVTKARRPRGQSSCQSTPSPGPCGPLPLTNGSDVVLTLRT
FT                   LAFLQPPTGGVCLQPLVHSNWQRAAPQPASSPAGESGSFNSDAASN"
FT   CDS             join(<14309513..14309578,14343455..14343528,
FT                   14351093..14351228,14355171..14355194)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23084"
FT                   /product="mCG23084, isoform CRA_b"
FT                   /note="gene_id=mCG23084.2 transcript_id=mCT170195.0
FT                   protein_id=mCP93043.0 isoform=CRA_b"
FT                   /protein_id="EDL28757.1"
FT                   /translation="HERRPAADHGHHRPEPGRGSGQKACPELPSDEVCSLQCALRDQGE
FT                   DWRKRRNFSKQATDVLNEYFYSHLSNPYPSEETKEELARKGGITVSQVPVAPCH"
FT   CDS             join(<14343484..14343528,14354622..14354775,
FT                   14355171..14355277,14356588..14356680)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23084"
FT                   /product="mCG23084, isoform CRA_d"
FT                   /note="gene_id=mCG23084.2 transcript_id=mCT23099.2
FT                   protein_id=mCP13284.1 isoform=CRA_d"
FT                   /protein_id="EDL28759.1"
FT                   /translation="SLLSSVCSARSRGRLVSNWFGNKRIRYKKNTGKFQEEATMYTGKA
FT                   STVTKARRPRGQSSCQSTPSPGPCGPLPLTNGSDVVLTLRTLAFLQPPTGGVCLQPLVH
FT                   SNWQRAAPQPASSPAGESGSFNSDAASN"
FT   gene            complement(14364841..>14371825)
FT                   /locus_tag="mCG_140599"
FT                   /note="gene_id=mCG140599.0"
FT   mRNA            complement(join(14364841..14367682,14367774..14367931,
FT                   14368465..14368573,14368761..14369087,14369862..14370047,
FT                   14370470..14370742,14370908..14371006,14371762..>14371825))
FT                   /locus_tag="mCG_140599"
FT                   /product="mCG140599"
FT                   /note="gene_id=mCG140599.0 transcript_id=mCT170192.0
FT                   created on 19-JUN-2002"
FT   CDS             complement(join(14365332..14367682,14367774..14367931,
FT                   14368465..14368573,14368761..14369087,14369862..14370047,
FT                   14370470..14370742,14370908..14371006,14371762..14371825))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140599"
FT                   /product="mCG140599"
FT                   /note="gene_id=mCG140599.0 transcript_id=mCT170192.0
FT                   protein_id=mCP93066.0"
FT                   /protein_id="EDL28762.1"
FT                   /translation="MASPLPLLYLCLAALHLAGARDATPTEEHTSTARGLQGRPPDTGQ
FT                   PSPALEDWEEASEWTSWFNVDHPGGDGDFESLAAIRFYYGPARVCPRPLALEARTTDWA
FT                   LPAAMGERVHANPERGFWCLNREQPRGRRCSNYHVRFRCPLDATHLPPCSAEAAWGAWG
FT                   AWGLCSKSCGLGRRLRRRSCQSSSGDTCPGSPQEAQKCVRSRCPALPKSSLCACRFHVP
FT                   LGCSSDTCGCPNHILLGSVVTPSGRPLSGARVSLRTRPGTIATSGTHGTFQVPGVCAGS
FT                   KASVSAQMNGFSAGTAQAHANSSNTATVTIILEELGKPYLVKHPESRVREAGQNVTFCC
FT                   KASGTPMPKKYSWFHNGTLLDRRQQGSGPHLELQGLHQAQAGEYHCKAWNEAGTVRSRA
FT                   ALLTILAPGQQACDPRPQEHLIKLPDDCGQPGGGPTYLDVGLCADTRCPGPVGSGPRCG
FT                   DAGSRCCSVLRLESRDIRCSGYVLPVKVVAECGCRKCLPRRGLVRGRVVAADSGEPLRF
FT                   ARILLGRAPIGFTSYQGDFTIEVPPATERLVVTFVDPSGDFVDSVRVLPFDPRGAGVYH
FT                   EIRALRKAAAVLLDAERGGEIPLGSTEEAPALGELVLPPGTFHHPDGRPYTGPVEARVT
FT                   FVDPRDLASASAASSDLRFLDSAGELAPLRTYGMFAVDLRAPGSTEQLHVARADVHVDA
FT                   DHVRMPGHAEALALWSLDPETGLWEEEGSEQGSGGFRRETAAARVRREERAFLVGALTM
FT                   RERRLFNLDVPERRRCFVKVRAYGTDRFAPAEQVQGVVVTLLNLEPAPGFTANPRAWGR
FT                   FDSSVTGPNGACVPAFCDAEKPDAYTAFVTAALGGEELEAAPSRPRATAAVVGVAQPYL
FT                   ERLGYQRTDHDDPALKRTGFRLNLARPRAGHESEAHGPVYPWRRLRDCEDAPVTDSHFR
FT                   FSRVEADKYEYDVVPFHEGAPASWTGDLLAWWPNPQEFRACFLKVRLQGPQEYMVRSHN
FT                   AGGTHEATRGRLYGLRDTRSVRHPERPGASAACVEFKCGGMLFDQRQVDRTLVTVTPQG
FT                   SCRRVAVNTLLQDYLARHPPLAAADDPAAFAMLAPLDALGHNYGVYTVTDQSPRLAKEI
FT                   AIGRCFDGSSDGFSREMKADAGTAVTFQCREPPARPSLFQRLLENPSSALGDIRREMGQ
FT                   ATRYSRVNQTQAGDTGPFGPGQ"
FT   gene            complement(14371960..14376495)
FT                   /locus_tag="mCG_23087"
FT                   /note="gene_id=mCG23087.1"
FT   mRNA            complement(join(14371960..14372493,14373458..14373608,
FT                   14373680..14373793,14373914..14374024,14375342..14376495))
FT                   /locus_tag="mCG_23087"
FT                   /product="mCG23087"
FT                   /note="gene_id=mCG23087.1 transcript_id=mCT23103.2 created
FT                   on 19-JUN-2002"
FT   CDS             complement(join(14372288..14372493,14373458..14373608,
FT                   14373680..14373793,14373914..14374024,14375342..14375473))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23087"
FT                   /product="mCG23087"
FT                   /note="gene_id=mCG23087.1 transcript_id=mCT23103.2
FT                   protein_id=mCP13307.2"
FT                   /protein_id="EDL28763.1"
FT                   /translation="MLPTSACSASEAAALERELLEEYRFGRQQLVELCGHASAVAVTKA
FT                   FPLPSLSRKQRTVLVVCGPEQNGAVGLACARHLRVFEYQPSIFCPARSADALHRDLTTQ
FT                   CEKMDIPFLSFLPAEVRLIDDAYGLVVDAVLGPGVRLAEAGGHCARALATLKRLSIPLV
FT                   SLDVPSGWDAEAGGDAKDAVQPDVLVSLAAPKSCAGRFSGRLHFVAGRFVPDDVRRKFG
FT                   LHLPKYTGTDCVASL"
FT   gene            complement(14378626..14388121)
FT                   /gene="Ndufa13"
FT                   /locus_tag="mCG_23089"
FT                   /note="gene_id=mCG23089.4"
FT   mRNA            complement(join(14378626..14378871,14378965..14379036,
FT                   14379703..14379781,14387105..14387295,14387444..14388121))
FT                   /gene="Ndufa13"
FT                   /locus_tag="mCG_23089"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 13, transcript variant mCT23101"
FT                   /note="gene_id=mCG23089.4 transcript_id=mCT23101.3 created
FT                   on 24-JUN-2004"
FT   mRNA            complement(join(14378626..14378871,14378965..14379036,
FT                   14379703..14379781,14387105..14387295,14387500..14387568))
FT                   /gene="Ndufa13"
FT                   /locus_tag="mCG_23089"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 13, transcript variant mCT170200"
FT                   /note="gene_id=mCG23089.4 transcript_id=mCT170200.2 created
FT                   on 24-JUN-2004"
FT   mRNA            complement(join(14378626..14378871,14378965..14379036,
FT                   14379703..14379781,14386774..14387062))
FT                   /gene="Ndufa13"
FT                   /locus_tag="mCG_23089"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 13, transcript variant mCT170199"
FT                   /note="gene_id=mCG23089.4 transcript_id=mCT170199.1 created
FT                   on 24-JUN-2004"
FT   mRNA            complement(join(14378626..14378871,14378965..14379036,
FT                   14379703..14380019))
FT                   /gene="Ndufa13"
FT                   /locus_tag="mCG_23089"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 13, transcript variant mCT170202"
FT                   /note="gene_id=mCG23089.4 transcript_id=mCT170202.2 created
FT                   on 24-JUN-2004"
FT   CDS             complement(join(14378682..14378871,14378965..14379036,
FT                   14379703..14379781,14387105..14387198))
FT                   /codon_start=1
FT                   /gene="Ndufa13"
FT                   /locus_tag="mCG_23089"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 13, isoform CRA_b"
FT                   /note="gene_id=mCG23089.4 transcript_id=mCT170200.2
FT                   protein_id=mCP93065.2 isoform=CRA_b"
FT                   /protein_id="EDL28765.1"
FT                   /translation="MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFAVGIGALIF
FT                   GYWRMMRWNQERRRLLIEDLEARIALMPLFQAEKDRRTLQILRENLEEEAIIMKDVPNW
FT                   KVGESVFHTTRWVPPLIGEMYGLRTKEEMSNANFGFTWYT"
FT   CDS             complement(join(14378682..14378871,14378965..14379036,
FT                   14379703..14379781,14387105..14387198))
FT                   /codon_start=1
FT                   /gene="Ndufa13"
FT                   /locus_tag="mCG_23089"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 13, isoform CRA_b"
FT                   /note="gene_id=mCG23089.4 transcript_id=mCT23101.3
FT                   protein_id=mCP13266.3 isoform=CRA_b"
FT                   /protein_id="EDL28767.1"
FT                   /translation="MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFAVGIGALIF
FT                   GYWRMMRWNQERRRLLIEDLEARIALMPLFQAEKDRRTLQILRENLEEEAIIMKDVPNW
FT                   KVGESVFHTTRWVPPLIGEMYGLRTKEEMSNANFGFTWYT"
FT   CDS             complement(join(14378682..14378871,14378965..14379036,
FT                   14379703..14379781,14386774..14386783))
FT                   /codon_start=1
FT                   /gene="Ndufa13"
FT                   /locus_tag="mCG_23089"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 13, isoform CRA_a"
FT                   /note="gene_id=mCG23089.4 transcript_id=mCT170199.1
FT                   protein_id=mCP93056.1 isoform=CRA_a"
FT                   /protein_id="EDL28764.1"
FT                   /translation="MLIGYSMFAVGIGALIFGYWRMMRWNQERRRLLIEDLEARIALMP
FT                   LFQAEKDRRTLQILRENLEEEAIIMKDVPNWKVGESVFHTTRWVPPLIGEMYGLRTKEE
FT                   MSNANFGFTWYT"
FT   CDS             complement(join(14378682..14378871,14378965..14379036,
FT                   14379703..14379773))
FT                   /codon_start=1
FT                   /gene="Ndufa13"
FT                   /locus_tag="mCG_23089"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 13, isoform CRA_c"
FT                   /note="gene_id=mCG23089.4 transcript_id=mCT170202.2
FT                   protein_id=mCP93053.2 isoform=CRA_c"
FT                   /protein_id="EDL28766.1"
FT                   /translation="MFAVGIGALIFGYWRMMRWNQERRRLLIEDLEARIALMPLFQAEK
FT                   DRRTLQILRENLEEEAIIMKDVPNWKVGESVFHTTRWVPPLIGEMYGLRTKEEMSNANF
FT                   GFTWYT"
FT   gene            14387778..14389079
FT                   /gene="Tssk6"
FT                   /locus_tag="mCG_49382"
FT                   /note="gene_id=mCG49382.1"
FT   mRNA            14387778..14389079
FT                   /gene="Tssk6"
FT                   /locus_tag="mCG_49382"
FT                   /product="testis-specific serine kinase 6"
FT                   /note="gene_id=mCG49382.1 transcript_id=mCT49565.1 created
FT                   on 19-JUN-2002"
FT   CDS             14387871..14388692
FT                   /codon_start=1
FT                   /gene="Tssk6"
FT                   /locus_tag="mCG_49382"
FT                   /product="testis-specific serine kinase 6"
FT                   /note="gene_id=mCG49382.1 transcript_id=mCT49565.1
FT                   protein_id=mCP34711.2"
FT                   /protein_id="EDL28768.1"
FT                   /translation="MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDR
FT                   RRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRN
FT                   GRIPGSQARELFSQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKITDFGFGRQAHG
FT                   YPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSLGVVLYVMVTGCMPFDDSDIAGLPR
FT                   RQKRGVLYPDGLELSERCKSLIAELLQFSPSARPSAGQVARNGWLRAGDSG"
FT   gene            <14392633..>14393265
FT                   /locus_tag="mCG_140596"
FT                   /note="gene_id=mCG140596.0"
FT   mRNA            join(<14392633..14393053,14393160..>14393265)
FT                   /locus_tag="mCG_140596"
FT                   /product="mCG140596"
FT                   /note="gene_id=mCG140596.0 transcript_id=mCT170186.0
FT                   created on 19-JUN-2002"
FT   CDS             join(<14392824..14393053,14393160..>14393265)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140596"
FT                   /product="mCG140596"
FT                   /note="gene_id=mCG140596.0 transcript_id=mCT170186.0
FT                   protein_id=mCP93059.0"
FT                   /protein_id="EDL28769.1"
FT                   /translation="CNLHIEDQKTDHFLETIQGLQADMTHGEDHPSPQQHSGCLRAWRC
FT                   LLQPALTTLTTAWGKLWLPWGGGEDRDQVWRLLFIGPLSQTTKPRSHICQKVWFDKYRC
FT                   VLCLAPPF"
FT   gene            complement(14393462..>14481040)
FT                   /gene="Gatad2a"
FT                   /locus_tag="mCG_23085"
FT                   /note="gene_id=mCG23085.2"
FT   mRNA            complement(join(14393462..14395645,14397348..14397540,
FT                   14397835..14397909,14398594..14398895,14400190..14400469,
FT                   14401955..14402122,14402240..14402371,14403114..14403203,
FT                   14403394..14403525,14403617..14403749,14421445..14421702,
FT                   14436203..14436304,14459648..>14459827))
FT                   /gene="Gatad2a"
FT                   /locus_tag="mCG_23085"
FT                   /product="GATA zinc finger domain containing 2A, transcript
FT                   variant mCT23100"
FT                   /note="gene_id=mCG23085.2 transcript_id=mCT23100.2 created
FT                   on 19-JUN-2002"
FT   mRNA            complement(join(14393518..14395645,14397348..14397540,
FT                   14397835..14397909,14398594..14398895,14400190..14400469,
FT                   14401955..14402122,14402231..14402371,14403114..14403203,
FT                   14403394..14403525,14403617..14403749,14421445..14421702,
FT                   14436203..14436304,14480664..>14481040))
FT                   /gene="Gatad2a"
FT                   /locus_tag="mCG_23085"
FT                   /product="GATA zinc finger domain containing 2A, transcript
FT                   variant mCT170198"
FT                   /note="gene_id=mCG23085.2 transcript_id=mCT170198.0 created
FT                   on 19-JUN-2002"
FT   CDS             complement(join(14395515..14395645,14397348..14397540,
FT                   14397835..14397909,14398594..14398895,14400190..14400469,
FT                   14401955..14402122,14402231..14402371,14403114..14403203,
FT                   14403394..14403525,14403617..14403749,14421445..14421702,
FT                   14436203..14436304,14480664..>14480872))
FT                   /codon_start=1
FT                   /gene="Gatad2a"
FT                   /locus_tag="mCG_23085"
FT                   /product="GATA zinc finger domain containing 2A, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23085.2 transcript_id=mCT170198.0
FT                   protein_id=mCP93052.0 isoform=CRA_a"
FT                   /protein_id="EDL28770.1"
FT                   /translation="DRAAALSAPRQLLPPGVSAPARARAPSLPERAPRRPREPSPWDAT
FT                   RPDPSALPEVGLGPSCRSRGAEQLRLASTLSQHIHISCLLTELWPWQHGRIRVPDPEAR
FT                   MSEEACRTRSQKRTLEPDLTEDDVENKKMKMEKGSSELTVDGDSRVMPEPSAGSAQGLL
FT                   RTTEAMGTGSGEGLLGDGPVDMRTSHSDMKSEKRPPSPDVIVLSDSEQPSSPRVNGLTT
FT                   VALKDTSTEALLKSSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPTA
FT                   SSGSTVTTPPPLVRGTQNIPAGKTSLQTSSTRIPGSIIPPPLVRGGQQVSAKLGPQASS
FT                   QVVMPPLVRGAQVSQQIHNIRQHSSTGPPPLLLAPRASVPSMQIQGQRIIQQGLIRVAN
FT                   VPNTSLLVNIPQPTAASMKGTAVASAQANSTPTSVASVVASAESPASRQAAAKLALRKQ
FT                   LEKTLLEIPPPKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQAGRISATAAAAVL
FT                   SREPYMCVQCKTDFTCRWREKGGAVMCENCMTSNQKKALKVEHTSRLKAAFVKALQQEQ
FT                   EMEQRLLQQGVGTASIKAEPAAPHPTLKQVIKPRRKLAFRSGEARVWNNGSSLQASSQL
FT                   SRGSATAPRGVLHTFSQSPKLQNAASATALVSRTGRHSERVVGTGKGTASNWKKTPLST
FT                   GGTLAFVSPSLAVHKTSSAVDRQREYLLDMIPPRSIPQSATWK"
FT   CDS             complement(join(14395515..14395645,14397348..14397540,
FT                   14397835..14397909,14398594..14398895,14400190..14400469,
FT                   14401955..14402122,14402240..14402371,14403114..14403203,
FT                   14403394..14403525,14403617..14403749,14421445..14421702,
FT                   14436203..14436304,14459648..>14459826))
FT                   /codon_start=1
FT                   /gene="Gatad2a"
FT                   /locus_tag="mCG_23085"
FT                   /product="GATA zinc finger domain containing 2A, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23085.2 transcript_id=mCT23100.2
FT                   protein_id=mCP13287.2 isoform=CRA_b"
FT                   /protein_id="EDL28771.1"
FT                   /translation="PCVRPRGALSGRRRGRAERRSERRGPGRPLRRSEHARPAPPAPSP
FT                   VDTRAAPGPGRRAAGLASTLSQHIHISCLLTELWPWQHGRIRVPDPEARMSEEACRTRS
FT                   QKRTLEPDLTEDDVENKKMKMEKGSSELTVDGDSRVMPEPSAGSAQGLLRTTEAMGTGS
FT                   GEGLLGDGPVDMRTSHSDMKSEKRPPSPDVIVLSDSEQPSSPRVNGLTTVALKDTSTEA
FT                   LLKSSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPTASSGSTVTTPP
FT                   PLVRGTQNIPAGKTSLQTSSTRIPGSIIPPPLVRGGQQVSAKLGPQASSQVVMPPLVRG
FT                   AQQIHNIRQHSSTGPPPLLLAPRASVPSMQIQGQRIIQQGLIRVANVPNTSLLVNIPQP
FT                   TAASMKGTAVASAQANSTPTSVASVVASAESPASRQAAAKLALRKQLEKTLLEIPPPKP
FT                   PAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQAGRISATAAAAVLSREPYMCVQCKTD
FT                   FTCRWREKGGAVMCENCMTSNQKKALKVEHTSRLKAAFVKALQQEQEMEQRLLQQGVGT
FT                   ASIKAEPAAPHPTLKQVIKPRRKLAFRSGEARVWNNGSSLQASSQLSRGSATAPRGVLH
FT                   TFSQSPKLQNAASATALVSRTGRHSERVVGTGKGTASNWKKTPLSTGGTLAFVSPSLAV
FT                   HKTSSAVDRQREYLLDMIPPRSIPQSATWK"
FT   gene            complement(14496477..>14497107)
FT                   /locus_tag="mCG_23090"
FT                   /note="gene_id=mCG23090.2"
FT   mRNA            complement(14496477..>14497107)
FT                   /locus_tag="mCG_23090"
FT                   /product="mCG23090"
FT                   /note="gene_id=mCG23090.2 transcript_id=mCT23105.2 created
FT                   on 19-JUN-2002"
FT   CDS             complement(14496681..>14496965)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23090"
FT                   /product="mCG23090"
FT                   /note="gene_id=mCG23090.2 transcript_id=mCT23105.2
FT                   protein_id=mCP13268.1"
FT                   /protein_id="EDL28772.1"
FT                   /translation="FEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGP
FT                   VVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSD"
FT   gene            complement(14502175..>14528779)
FT                   /gene="9130404D08Rik"
FT                   /locus_tag="mCG_23097"
FT                   /note="gene_id=mCG23097.2"
FT   mRNA            complement(join(14502175..14504780,14504905..14505712,
FT                   14505799..14505926,14506472..14506562,14508188..14508299,
FT                   14508408..14508485,14508672..14508721,14509666..14509749,
FT                   14511880..14511945,14512226..14512303,14512725..14512828,
FT                   14513517..14513607,14513674..14513820,14514671..14514826,
FT                   14515260..14515287,14516694..14516788,14517515..14517610,
FT                   14519225..14519290,14519657..14519674,14528436..>14528779))
FT                   /gene="9130404D08Rik"
FT                   /locus_tag="mCG_23097"
FT                   /product="RIKEN cDNA 9130404D08"
FT                   /note="gene_id=mCG23097.2 transcript_id=mCT23113.2 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(14505638..14505712,14505799..14505926,
FT                   14506472..14506562,14508188..14508299,14508408..14508485,
FT                   14508672..14508721,14509666..14509749,14511880..14511945,
FT                   14512226..14512303,14512725..14512828,14513517..14513607,
FT                   14513674..14513820,14514671..14514826,14515260..14515287,
FT                   14516694..14516788,14517515..14517610,14519225..14519290,
FT                   14519657..14519674,14528436..>14528777))
FT                   /codon_start=1
FT                   /gene="9130404D08Rik"
FT                   /locus_tag="mCG_23097"
FT                   /product="RIKEN cDNA 9130404D08"
FT                   /note="gene_id=mCG23097.2 transcript_id=mCT23113.2
FT                   protein_id=mCP13289.2"
FT                   /protein_id="EDL28773.1"
FT                   /translation="GASASLWRRLVVVRAKMAAQAAAAAQAAAAAQAAAAQAAQAEAAE
FT                   SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFPFKPPQRIEARTHLQLGSVLYHHTKNS
FT                   EQARSHLEKAWLISQQIPQFEDVKFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTP
FT                   YWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERK
FT                   LQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQC
FT                   IQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALM
FT                   QLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSPRLFSNH
FT                   AAQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNHQELWAFIVTNLASVYIREGNRHQEL
FT                   YSLLERINPDHSFPVSSHCLRAAAFYVRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNR
FT                   LTACSLVLLGHIFYVLGNHRESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNA
FT                   MDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL"
FT   gene            <14528857..14558151
FT                   /gene="Sf4"
FT                   /locus_tag="mCG_23093"
FT                   /note="gene_id=mCG23093.1"
FT   mRNA            join(<14528857..14529124,14534549..14534720,
FT                   14538645..14538745,14542192..14542410,14545100..14545211,
FT                   14545559..14545659,14546342..14546465,14550643..14551004,
FT                   14555258..14555364,14555802..14555979,14556137..14556243,
FT                   14556920..14557065,14557328..14557457,14557612..14558151)
FT                   /gene="Sf4"
FT                   /locus_tag="mCG_23093"
FT                   /product="splicing factor 4, transcript variant mCT23110"
FT                   /note="gene_id=mCG23093.1 transcript_id=mCT23110.2 created
FT                   on 19-JUN-2002"
FT   mRNA            join(<14528858..14529124,14534549..14534720,
FT                   14538645..14538745,14542192..14542410,14545088..14545211,
FT                   14545559..14545659,14546342..14546465,14550643..14551004,
FT                   14555258..14555364,14555802..14555979,14556137..14556243,
FT                   14556920..14557065,14557328..14557457,14557612..14558135)
FT                   /gene="Sf4"
FT                   /locus_tag="mCG_23093"
FT                   /product="splicing factor 4, transcript variant mCT170203"
FT                   /note="gene_id=mCG23093.1 transcript_id=mCT170203.0 created
FT                   on 19-JUN-2002"
FT   CDS             join(<14528944..14529124,14534549..14534720,
FT                   14538645..14538745,14542192..14542410,14545088..14545211,
FT                   14545559..14545659,14546342..14546465,14550643..14551004,
FT                   14555258..14555364,14555802..14555979,14556137..14556243,
FT                   14556920..14557065,14557328..14557457,14557612..14557638)
FT                   /codon_start=1
FT                   /gene="Sf4"
FT                   /locus_tag="mCG_23093"
FT                   /product="splicing factor 4, isoform CRA_c"
FT                   /note="gene_id=mCG23093.1 transcript_id=mCT170203.0
FT                   protein_id=mCP93047.0 isoform=CRA_c"
FT                   /protein_id="EDL28776.1"
FT                   /translation="RRRFCGEDARCPRRGLDEIVGEGLHLPSDQAHYNRASLFSGGAGA
FT                   LWDWMSLKMDNRDVAGKANRWFGMAQPKSGKMNMNILHQEELIAQKKREIEARMEQKAR
FT                   QSHVPSPQPPHPGEIADAHNSCISNKFANDGSFLQQFLKLQKAQTSTDSAPRAPPSMPT
FT                   PSSLKKPLVLSKRTGLGLSSPTGPVKNYSHAKQLPVAHRPSVFQSPDDDEEEDYEQWLE
FT                   IKVSPPEGAETRRVIEKLARFVAEGGPELEKVAMEDYKDNPAFTFLHDKNSREFLYYRR
FT                   KVAEIRKEAQKPQAATQKVSPPEDEEAKNLAEKLARFIADGGPEVETIALQNNRENQAF
FT                   SFLYDPNSQGYRYYRQKLDEFRKAKAGSTGSFPAPAPNPSLRRKSAPEALSGAVPPITA
FT                   CPTPVAPAPAVNPTPSIPGKPTATAAVKRKRKSRWGPEEDKVELPPAELAQRDIDASPS
FT                   PLSVQDLKGLGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQL
FT                   LWEKALQQHQHGYDSDEEVDSELGTWEHQLRRMEMDKTREWAEQLTQMGRGKHFIGDFL
FT                   PPDELEKFMETFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGTEGQGI
FT                   KNPVNKGATTIDGAGFGIDRPAELSKEDDEYEAFRKRMMLAYRFRPNPLNNPRRPYY"
FT   CDS             join(<14528944..14529124,14534549..14534720,
FT                   14538645..14538745,14542192..14542410,14545100..14545211,
FT                   14545559..14545659,14546342..14546465,14550643..14551004,
FT                   14555258..14555364,14555802..14555979,14556137..14556243,
FT                   14556920..14557065,14557328..14557457,14557612..14557638)
FT                   /codon_start=1
FT                   /gene="Sf4"
FT                   /locus_tag="mCG_23093"
FT                   /product="splicing factor 4, isoform CRA_b"
FT                   /note="gene_id=mCG23093.1 transcript_id=mCT23110.2
FT                   protein_id=mCP13304.2 isoform=CRA_b"
FT                   /protein_id="EDL28775.1"
FT                   /translation="RRRFCGEDARCPRRGLDEIVGEGLHLPSDQAHYNRASLFSGGAGA
FT                   LWDWMSLKMDNRDVAGKANRWFGMAQPKSGKMNMNILHQEELIAQKKREIEARMEQKAR
FT                   QSHVPSPQPPHPGEIADAHNSCISNKFANDGSFLQQFLKLQKAQTSTDSAPRAPPSMPT
FT                   PSSLKKPLVLSKRTGLGLSSPTGPVKNYSHAKQLPVAHRPSVFQSPDDDEEEDYEQWLE
FT                   IKEGAETRRVIEKLARFVAEGGPELEKVAMEDYKDNPAFTFLHDKNSREFLYYRRKVAE
FT                   IRKEAQKPQAATQKVSPPEDEEAKNLAEKLARFIADGGPEVETIALQNNRENQAFSFLY
FT                   DPNSQGYRYYRQKLDEFRKAKAGSTGSFPAPAPNPSLRRKSAPEALSGAVPPITACPTP
FT                   VAPAPAVNPTPSIPGKPTATAAVKRKRKSRWGPEEDKVELPPAELAQRDIDASPSPLSV
FT                   QDLKGLGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEK
FT                   ALQQHQHGYDSDEEVDSELGTWEHQLRRMEMDKTREWAEQLTQMGRGKHFIGDFLPPDE
FT                   LEKFMETFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGTEGQGIKNPV
FT                   NKGATTIDGAGFGIDRPAELSKEDDEYEAFRKRMMLAYRFRPNPLNNPRRPYY"
FT   mRNA            join(<14529076..14529124,14534549..14534720,
FT                   14538645..14538745,14542192..14542410,14545088..14545211,
FT                   14545559..14545659,14546342..14546465,14550643..14552717)
FT                   /gene="Sf4"
FT                   /locus_tag="mCG_23093"
FT                   /product="splicing factor 4, transcript variant mCT192561"
FT                   /note="gene_id=mCG23093.1 transcript_id=mCT192561.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<14529076..14529124,14534549..14534720,
FT                   14538645..14538745,14542192..14542410,14545088..14545211,
FT                   14545559..14545659,14546342..14546465,14550643..14551111)
FT                   /codon_start=1
FT                   /gene="Sf4"
FT                   /locus_tag="mCG_23093"
FT                   /product="splicing factor 4, isoform CRA_a"
FT                   /note="gene_id=mCG23093.1 transcript_id=mCT192561.0
FT                   protein_id=mCP113512.0 isoform=CRA_a"
FT                   /protein_id="EDL28774.1"
FT                   /translation="ALWDWMSLKMDNRDVAGKANRWFGMAQPKSGKMNMNILHQEELIA
FT                   QKKREIEARMEQKARQSHVPSPQPPHPGEIADAHNSCISNKFANDGSFLQQFLKLQKAQ
FT                   TSTDSAPRAPPSMPTPSSLKKPLVLSKRTGLGLSSPTGPVKNYSHAKQLPVAHRPSVFQ
FT                   SPDDDEEEDYEQWLEIKVSPPEGAETRRVIEKLARFVAEGGPELEKVAMEDYKDNPAFT
FT                   FLHDKNSREFLYYRRKVAEIRKEAQKPQAATQKVSPPEDEEAKNLAEKLARFIADGGPE
FT                   VETIALQNNRENQAFSFLYDPNSQGYRYYRQKLDEFRKAKAGSTGSFPAPAPNPSLRRK
FT                   SAPEALSGAVPPITACPTPVAPAPAVNPTPSIPGKPTATAAVKRKRKSRWGPEEDKVEL
FT                   PPAELAQRDIDASPSPLSGVGPFLGGPRGYLRAWVTFYSLLWLGTLGYLCIDI"
FT   gene            <14558739..14565941
FT                   /gene="Tm6sf2"
FT                   /locus_tag="mCG_23101"
FT                   /note="gene_id=mCG23101.2"
FT   mRNA            join(<14558739..14558897,14560156..14560259,
FT                   14561210..14561307,14561378..14561481,14561879..14561961,
FT                   14563268..14563392,14563759..14563860,14564188..14564280,
FT                   14564683..14564802,14565494..14565941)
FT                   /gene="Tm6sf2"
FT                   /locus_tag="mCG_23101"
FT                   /product="transmembrane 6 superfamily member 2, transcript
FT                   variant mCT23116"
FT                   /note="gene_id=mCG23101.2 transcript_id=mCT23116.2 created
FT                   on 19-JUN-2002"
FT   mRNA            join(<14558739..14558897,14560156..14560259,
FT                   14561210..14561307,14561378..14561481,14561879..14561961,
FT                   14563268..14563392,14563765..14563860,14564188..14564280,
FT                   14564683..14564802,14565494..14565930)
FT                   /gene="Tm6sf2"
FT                   /locus_tag="mCG_23101"
FT                   /product="transmembrane 6 superfamily member 2, transcript
FT                   variant mCT192538"
FT                   /note="gene_id=mCG23101.2 transcript_id=mCT192538.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<14558740..14558897,14560156..14560259,
FT                   14561210..14561307,14561378..14561481,14561879..14561961,
FT                   14563268..14563392,14563759..14563860,14564188..14564280,
FT                   14564683..14564802,14565494..14565706)
FT                   /codon_start=1
FT                   /gene="Tm6sf2"
FT                   /locus_tag="mCG_23101"
FT                   /product="transmembrane 6 superfamily member 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23101.2 transcript_id=mCT23116.2
FT                   protein_id=mCP13277.2 isoform=CRA_b"
FT                   /protein_id="EDL28778.1"
FT                   /translation="DALRSRSQASWRPRRGRGAAAMDIPPLAGRTVAMSFCALPVSYLL
FT                   NQVSAFSQPLFVVLTSALILGLLFLAVYSLSHGEITYDPLYAVFVIFSFTSVVDLVIAL
FT                   QEDGYMMGFMDFYTKEGEPYLRTAHGIFICYWDGTVHYLLYLTMAGAIRKRKRYRNLGL
FT                   YWLGSFAMSILVFLPGNILGKYSSEMRPTFFLAILYMLVPCWAGVRIFNQSRAPTSYTP
FT                   DMVQEEQKKSLFQRPADLALIVYLIFAALFTVFRGLVVLDCPTDACFIYIYQYEPYLRD
FT                   PVAYPKLQMLMYLFYALPFYCLAAYALAFPGCSWLPDWALVFAGAIGQAQFSHMGASMH
FT                   MRTPFTYRVPEDTWATFFLSNLLLALGPHLLAFRCLWRPAFFLHAALPSSPQDQDKKQQ
FT                   "
FT   CDS             join(<14558740..14558897,14560156..14560259,
FT                   14561210..14561307,14561378..14561481,14561879..14561961,
FT                   14563268..14563392,14563765..14563860,14564188..14564280,
FT                   14564683..14564802,14565494..14565706)
FT                   /codon_start=1
FT                   /gene="Tm6sf2"
FT                   /locus_tag="mCG_23101"
FT                   /product="transmembrane 6 superfamily member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23101.2 transcript_id=mCT192538.0
FT                   protein_id=mCP113514.0 isoform=CRA_a"
FT                   /protein_id="EDL28777.1"
FT                   /translation="DALRSRSQASWRPRRGRGAAAMDIPPLAGRTVAMSFCALPVSYLL
FT                   NQVSAFSQPLFVVLTSALILGLLFLAVYSLSHGEITYDPLYAVFVIFSFTSVVDLVIAL
FT                   QEDGYMMGFMDFYTKEGEPYLRTAHGIFICYWDGTVHYLLYLTMAGAIRKRKRYRNLGL
FT                   YWLGSFAMSILVFLPGNILGKYSSEMRPTFFLAILYMLVPCWAGVRIFNQSRAPTSYTP
FT                   DMEEQKKSLFQRPADLALIVYLIFAALFTVFRGLVVLDCPTDACFIYIYQYEPYLRDPV
FT                   AYPKLQMLMYLFYALPFYCLAAYALAFPGCSWLPDWALVFAGAIGQAQFSHMGASMHMR
FT                   TPFTYRVPEDTWATFFLSNLLLALGPHLLAFRCLWRPAFFLHAALPSSPQDQDKKQQ"
FT   gene            <14569397..14576736
FT                   /gene="Hapln4"
FT                   /locus_tag="mCG_23100"
FT                   /note="gene_id=mCG23100.2"
FT   mRNA            join(<14569397..14569440,14570297..14570417,
FT                   14570659..14571021,14572685..14573008,14574007..14576736)
FT                   /gene="Hapln4"
FT                   /locus_tag="mCG_23100"
FT                   /product="hyaluronan and proteoglycan link protein 4"
FT                   /note="gene_id=mCG23100.2 transcript_id=mCT23115.2 created
FT                   on 19-JUN-2002"
FT   CDS             join(<14569399..14569440,14570297..14570417,
FT                   14570659..14571021,14572685..14573008,14574007..14574398)
FT                   /codon_start=1
FT                   /gene="Hapln4"
FT                   /locus_tag="mCG_23100"
FT                   /product="hyaluronan and proteoglycan link protein 4"
FT                   /note="gene_id=mCG23100.2 transcript_id=mCT23115.2
FT                   protein_id=mCP13274.2"
FT                   /protein_id="EDL28779.1"
FT                   /translation="GKRTGRSARATTRMACAPGALGHRALWAVAWGLLLLVPVLAGAQR
FT                   GRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVV
FT                   DPLAFADVFVALGPQHRAFGPYRGRAELQNDGPGDASLVLRNVTLQDYGRYECEVTNEL
FT                   EDDVGMVKLDLEGVVFPYHPRGGRYKMTFVEAQRACAEQDGILASAEQLHAAWRDGLDW
FT                   CNAGWLRDGSVQYPVSHAREPCGGTGSTGAGGGTNGGVRNYGYRHNAEERYDAFCFTSN
FT                   LPGRVFFLKPLRPVALAGAVRACAARGATVAKVGQLFAAWKLQLLDRCTAGWLADGSAR
FT                   YPIVNPRTRCGGPRPGVRSLGFPDASRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWA
FT                   GGSRDPAAWTPLRV"
FT   gene            complement(<14583300..14602018)
FT                   /locus_tag="mCG_23092"
FT                   /note="gene_id=mCG23092.2"
FT   mRNA            complement(join(<14583300..14583458,14583809..14583922,
FT                   14585349..14585465,14588846..14590054,14591346..14591942,
FT                   14593299..14593592,14593906..14594033,14594131..14594305,
FT                   14596394..14596792,14597996..14598075,14601925..14602018))
FT                   /locus_tag="mCG_23092"
FT                   /product="mCG23092"
FT                   /note="gene_id=mCG23092.2 transcript_id=mCT23107.2 created
FT                   on 19-JUN-2002"
FT   CDS             complement(join(<14583300..14583458,14583809..14583922,
FT                   14585349..14585465,14588846..14590054,14591346..14591942,
FT                   14593299..14593592,14593906..14594033,14594131..14594305,
FT                   14596394..14596792,14597996..14598068))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23092"
FT                   /product="mCG23092"
FT                   /note="gene_id=mCG23092.2 transcript_id=mCT23107.2
FT                   protein_id=mCP13258.2"
FT                   /protein_id="EDL28780.1"
FT                   /translation="MGAGSVWASGLLLLWLLLLVAGDQDTQDTTATEKGLRMLKSGSGP
FT                   VRAALAELVALPCFFTLQPRLSSLRDIPRIKWTKVQTASGQRQDLPILVAKDNVVRVAK
FT                   GWQGRVSLPAYPRHRANATLLLGPLRASDSGLYRCQVVKGIEDEQDLVTLEVTGVVFHY
FT                   RAARDRYALTFAEAQEACRLSSATIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQS
FT                   RPGCYGDRSSLPGVRSYGRRDPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQCQR
FT                   QGAALASVGQLHLAWHEGLDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANR
FT                   TGFPAPGARFDAYCFRAHHHTAQHGDSEIPSSGDEGEIVSAEGPPGRELKPSLGEQEVI
FT                   APDFQEPLMSSGEGEPPDLTWTQAPEETLGSTPGGPTLASWPSSEKWLFTGAPSSMGVS
FT                   SPSDMGVDMEATTPLGTQVAPTPTMRRGRFKGLNGRHFQQQGPEDQLPEVAEPSAQPPT
FT                   LGATANHMRPSAATEASESDQSHSPWAILTNEVDEPGAGSLGSRSLPESLMWSPSLISP
FT                   SVPSTDSTPSAKPGAAEAPSVKSAIPHLPRLPSEPPAPSPGPSEALSAVSLQASSADGS
FT                   PDFPIVAMLRAPKLWLLPRSTLVPNMTPVPLSPASPLPSWVPEEQAVRPVSLGAEDLET
FT                   PFQTTIAAPVEASHRSPDADSIEIEGTSSMRATKHPISGPWASLDSSNVTMNPVPSDAG
FT                   ILGTESGVLDLPGSPTSGGQATVEKVLATWLPLPGQGLDPGSQSTPMEAHGVAVSMEPT
FT                   VALEGGATEGPMEATREVVPSTADATWESESRSAISSTHIAVTMARAQGMPTLTSTSSE
FT                   GHPEPKGQMVAQESLEPLNTLPSHPWSSLVVPMDEVASVSSGEPTGLWDIPSTLIPVSL
FT                   GLDESDLNVVAESPSVKGFWEEVASGQEDPTDPCENNPCLHGGTCHTNGTVYGCSCDQG
FT                   YAGENCEIDIDDCLCSPCENGGTCIDEVNGFICLCLPSYGGSLCEKDTEGCDRGWHKFQ
FT                   GHCYRYFAHRRAWEDAERDCRRRAGHLTSVHSPEEHKFIN"
FT   gene            <14611985..14614954
FT                   /gene="2310073E15Rik"
FT                   /locus_tag="mCG_23095"
FT                   /note="gene_id=mCG23095.1"
FT   mRNA            join(<14611985..14612796,14613115..14613205,
FT                   14613609..14613714,14613784..14613846,14614290..14614954)
FT                   /gene="2310073E15Rik"
FT                   /locus_tag="mCG_23095"
FT                   /product="RIKEN cDNA 2310073E15, transcript variant
FT                   mCT23111"
FT                   /note="gene_id=mCG23095.1 transcript_id=mCT23111.1 created
FT                   on 19-JUN-2002"
FT   mRNA            join(<14612529..14612796,14613115..14613205,
FT                   14613784..14613846,14614290..14614944)
FT                   /gene="2310073E15Rik"
FT                   /locus_tag="mCG_23095"
FT                   /product="RIKEN cDNA 2310073E15, transcript variant
FT                   mCT170207"
FT                   /note="gene_id=mCG23095.1 transcript_id=mCT170207.0 created
FT                   on 19-JUN-2002"
FT   mRNA            join(<14612552..14612796,14613115..14613205,
FT                   14613609..14613714,14613784..14614117)
FT                   /gene="2310073E15Rik"
FT                   /locus_tag="mCG_23095"
FT                   /product="RIKEN cDNA 2310073E15, transcript variant
FT                   mCT170206"
FT                   /note="gene_id=mCG23095.1 transcript_id=mCT170206.0 created
FT                   on 19-JUN-2002"
FT   mRNA            join(<14612560..14612796,14613115..14613205,
FT                   14613784..14614139)
FT                   /gene="2310073E15Rik"
FT                   /locus_tag="mCG_23095"
FT                   /product="RIKEN cDNA 2310073E15, transcript variant
FT                   mCT170205"
FT                   /note="gene_id=mCG23095.1 transcript_id=mCT170205.0 created
FT                   on 19-JUN-2002"
FT   CDS             join(<14612663..14612796,14613115..14613205,
FT                   14613609..14613714,14613784..14613846,14614290..14614330)
FT                   /codon_start=1
FT                   /gene="2310073E15Rik"
FT                   /locus_tag="mCG_23095"
FT                   /product="RIKEN cDNA 2310073E15, isoform CRA_b"
FT                   /note="gene_id=mCG23095.1 transcript_id=mCT23111.1
FT                   protein_id=mCP13252.1 isoform=CRA_b"
FT                   /protein_id="EDL28783.1"
FT                   /translation="RWPGVGSVAARSSWEWQRRASNSRSASHPRTVMTQSLVCPDTVSR
FT                   VSSVLNRNSRQFGKKHLFDQDEETCWNSDQGPSQWVSLEFPQCVQITQLQVQFQGGFSS
FT                   RHSCLEGSRGGEALSKIVDFYPEDTNALTPSPSPQWRWTD"
FT   CDS             join(<14612663..14612796,14613115..14613205,
FT                   14613609..14613714,14613784..14614007)
FT                   /codon_start=1
FT                   /gene="2310073E15Rik"
FT                   /locus_tag="mCG_23095"
FT                   /product="RIKEN cDNA 2310073E15, isoform CRA_c"
FT                   /note="gene_id=mCG23095.1 transcript_id=mCT170206.0
FT                   protein_id=mCP93046.0 isoform=CRA_c"
FT                   /protein_id="EDL28784.1"
FT                   /translation="RWPGVGSVAARSSWEWQRRASNSRSASHPRTVMTQSLVCPDTVSR
FT                   VSSVLNRNSRQFGKKHLFDQDEETCWNSDQGPSQWVSLEFPQCVQITQLQVQFQGGFSS
FT                   RHSCLEGSRGGEALSKIVDFYPEDTNALQISCLSCGGRDLVFYKLQVFGCGGNGTGEAG
FT                   AGGSRMPGQLGPDPVSKESKL"
FT   CDS             join(<14612663..14612796,14613115..14613205,
FT                   14613784..14613819)
FT                   /codon_start=1
FT                   /gene="2310073E15Rik"
FT                   /locus_tag="mCG_23095"
FT                   /product="RIKEN cDNA 2310073E15, isoform CRA_a"
FT                   /note="gene_id=mCG23095.1 transcript_id=mCT170205.0
FT                   protein_id=mCP93062.0 isoform=CRA_a"
FT                   /protein_id="EDL28781.1"
FT                   /translation="RWPGVGSVAARSSWEWQRRASNSRSASHPRTVMTQSLVCPDTVSR
FT                   VSSVLNRNSRQFGKKHLFDQDEETCWNSDQVHGVGRHSARL"
FT   CDS             join(<14612663..14612796,14613115..14613205,
FT                   14613784..14613819)
FT                   /codon_start=1
FT                   /gene="2310073E15Rik"
FT                   /locus_tag="mCG_23095"
FT                   /product="RIKEN cDNA 2310073E15, isoform CRA_a"
FT                   /note="gene_id=mCG23095.1 transcript_id=mCT170207.0
FT                   protein_id=mCP93037.0 isoform=CRA_a"
FT                   /protein_id="EDL28782.1"
FT                   /translation="RWPGVGSVAARSSWEWQRRASNSRSASHPRTVMTQSLVCPDTVSR
FT                   VSSVLNRNSRQFGKKHLFDQDEETCWNSDQVHGVGRHSARL"
FT   gene            complement(14613390..14620386)
FT                   /gene="Rfxank"
FT                   /locus_tag="mCG_23094"
FT                   /note="gene_id=mCG23094.3"
FT   mRNA            complement(join(14613390..14614660,14615422..14615502,
FT                   14615808..14615874,14616235..14616360,14616487..14616587,
FT                   14616762..14616827,14617406..14617486,14619225..14619419,
FT                   14620117..>14620295))
FT                   /gene="Rfxank"
FT                   /locus_tag="mCG_23094"
FT                   /product="regulatory factor X-associated ankyrin-containing
FT                   protein, transcript variant mCT192562"
FT                   /note="gene_id=mCG23094.3 transcript_id=mCT192562.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(14613685..14613707,14613779..14613856,
FT                   14614296..14614660,14615422..14615502,14615808..14615874,
FT                   14616235..14616360,14616487..14616587,14616762..14616827,
FT                   14617406..14617486,14619225..14619419,14620117..14620386))
FT                   /gene="Rfxank"
FT                   /locus_tag="mCG_23094"
FT                   /product="regulatory factor X-associated ankyrin-containing
FT                   protein, transcript variant mCT170204"
FT                   /note="gene_id=mCG23094.3 transcript_id=mCT170204.0 created
FT                   on 19-JUN-2002"
FT   mRNA            complement(join(14613685..14613707,14613779..14613856,
FT                   14614296..14614660,14615422..14615502,14615808..14615874,
FT                   14616235..14616360,14616487..14616587,14616732..14616827,
FT                   14617406..14617486,14619225..14619419,14620117..14620386))
FT                   /gene="Rfxank"
FT                   /locus_tag="mCG_23094"
FT                   /product="regulatory factor X-associated ankyrin-containing
FT                   protein, transcript variant mCT23108"
FT                   /note="gene_id=mCG23094.3 transcript_id=mCT23108.2 created
FT                   on 19-JUN-2002"
FT   CDS             complement(join(14614590..14614660,14615422..14615502,
FT                   14615808..14615874,14616235..14616360,14616487..14616587,
FT                   14616762..14616827,14617406..14617486,14619225..14619419,
FT                   14620117..>14620183))
FT                   /codon_start=1
FT                   /gene="Rfxank"
FT                   /locus_tag="mCG_23094"
FT                   /product="regulatory factor X-associated ankyrin-containing
FT                   protein, isoform CRA_b"
FT                   /note="gene_id=mCG23094.3 transcript_id=mCT192562.0
FT                   protein_id=mCP113513.0 isoform=CRA_b"
FT                   /protein_id="EDL28786.1"
FT                   /translation="TELPEFWKTKAGSVGTQRRLEGASSMEPTQVAENLVPNQQPPVPD
FT                   LEDPEDTRDESPENSDTVVLSLFPCTPDAVNPEADASASSLQGSFLKHSTTLTNRQRGN
FT                   EVSALPATLDSLSIHQLAAQGELSQLKDHLRKGNNLINKPDERGFTPLIWASAFGEIET
FT                   VRFLLDWGADPHILAKERESALSLASMGGYTDIVRLLLDRDVDINIYDWNGGTPLLYAV
FT                   RGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQVMESHILRLFQSTLGPV
FT                   DPE"
FT   CDS             complement(join(14614590..14614660,14615422..14615502,
FT                   14615808..14615874,14616235..14616360,14616487..14616587,
FT                   14616762..14616827,14617406..14617486,14619225..14619411))
FT                   /codon_start=1
FT                   /gene="Rfxank"
FT                   /locus_tag="mCG_23094"
FT                   /product="regulatory factor X-associated ankyrin-containing
FT                   protein, isoform CRA_a"
FT                   /note="gene_id=mCG23094.3 transcript_id=mCT170204.0
FT                   protein_id=mCP93060.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q543F0"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR017362"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1333865"
FT                   /db_xref="UniProtKB/TrEMBL:Q543F0"
FT                   /protein_id="EDL28785.1"
FT                   /translation="MEPTQVAENLVPNQQPPVPDLEDPEDTRDESPENSDTVVLSLFPC
FT                   TPDAVNPEADASASSLQGSFLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELSQ
FT                   LKDHLRKGNNLINKPDERGFTPLIWASAFGEIETVRFLLDWGADPHILAKERESALSLA
FT                   SMGGYTDIVRLLLDRDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSG
FT                   YTPMDLAVALGYRKVQQVMESHILRLFQSTLGPVDPE"
FT   CDS             complement(join(14614590..14614660,14615422..14615502,
FT                   14615808..14615874,14616235..14616360,14616487..14616587,
FT                   14616732..14616827,14617406..14617486,14619225..14619411))
FT                   /codon_start=1
FT                   /gene="Rfxank"
FT                   /locus_tag="mCG_23094"
FT                   /product="regulatory factor X-associated ankyrin-containing
FT                   protein, isoform CRA_c"
FT                   /note="gene_id=mCG23094.3 transcript_id=mCT23108.2
FT                   protein_id=mCP13270.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q53X17"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR017362"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1333865"
FT                   /db_xref="UniProtKB/TrEMBL:Q53X17"
FT                   /protein_id="EDL28787.1"
FT                   /translation="MEPTQVAENLVPNQQPPVPDLEDPEDTRDESPENSDTVVLSLFPC
FT                   TPDAVNPEADASASSLQGSFLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELSQ
FT                   LKDHLRKGACPACTCLSGNNLINKPDERGFTPLIWASAFGEIETVRFLLDWGADPHILA
FT                   KERESALSLASMGGYTDIVRLLLDRDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARG
FT                   ADLTTEADSGYTPMDLAVALGYRKVQQVMESHILRLFQSTLGPVDPE"
FT   gene            14620657..14648682
FT                   /gene="Mef2b"
FT                   /locus_tag="mCG_23096"
FT                   /note="gene_id=mCG23096.2"
FT   mRNA            join(14620657..14620968,14623092..14623204,
FT                   14623702..14623766,14626252..14626362,14627039..14627118,
FT                   14628317..14628424,14645424..14645499,14646243..14646446,
FT                   14646725..14646859,14647241..14647370,14647488..14647621,
FT                   14647809..14647893,14648014..14648101,14648261..14648682)
FT                   /gene="Mef2b"
FT                   /locus_tag="mCG_23096"
FT                   /product="myocyte enhancer factor 2B, transcript variant
FT                   mCT170208"
FT                   /note="gene_id=mCG23096.2 transcript_id=mCT170208.0 created
FT                   on 19-JUN-2002"
FT   mRNA            join(14620905..14620968,14645424..14645499,
FT                   14646243..14646446,14646725..14646859,14647241..14647370,
FT                   14647488..14647621,14647809..14647893,14648014..14648101,
FT                   14648261..14648682)
FT                   /gene="Mef2b"
FT                   /locus_tag="mCG_23096"
FT                   /product="myocyte enhancer factor 2B, transcript variant
FT                   mCT23112"
FT                   /note="gene_id=mCG23096.2 transcript_id=mCT23112.1 created
FT                   on 19-JUN-2002"
FT   CDS             join(14645446..14645499,14646243..14646446,
FT                   14646725..14646859,14647241..14647370,14647488..14647621,
FT                   14647809..14647893,14648014..14648101,14648261..14648480)
FT                   /codon_start=1
FT                   /gene="Mef2b"
FT                   /locus_tag="mCG_23096"
FT                   /product="myocyte enhancer factor 2B, isoform CRA_a"
FT                   /note="gene_id=mCG23096.2 transcript_id=mCT170208.0
FT                   protein_id=mCP93064.0 isoform=CRA_a"
FT                   /db_xref="GOA:K7N7F1"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="MGI:MGI:104526"
FT                   /db_xref="MGI:MGI:1919618"
FT                   /db_xref="UniProtKB/TrEMBL:K7N7F1"
FT                   /protein_id="EDL28788.1"
FT                   /translation="MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCDIAL
FT                   IIFNSAQRLFQYASSDMDRVLLKYTEYSEPHESRTNADILQTLKRRGVGLDGPELDMEE
FT                   GPEGPGEKLLRTLGGDRGSASPPPRIYPVAPAMSVSELSYRVPPATPGCDPGGLGEAPS
FT                   VHSRPPHFRPPGLGHPIFSPSHLASKTPPPLYLATDGRRPDLPPGLVGARGGLGTSRSL
FT                   YSGLQSPGAPGPALGSFAFLPSGSTDCSPGDAAQGPLQPSPWPPTRDAVDPARPVARSL
FT                   CKEGPPSRGASPPTPPVSIKSERLSPVTGTSGDFPRSFPYPLLLARPLAEPLRPSASLH
FT                   RLTPDSWPR"
FT   CDS             join(14645446..14645499,14646243..14646446,
FT                   14646725..14646859,14647241..14647370,14647488..14647621,
FT                   14647809..14647893,14648014..14648101,14648261..14648480)
FT                   /codon_start=1
FT                   /gene="Mef2b"
FT                   /locus_tag="mCG_23096"
FT                   /product="myocyte enhancer factor 2B, isoform CRA_a"
FT                   /note="gene_id=mCG23096.2 transcript_id=mCT23112.1
FT                   protein_id=mCP13281.2 isoform=CRA_a"
FT                   /db_xref="GOA:K7N7F1"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="MGI:MGI:104526"
FT                   /db_xref="MGI:MGI:1919618"
FT                   /db_xref="UniProtKB/TrEMBL:K7N7F1"
FT                   /protein_id="EDL28789.1"
FT                   /translation="MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCDIAL
FT                   IIFNSAQRLFQYASSDMDRVLLKYTEYSEPHESRTNADILQTLKRRGVGLDGPELDMEE
FT                   GPEGPGEKLLRTLGGDRGSASPPPRIYPVAPAMSVSELSYRVPPATPGCDPGGLGEAPS
FT                   VHSRPPHFRPPGLGHPIFSPSHLASKTPPPLYLATDGRRPDLPPGLVGARGGLGTSRSL
FT                   YSGLQSPGAPGPALGSFAFLPSGSTDCSPGDAAQGPLQPSPWPPTRDAVDPARPVARSL
FT                   CKEGPPSRGASPPTPPVSIKSERLSPVTGTSGDFPRSFPYPLLLARPLAEPLRPSASLH
FT                   RLTPDSWPR"
FT   gene            <14653624..14665313
FT                   /gene="Tmem161a"
FT                   /locus_tag="mCG_23091"
FT                   /note="gene_id=mCG23091.4"
FT   mRNA            join(<14653624..14653660,14655503..14655606,
FT                   14662185..14662245,14662352..14662495,14662582..14662695,
FT                   14662795..14662969,14663076..14663172,14663529..14665313)
FT                   /gene="Tmem161a"
FT                   /locus_tag="mCG_23091"
FT                   /product="transmembrane protein 161A, transcript variant
FT                   mCT192558"
FT                   /note="gene_id=mCG23091.4 transcript_id=mCT192558.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<14653626..14653660,14658029..14658109,
FT                   14658425..14658522,14658636..14658792,14660513..14660664,
FT                   14662185..14662245,14662352..14662495,14662582..14662695,
FT                   14662795..14662969,14663076..14663172,14663529..14664251)
FT                   /gene="Tmem161a"
FT                   /locus_tag="mCG_23091"
FT                   /product="transmembrane protein 161A, transcript variant
FT                   mCT192557"
FT                   /note="gene_id=mCG23091.4 transcript_id=mCT192557.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<14653626..14653660,14658029..14658109,
FT                   14658425..14658522,14658636..14658792,14660513..14660664,
FT                   14662185..14662245,14662352..14662495,14662582..14662695,
FT                   14662795..14662969,14663076..14663172,14663529..14663785)
FT                   /codon_start=1
FT                   /gene="Tmem161a"
FT                   /locus_tag="mCG_23091"
FT                   /product="transmembrane protein 161A, isoform CRA_a"
FT                   /note="gene_id=mCG23091.4 transcript_id=mCT192557.0
FT                   protein_id=mCP113509.0 isoform=CRA_a"
FT                   /protein_id="EDL28790.1"
FT                   /translation="ASYRCAPRERTCLFRYIHPSEEELRALSGKLRPRVRKERWANGLH
FT                   DEKPLSVPRDAHFQLQTCPLTAVDALVLRFFLEYQWFVDFAVYSVGVYLFTEAYYFVLG
FT                   PVQETNIAVFWCLLTLAFSLKVFLMVTRLYFSTKEGGERSVCLSFAFLFLLLAMLVQVV
FT                   REETLELGLEPGLASMTQHLEPILKKQDWDWTLPVIKLAIRLGLAVLGSLLGAFLIFPG
FT                   LRLAQTHQDALTLSADRPLLQLLLHTSFLSPLCTLWLWTKPVARDFLYQAPTRNMTFSV
FT                   PSEGAFDSLRLWVLVALCLLRLAVTRPHLQAYLCLAKARVEQLRKEAGRIEAREIQQRV
FT                   VRVYCYVTVVSLQYLTPLILTLHCTLLLKTLGGYSWALSSTPPPLAPSQPSEALIPVDP
FT                   AGDEAQQTAAQVAGILGGLLTPLFLRGMLAYIIWWTAACQLLSSLFGLYFHQHLAAS"
FT   mRNA            join(14653630..14653660,14655503..14655606,
FT                   14658029..14658109,14658425..14658522,14658636..14658792,
FT                   14660513..14660664,14662185..14662245,14662352..14662495,
FT                   14662582..14662695,14662795..14662969,14663076..14663172,
FT                   14663529..14665312)
FT                   /gene="Tmem161a"
FT                   /locus_tag="mCG_23091"
FT                   /product="transmembrane protein 161A, transcript variant
FT                   mCT23106"
FT                   /note="gene_id=mCG23091.4 transcript_id=mCT23106.2 created
FT                   on 15-JUL-2003"
FT   mRNA            join(<14653631..14653660,14655503..14655606,
FT                   14658029..14658109,14658425..14658522,14658636..14658792,
FT                   14660513..14660664,14662185..14662245,14662352..14662514,
FT                   14662795..14662969,14663076..14663172,14663529..14664521)
FT                   /gene="Tmem161a"
FT                   /locus_tag="mCG_23091"
FT                   /product="transmembrane protein 161A, transcript variant
FT                   mCT192559"
FT                   /note="gene_id=mCG23091.4 transcript_id=mCT192559.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<14653631..14653660,14655503..14655606,
FT                   14658029..14658109,14658425..14658522,14658636..14658792,
FT                   14660513..14660664,14662185..14662245,14662352..14662514,
FT                   14662795..14662947)
FT                   /codon_start=1
FT                   /gene="Tmem161a"
FT                   /locus_tag="mCG_23091"
FT                   /product="transmembrane protein 161A, isoform CRA_c"
FT                   /note="gene_id=mCG23091.4 transcript_id=mCT192559.0
FT                   protein_id=mCP113511.0 isoform=CRA_c"
FT                   /protein_id="EDL28792.1"
FT                   /translation="VPLCAQGADMAVLGVQLVVTLFTATLMHRLAPHCSFARWLLCNGS
FT                   LFRYIHPSEEELRALSGKLRPRVRKERWANGLHDEKPLSVPRDAHFQLQTCPLTAVDAL
FT                   VLRFFLEYQWFVDFAVYSVGVYLFTEAYYFVLGPVQETNIAVFWCLLTLAFSLKVFLMV
FT                   TRLYFSTKEGGERSVCLSFAFLFLLLAMLVQVVREETLELGLEPGLASMTQHLEPILKK
FT                   QDWDWTLPVIKLAIRLGLAVLGSLLGAFLIFPGLRLAQTHQDALTLSADRPLLQLGGSP
FT                   RTVRRGFRLSAPLGVGGAVPVAPGSNPATPAGLPVPGQGSSGAAAQGGWPH"
FT   CDS             join(14653658..14653660,14655503..14655606,
FT                   14658029..14658109,14658425..14658522,14658636..14658792,
FT                   14660513..14660664,14662185..14662245,14662352..14662495,
FT                   14662582..14662695,14662795..14662969,14663076..14663172,
FT                   14663529..14663785)
FT                   /codon_start=1
FT                   /gene="Tmem161a"
FT                   /locus_tag="mCG_23091"
FT                   /product="transmembrane protein 161A, isoform CRA_d"
FT                   /note="gene_id=mCG23091.4 transcript_id=mCT23106.2
FT                   protein_id=mCP13295.3 isoform=CRA_d"
FT                   /protein_id="EDL28793.1"
FT                   /translation="MAVLGVQLVVTLFTATLMHRLAPHCSFARWLLCNGSLFRYIHPSE
FT                   EELRALSGKLRPRVRKERWANGLHDEKPLSVPRDAHFQLQTCPLTAVDALVLRFFLEYQ
FT                   WFVDFAVYSVGVYLFTEAYYFVLGPVQETNIAVFWCLLTLAFSLKVFLMVTRLYFSTKE
FT                   GGERSVCLSFAFLFLLLAMLVQVVREETLELGLEPGLASMTQHLEPILKKQDWDWTLPV
FT                   IKLAIRLGLAVLGSLLGAFLIFPGLRLAQTHQDALTLSADRPLLQLLLHTSFLSPLCTL
FT                   WLWTKPVARDFLYQAPTRNMTFSVPSEGAFDSLRLWVLVALCLLRLAVTRPHLQAYLCL
FT                   AKARVEQLRKEAGRIEAREIQQRVVRVYCYVTVVSLQYLTPLILTLHCTLLLKTLGGYS
FT                   WALSSTPPPLAPSQPSEALIPVDPAGDEAQQTAAQVAGILGGLLTPLFLRGMLAYIIWW
FT                   TAACQLLSSLFGLYFHQHLAAS"
FT   CDS             join(<14655564..14655606,14662185..14662245,
FT                   14662352..14662495,14662582..14662695,14662795..14662969,
FT                   14663076..14663172,14663529..14663785)
FT                   /codon_start=1
FT                   /gene="Tmem161a"
FT                   /locus_tag="mCG_23091"
FT                   /product="transmembrane protein 161A, isoform CRA_b"
FT                   /note="gene_id=mCG23091.4 transcript_id=mCT192558.0
FT                   protein_id=mCP113510.0 isoform=CRA_b"
FT                   /protein_id="EDL28791.1"
FT                   /translation="RHTVPSHAGCSAMAGLASMTQHLEPILKKQDWDWTLPVIKLAIRL
FT                   GLAVLGSLLGAFLIFPGLRLAQTHQDALTLSADRPLLQLLLHTSFLSPLCTLWLWTKPV
FT                   ARDFLYQAPTRNMTFSVPSEGAFDSLRLWVLVALCLLRLAVTRPHLQAYLCLAKARVEQ
FT                   LRKEAGRIEAREIQQRVVRVYCYVTVVSLQYLTPLILTLHCTLLLKTLGGYSWALSSTP
FT                   PPLAPSQPSEALIPVDPAGDEAQQTAAQVAGILGGLLTPLFLRGMLAYIIWWTAACQLL
FT                   SSLFGLYFHQHLAAS"
FT   gene            complement(14665986..14693887)
FT                   /locus_tag="mCG_23098"
FT                   /note="gene_id=mCG23098.3"
FT   mRNA            complement(join(14665986..14668372,14669896..14670047,
FT                   14670429..14670545,14671007..14671173,14671659..14671684,
FT                   14673457..14673560,14675717..14675833,14693809..14693887))
FT                   /locus_tag="mCG_23098"
FT                   /product="mCG23098, transcript variant mCT170209"
FT                   /note="gene_id=mCG23098.3 transcript_id=mCT170209.1 created
FT                   on 24-JUN-2003"
FT   mRNA            complement(join(14665986..14668372,14669896..14670047,
FT                   14670429..14670545,14671007..14671173,14671587..14671684,
FT                   14673457..14673560,14675717..14675833,14693809..14693887))
FT                   /locus_tag="mCG_23098"
FT                   /product="mCG23098, transcript variant mCT23109"
FT                   /note="gene_id=mCG23098.3 transcript_id=mCT23109.3 created
FT                   on 24-JUN-2003"
FT   mRNA            complement(join(14665986..14668372,14669896..14670047,
FT                   14670429..14670545,14671007..14671173,14671659..14671684,
FT                   14673457..14673560,14675717..14675841,14693819..14693849))
FT                   /locus_tag="mCG_23098"
FT                   /product="mCG23098, transcript variant mCT185811"
FT                   /note="gene_id=mCG23098.3 transcript_id=mCT185811.0 created
FT                   on 24-JUN-2003"
FT   CDS             complement(join(14668065..14668372,14669896..14670047,
FT                   14670429..14670545,14671007..14671098))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23098"
FT                   /product="mCG23098, isoform CRA_b"
FT                   /note="gene_id=mCG23098.3 transcript_id=mCT185811.0
FT                   protein_id=mCP107068.0 isoform=CRA_b"
FT                   /protein_id="EDL28795.1"
FT                   /translation="MVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRLLAGALA
FT                   GTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPY
FT                   AGLSFFTYESLKSLHREYSGRPQPYPFERMVFGACAGLIGQSASYPLDVVRRRMQTAGV
FT                   TGHQHGSILSTLRSIVREEGAVRGLYKGLSMNWLKGPIAVGISFTTFDLMQILLRRLQS
FT                   "
FT   CDS             complement(join(14668065..14668372,14669896..14670047,
FT                   14670429..14670545,14671007..14671098))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23098"
FT                   /product="mCG23098, isoform CRA_b"
FT                   /note="gene_id=mCG23098.3 transcript_id=mCT170209.1
FT                   protein_id=mCP93041.1 isoform=CRA_b"
FT                   /protein_id="EDL28796.1"
FT                   /translation="MVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRLLAGALA
FT                   GTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPY
FT                   AGLSFFTYESLKSLHREYSGRPQPYPFERMVFGACAGLIGQSASYPLDVVRRRMQTAGV
FT                   TGHQHGSILSTLRSIVREEGAVRGLYKGLSMNWLKGPIAVGISFTTFDLMQILLRRLQS
FT                   "
FT   CDS             complement(join(14668065..14668372,14669896..14670047,
FT                   14670429..14670545,14671007..14671098))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23098"
FT                   /product="mCG23098, isoform CRA_b"
FT                   /note="gene_id=mCG23098.3 transcript_id=mCT23109.3
FT                   protein_id=mCP13253.3 isoform=CRA_b"
FT                   /protein_id="EDL28797.1"
FT                   /translation="MVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRLLAGALA
FT                   GTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPY
FT                   AGLSFFTYESLKSLHREYSGRPQPYPFERMVFGACAGLIGQSASYPLDVVRRRMQTAGV
FT                   TGHQHGSILSTLRSIVREEGAVRGLYKGLSMNWLKGPIAVGISFTTFDLMQILLRRLQS
FT                   "
FT   mRNA            complement(join(14669656..14670047,14670429..14670545,
FT                   14671007..14671173,14671659..14671684,14673457..14673560,
FT                   14675717..14675833,14693809..14693836))
FT                   /locus_tag="mCG_23098"
FT                   /product="mCG23098, transcript variant mCT173276"
FT                   /note="gene_id=mCG23098.3 transcript_id=mCT173276.1 created
FT                   on 24-JUN-2003"
FT   CDS             complement(join(14669660..14670047,14670429..14670545,
FT                   14671007..14671098))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23098"
FT                   /product="mCG23098, isoform CRA_a"
FT                   /note="gene_id=mCG23098.3 transcript_id=mCT173276.1
FT                   protein_id=mCP96195.1 isoform=CRA_a"
FT                   /protein_id="EDL28794.1"
FT                   /translation="MVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRLLAGALA
FT                   GTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPY
FT                   AGLSFFTYESLKSLHRGKGRWREEMGPRGAVPVNPIIQSHTGGQAGIQSPIQKTPSVQW
FT                   DPGAWAATFHVSIFIQLLSGGRTVEHKLTSSLPCS"
FT   gene            complement(14670838..14693859)
FT                   /locus_tag="mCG_146355"
FT                   /note="gene_id=mCG146355.0"
FT   mRNA            complement(join(14670838..14671173,14671659..14671684,
FT                   14673457..14673560,14675717..14675833,14693809..14693859))
FT                   /locus_tag="mCG_146355"
FT                   /product="mCG146355"
FT                   /note="gene_id=mCG146355.0 transcript_id=mCT173277.0
FT                   created on 24-JUN-2003"
FT   CDS             complement(join(14671136..14671173,14671659..14671684,
FT                   14673457..14673560,14675717..14675794))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146355"
FT                   /product="mCG146355"
FT                   /note="gene_id=mCG146355.0 transcript_id=mCT173277.0
FT                   protein_id=mCP96196.1"
FT                   /protein_id="EDL28798.1"
FT                   /translation="MVCRKARCACERMLKPSWLGPSPRRQRPQASAQLPAVWSPGWCTC
FT                   QDSSSPPGPDQDHLPSVFKKIFCQGGLPAPLLHLPQ"
FT   gene            complement(14673965..14693864)
FT                   /locus_tag="mCG_145765"
FT                   /note="gene_id=mCG145765.0"
FT   mRNA            complement(join(14673965..14675833,14693809..14693864))
FT                   /locus_tag="mCG_145765"
FT                   /product="mCG145765"
FT                   /note="gene_id=mCG145765.0 transcript_id=mCT185810.0
FT                   created on 24-JUN-2003"
FT   CDS             complement(14674293..14674634)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145765"
FT                   /product="mCG145765"
FT                   /note="gene_id=mCG145765.0 transcript_id=mCT185810.0
FT                   protein_id=mCP107069.0"
FT                   /protein_id="EDL28799.1"
FT                   /translation="MTAPCRGNYQLGTVHTPETQCKNLSWSVVTHTFKPNTLEAEVQGQ
FT                   PVLQSEFQDSQSYTEEPLPQDGSKIRHYNYTNKGRDGDQGLHTGVMKTGKLEGWSGTSC
FT                   GVTVPSPQS"
FT   gene            complement(14687088..14689094)
FT                   /locus_tag="mCG_147975"
FT                   /note="gene_id=mCG147975.0"
FT   mRNA            complement(join(14687088..14687872,14688538..14689094))
FT                   /locus_tag="mCG_147975"
FT                   /product="mCG147975"
FT                   /note="gene_id=mCG147975.0 transcript_id=mCT188238.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(14687237..14687644)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147975"
FT                   /product="mCG147975"
FT                   /note="gene_id=mCG147975.0 transcript_id=mCT188238.0
FT                   protein_id=mCP108242.0"
FT                   /protein_id="EDL28800.1"
FT                   /translation="MESRGLVGVGSFFYCVGSGSGTQGITIGSTTLCPGALSPLIYHQA
FT                   IFLDSEMQSKVFCVFSFKIFYFWFMSMKFLPACVYVSGVPSTRRGQKKVSRFPGSGVTD
FT                   GCELPCGCLEWKLYPLKEKSVLLTTEPVLQL"
FT   gene            complement(14702744..>14716750)
FT                   /locus_tag="mCG_23104"
FT                   /note="gene_id=mCG23104.2"
FT   mRNA            complement(join(14702744..14703430,14704659..14704796,
FT                   14705072..14705203,14706098..14706243,14707454..14708027,
FT                   14711830..14711912,14713579..14713705,14716409..>14716723))
FT                   /locus_tag="mCG_23104"
FT                   /product="mCG23104, transcript variant mCT23119"
FT                   /note="gene_id=mCG23104.2 transcript_id=mCT23119.2 created
FT                   on 19-JUN-2002"
FT   CDS             complement(join(14703218..14703430,14704659..14704796,
FT                   14705072..14705203,14706098..14706243,14707454..14708027,
FT                   14711830..14711912,14713579..14713705,14716409..>14716639))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23104"
FT                   /product="mCG23104, isoform CRA_b"
FT                   /note="gene_id=mCG23104.2 transcript_id=mCT23119.2
FT                   protein_id=mCP13315.2 isoform=CRA_b"
FT                   /protein_id="EDL28802.1"
FT                   /translation="EYCKSLRPTRILWLPSLYLCSRSPSLPRKGASRLKEGRRGEAAPL
FT                   RLRLYGGSKEPKAKSRVTAASPTLSPRGCVDPAVMASKRITQETFDAAVRENIEEFEMG
FT                   TEEAIREAVEQFESQGVDLSNIVKTIPKVSLDGLQEPTHSVLQALNDLQESLTGSRLQE
FT                   VSAHLVRFCDQCKQQKASRYLAAQKGAYPILLAAWQLAATSNQGLLLQALNALAVLTDG
FT                   QPDLLDAQGLHLLVATLAQNAANTELTCCGIRCVRHVCLKHEQNRQDLVKAGVLPLLTA
FT                   AITQHGQHADVVREACWALRVMTFDDDIRVPFGHAHEHAKMIVQENKGLKVLIEAARAF
FT                   SDNPGVLSELCSTLSRLAVRNEFCQEVIDLGGLGILVTLLADCNDHQDLVKQVLSALRA
FT                   IAGNDDVKDAIVRAGGTESIVAAMTRHLASPQVCEQSCAALCVLALRKPDNSRVIIEGG
FT                   GALAALQAMKAHPQEAGVQKQACMLIRNLVSRSQVFSKPILDLGAEELILQARAAHPDC
FT                   EDVAKAALRDLGCRVELRELWTGKKGDLAL"
FT   mRNA            complement(join(14707162..14708027,14711830..14711912,
FT                   14713579..14713705,14716409..>14716750))
FT                   /locus_tag="mCG_23104"
FT                   /product="mCG23104, transcript variant mCT170210"
FT                   /note="gene_id=mCG23104.2 transcript_id=mCT170210.0 created
FT                   on 19-JUN-2002"
FT   CDS             complement(join(14707416..14708027,14711830..14711912,
FT                   14713579..14713705,14716409..>14716639))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23104"
FT                   /product="mCG23104, isoform CRA_a"
FT                   /note="gene_id=mCG23104.2 transcript_id=mCT170210.0
FT                   protein_id=mCP93042.0 isoform=CRA_a"
FT                   /protein_id="EDL28801.1"
FT                   /translation="EYCKSLRPTRILWLPSLYLCSRSPSLPRKGASRLKEGRRGEAAPL
FT                   RLRLYGGSKEPKAKSRVTAASPTLSPRGCVDPAVMASKRITQETFDAAVRENIEEFEMG
FT                   TEEAIREAVEQFESQGVDLSNIVKTIPKVSLDGLQEPTHSVLQALNDLQESLTGSRLQE
FT                   VSAHLVRFCDQCKQQKASRYLAAQKGAYPILLAAWQLAATSNQGLLLQALNALAVLTDG
FT                   QPDLLDAQGLHLLVATLAQNAANTELTCCGIRCVRHVCLKHEQNRQDLVKAGVLPLLTA
FT                   AITQHGQHADVVREACWALRVMTFDDDIRVPFGHAHEHAKMIVQENKGLKVLIEAARGR
FT                   SSPGKRMVGG"
FT   gene            <14716847..14762128
FT                   /gene="Sfrs14"
FT                   /locus_tag="mCG_23110"
FT                   /note="gene_id=mCG23110.2"
FT   mRNA            join(<14716847..14716951,14718966..14719092,
FT                   14724800..14726365,14730681..14730801,14733869..14734356,
FT                   14735834..14735945,14739385..14739869,14741198..14741259,
FT                   14741938..14742074,14742724..14742844,14745126..14745767)
FT                   /gene="Sfrs14"
FT                   /locus_tag="mCG_23110"
FT                   /product="splicing factor, arginine/serine-rich 14,
FT                   transcript variant mCT23125"
FT                   /note="gene_id=mCG23110.2 transcript_id=mCT23125.2 created
FT                   on 19-JUN-2002"
FT   CDS             join(<14716895..14716951,14718966..14719092,
FT                   14724800..14726365,14730681..14730801,14733869..14734356,
FT                   14735834..14735945,14739385..14739869,14741198..14741259,
FT                   14741938..14742074,14742724..14742844)
FT                   /codon_start=1
FT                   /gene="Sfrs14"
FT                   /locus_tag="mCG_23110"
FT                   /product="splicing factor, arginine/serine-rich 14, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23110.2 transcript_id=mCT23125.2
FT                   protein_id=mCP13273.2 isoform=CRA_b"
FT                   /protein_id="EDL28804.1"
FT                   /translation="GARGGGGSGGGGTARGRLREKKKTMAARRMAQESLDSVLQEKSKR
FT                   YGDSEAVGEALHLKAQDLLRTGSRARADVYEDIHGDSRYSASGSGVYSLDMGREGLRGD
FT                   MFVGPSFRSSNQSVGEDSYLRKECGRDLEPAHTDSRDQSFGHRNLGHFPSQDWKLALRG
FT                   SWEQDLGHSVSQESSWSQEYGFGPSLLGDLASSRRMEKESRDYDLDHPGEVDSVSRSSG
FT                   QVLTRGRSLNIADQEGTLLGKGDTQGLLGAKGVGKLITLKSMTTKKIPVASRITSKPQG
FT                   TNQIQKPTPSPDVTIGTSPVLDEIQFAALKIPLGLDLRTLGLPRRKMGFDAIDKADVFS
FT                   RFGIEIIKWAGFHTIKDDLKFSQLFQTLFELETETCAKMLASFKCSLKPEHRDFCFFTI
FT                   KFLKHSALKTPRVDNEFLNMLLDKGAVKTKNCFFEIIKPFDKSIMRLQDRLLKGVTPLL
FT                   MACNAYELSVKMKTLTSPLDLAMALETTNSLCRKSLALLGQTFSLASSFRQEKILEAVG
FT                   LQDIAPSPAYFPNFEDSTLFGREYIDHLKAWLMASGYPLQLKRAVPPESREQKTTAQTW
FT                   ASSTLSQAVPQRADHRVVDTIDQLVMRVIQGRLSPRERTLLLQDPAYWFLSDESSLEYK
FT                   YYKLKLAESQRLNHSWPIVERRPTPAQCAVRAMLYAQAVRSLKRRLLPWQRRRLIRSQG
FT                   PRGLKAKKATTAQQTSLSSGTRQKHHGRQASGSLRVKPPPRDSSDAAQDCLSEPAKPCP
FT                   QPSSPGALGPSPRPTGADDSEALPASSRCPSANMDAKTMETAEKLARFVAQVGPEIEQF
FT                   SIENSTDNPDLWFLHDQSSSAFKFYREKVLELCPSISFQSTGEAGDSVQSPTAGKEGKG
FT                   EPQEGHPEQEASLEGTEVLPEEEEEDEEESEDEGGEETSTLRPQAGAAKCPGSEGSSPT
FT                   DSIPGEGSREDQASTPGLSQASSGSCFPRKRISSKSLKVGMIPAPKRVCLIQESKVHEP
FT                   VRIAYDRPRGRPIAKKKKPKDMEFSQQKLTDKNVGFQMLQKMGWKEGHGLGSLGKGIRE
FT                   PVSVGALSEGEGLGADGPEQKEDTFDVFRQRMMQMYRHKRASK"
FT   mRNA            join(<14734268..14734356,14735834..14735945,
FT                   14760678..14760817,14761897..14762128)
FT                   /gene="Sfrs14"
FT                   /locus_tag="mCG_23110"
FT                   /product="splicing factor, arginine/serine-rich 14,
FT                   transcript variant mCT170212"
FT                   /note="gene_id=mCG23110.2 transcript_id=mCT170212.0 created
FT                   on 19-JUN-2002"
FT   CDS             join(<14734269..14734356,14735834..14735945,
FT                   14760678..14760804)
FT                   /codon_start=1
FT                   /gene="Sfrs14"
FT                   /locus_tag="mCG_23110"
FT                   /product="splicing factor, arginine/serine-rich 14, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23110.2 transcript_id=mCT170212.0
FT                   protein_id=mCP93055.0 isoform=CRA_a"
FT                   /protein_id="EDL28803.1"
FT                   /translation="PGALGPSPRPTGADDSEALPASSRCPSANMDAKTMETAEKLARFV
FT                   AQVGPEIEQFSIENSTDNPDLCCSAEGSWEVGSRQEPRQDQQHGLPARCSLCVSGRLCP
FT                   EWGN"
FT   gene            complement(14744960..>14784705)
FT                   /gene="Ddx49"
FT                   /locus_tag="mCG_23105"
FT                   /note="gene_id=mCG23105.1"
FT   mRNA            complement(join(14744960..14745301,14764544..14764646,
FT                   14775869..14775943,14776084..14776155,14776255..14776343,
FT                   14776943..14777017,14777623..14777720,14777831..14777907,
FT                   14778640..14778715,14779160..14779300,14779388..14779575,
FT                   14780133..14780254,14780338..14780423,14783234..14783357,
FT                   14784578..>14784705))
FT                   /gene="Ddx49"
FT                   /locus_tag="mCG_23105"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 49"
FT                   /note="gene_id=mCG23105.1 transcript_id=mCT23120.1 created
FT                   on 19-JUN-2002"
FT   CDS             complement(join(14745117..14745301,14764544..14764646,
FT                   14775869..14775943,14776084..14776155,14776255..14776343,
FT                   14776943..14777017,14777623..14777720,14777831..14777907,
FT                   14778640..14778715,14779160..14779300,14779388..14779575,
FT                   14780133..14780254,14780338..14780423,14783234..14783357,
FT                   14784578..>14784704))
FT                   /codon_start=1
FT                   /gene="Ddx49"
FT                   /locus_tag="mCG_23105"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 49"
FT                   /note="gene_id=mCG23105.1 transcript_id=mCT23120.1
FT                   protein_id=mCP13257.1"
FT                   /protein_id="EDL28805.1"
FT                   /translation="RVWSMAGFAEIGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRD
FT                   CLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLK
FT                   DCIIVGGMDMVAQALELSRKPHVVIATPGRLADHLRSSNTFNMKKIQFLVMDEADRLLE
FT                   QGCTDFTTDLETILAAVPARRQTLLFSATLTDTLKELQGLATNEPFFWEAQATVRTVEQ
FT                   LDQRYLLVPEKVKDAYLVHLVQTFQDQLEDCSIIIFTNTCKTCQILCMMLRKFNFPTVA
FT                   LHSMMKQKERFAALAKFKSSIYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRV
FT                   GRTARAGRQGQAITLVTQYDIHLLHAIEEQIKQQLAELVVEEAEVLQILTQVNVVRREC
FT                   EIKLEASHFDEKKEINKRKQMILEGKDPDLEAKRKAELAKIKQQNRRFKEKGGPESSCG
FT                   FFEKKKFLDPQQLKHEDSLSPAPQNEDPYKHNYIQEVTSQVCSRFYQVQNQLARRTSRN
FT                   RNKLEPGQARPAQLLESMVLVDVTLELE"
FT   gene            14765294..14776606
FT                   /gene="Homer3"
FT                   /locus_tag="mCG_23106"
FT                   /note="gene_id=mCG23106.2"
FT   mRNA            join(14765294..14765356,14767490..14767571,
FT                   14767650..14767806,14768187..14768318,14771650..14771757,
FT                   14772308..14772429,14773263..14773419,14773574..14773684,
FT                   14773773..14773859,14775231..14776605)
FT                   /gene="Homer3"
FT                   /locus_tag="mCG_23106"
FT                   /product="homer homolog 3 (Drosophila), transcript variant
FT                   mCT23121"
FT                   /note="gene_id=mCG23106.2 transcript_id=mCT23121.2 created
FT                   on 19-JUN-2002"
FT   mRNA            join(<14765306..14765356,14767490..14767571,
FT                   14767650..14767806,14768187..14768318,14771650..14771757,
FT                   14772308..14772429,14773263..14773419,14773574..14773684,
FT                   14773782..14773859,14775231..14776606)
FT                   /gene="Homer3"
FT                   /locus_tag="mCG_23106"
FT                   /product="homer homolog 3 (Drosophila), transcript variant
FT                   mCT192545"
FT                   /note="gene_id=mCG23106.2 transcript_id=mCT192545.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<14767555..14767571,14767650..14767806,
FT                   14768187..14768318,14771650..14771757,14772308..14772429,
FT                   14773263..14773419,14773574..14773684,14773782..14773859,
FT                   14775231..14775422)
FT                   /codon_start=1
FT                   /gene="Homer3"
FT                   /locus_tag="mCG_23106"
FT                   /product="homer homolog 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG23106.2 transcript_id=mCT192545.0
FT                   protein_id=mCP113516.0 isoform=CRA_a"
FT                   /protein_id="EDL28806.1"
FT                   /translation="PMSTAREQPIFSTRAHVFQIDPTTKRNWIPAGKHALTVSYFYDAT
FT                   RNVYRIISIGGAKAIINSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQQLTQFA
FT                   EKFQEVKEAARLAREKSQDGGEFTSTGLALASHQVPPSPLVSTNGPGEEKLFRSQSADT
FT                   PGPTERERLKKMLSEGSVGEVQWEAEFFALQDSNQRLAGALREANAAATQWRQQLEVQR
FT                   AEAELLRQRVAELEAQVAVEPVRAGEKEATSQSVEQLEARVQTKDQTLKNQSTGTREAP
FT                   DTAEREETQQQVQDLETRNAELEQQLRSMECNLEEARAERERARAEVGRAAQLLDVRLF
FT                   ELSELREGLARLAEAAP"
FT   CDS             join(14767558..14767571,14767650..14767806,
FT                   14768187..14768318,14771650..14771757,14772308..14772429,
FT                   14773263..14773419,14773574..14773684,14773773..14773859,
FT                   14775231..14775422)
FT                   /codon_start=1
FT                   /gene="Homer3"
FT                   /locus_tag="mCG_23106"
FT                   /product="homer homolog 3 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG23106.2 transcript_id=mCT23121.2
FT                   protein_id=mCP13272.2 isoform=CRA_b"
FT                   /protein_id="EDL28807.1"
FT                   /translation="MSTAREQPIFSTRAHVFQIDPTTKRNWIPAGKHALTVSYFYDATR
FT                   NVYRIISIGGAKAIINSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQQLTQFAE
FT                   KFQEVKEAARLAREKSQDGGEFTSTGLALASHQVPPSPLVSTNGPGEEKLFRSQSADTP
FT                   GPTERERLKKMLSEGSVGEVQWEAEFFALQDSNQRLAGALREANAAATQWRQQLEVQRA
FT                   EAELLRQRVAELEAQVAVEPVRAGEKEATSQSVEQLEARVQTKDQEIQTLKNQSTGTRE
FT                   APDTAEREETQQQVQDLETRNAELEQQLRSMECNLEEARAERERARAEVGRAAQLLDVR
FT                   LFELSELREGLARLAEAAP"
FT   gene            14784861..14795221
FT                   /gene="Cope"
FT                   /locus_tag="mCG_23109"
FT                   /note="gene_id=mCG23109.2"
FT   mRNA            join(14784861..14785187,14786889..14786951,
FT                   14787890..14787990,14788754..14788906,14790185..14790238,
FT                   14790730..14790811,14792567..14792722,14793859..14793927,
FT                   14794937..14795220)
FT                   /gene="Cope"
FT                   /locus_tag="mCG_23109"
FT                   /product="coatomer protein complex, subunit epsilon,
FT                   transcript variant mCT170211"
FT                   /note="gene_id=mCG23109.2 transcript_id=mCT170211.0 created
FT                   on 19-JUN-2002"
FT   mRNA            join(14784880..14785187,14786889..14786951,
FT                   14787890..14787990,14788754..14788906,14790185..14790238,
FT                   14790730..14790811,14792567..14792722,14793859..14793927,
FT                   14794937..14795011,14795090..14795221)
FT                   /gene="Cope"
FT                   /locus_tag="mCG_23109"
FT                   /product="coatomer protein complex, subunit epsilon,
FT                   transcript variant mCT23124"
FT                   /note="gene_id=mCG23109.2 transcript_id=mCT23124.1 created
FT                   on 19-JUN-2002"
FT   mRNA            join(<14785055..14785187,14786889..14788906,
FT                   14790185..14790238,14790730..14790811,14792567..14792722,
FT                   14793859..14793927,14794937..14795011,14795090..14795221)
FT                   /gene="Cope"
FT                   /locus_tag="mCG_23109"
FT                   /product="coatomer protein complex, subunit epsilon,
FT                   transcript variant mCT192550"
FT                   /note="gene_id=mCG23109.2 transcript_id=mCT192550.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(14785062..14785187,14786889..14786951,
FT                   14787890..14787990,14788754..14788906,14790185..14790238,
FT                   14790730..14790811,14792567..14792722,14793859..14793927,
FT                   14794937..14795011,14795090..14795137)
FT                   /codon_start=1
FT                   /gene="Cope"
FT                   /locus_tag="mCG_23109"
FT                   /product="coatomer protein complex, subunit epsilon,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG23109.2 transcript_id=mCT23124.1
FT                   protein_id=mCP13256.1 isoform=CRA_c"
FT                   /protein_id="EDL28810.1"
FT                   /translation="MAPPVPGAVSGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSS
FT                   PEREVERDVFLYRAYLAQRKYGVVLDEIKPSSAPELQAVRMFAEYLASENQRDSIVLEL
FT                   DREMSRSVDVTNTTFLLMAASIYFHDQNPDAALRTLHQGDGLECMAMTIQILLKLDRLD
FT                   LARKELKKMQDQDEDATLTQLATAWVNLAVGGEKLQEAYYIFQELADKCSPTLLLLNGQ
FT                   AACHSAQGRWETAEGVLQEALDKDSGHPETLINLIVLSQHLGKPPEVTNRYLSQLKDAH
FT                   RAHPFIKEYQAKENDFDRLAMQYAPSA"
FT   CDS             join(14785062..14785187,14786889..14786951,
FT                   14787890..14787990,14788754..14788906,14790185..14790238,
FT                   14790730..14790811,14792567..14792722,14793859..14793927,
FT                   14794937..14795089)
FT                   /codon_start=1
FT                   /gene="Cope"
FT                   /locus_tag="mCG_23109"
FT                   /product="coatomer protein complex, subunit epsilon,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG23109.2 transcript_id=mCT170211.0
FT                   protein_id=mCP93049.0 isoform=CRA_a"
FT                   /protein_id="EDL28808.1"
FT                   /translation="MAPPVPGAVSGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSS
FT                   PEREVERDVFLYRAYLAQRKYGVVLDEIKPSSAPELQAVRMFAEYLASENQRDSIVLEL
FT                   DREMSRSVDVTNTTFLLMAASIYFHDQNPDAALRTLHQGDGLECMAMTIQILLKLDRLD
FT                   LARKELKKMQDQDEDATLTQLATAWVNLAVGGEKLQEAYYIFQELADKCSPTLLLLNGQ
FT                   AACHSAQGRWETAEGVLQEALDKDSGHPETLINLIVLSQHLGKPPEVTNRYLSQLKDAH
FT                   RAHPFIKEYQAKVSRAVVPMDGREEAVLSHAMSLLPL"
FT   CDS             join(<14788737..14788906,14790185..14790238,
FT                   14790730..14790811,14792567..14792722,14793859..14793927,
FT                   14794937..14795011,14795090..14795137)
FT                   /codon_start=1
FT                   /gene="Cope"
FT                   /locus_tag="mCG_23109"
FT                   /product="coatomer protein complex, subunit epsilon,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23109.2 transcript_id=mCT192550.0
FT                   protein_id=mCP113517.0 isoform=CRA_b"
FT                   /protein_id="EDL28809.1"
FT                   /translation="AATSCRDSIVLELDREMSRSVDVTNTTFLLMAASIYFHDQNPDAA
FT                   LRTLHQGDGLECMAMTIQILLKLDRLDLARKELKKMQDQDEDATLTQLATAWVNLAVGG
FT                   EKLQEAYYIFQELADKCSPTLLLLNGQAACHSAQGRWETAEGVLQEALDKDSGHPETLI
FT                   NLIVLSQHLGKPPEVTNRYLSQLKDAHRAHPFIKEYQAKENDFDRLAMQYAPSA"
FT   gene            14797750..14814170
FT                   /locus_tag="mCG_23111"
FT                   /note="gene_id=mCG23111.2"
FT   mRNA            join(14797750..14798335,14800418..14800577,
FT                   14803735..14803915,14804764..14804925,14805338..14805485,
FT                   14805597..14805706,14811773..14812511,14812934..14814170)
FT                   /locus_tag="mCG_23111"
FT                   /product="mCG23111"
FT                   /note="gene_id=mCG23111.2 transcript_id=mCT23126.3 created
FT                   on 23-JUN-2003"
FT   gene            14797750..14813822
FT                   /locus_tag="mCG_142774"
FT                   /note="gene_id=mCG142774.0"
FT   mRNA            join(14797750..14798335,14800418..14800577,
FT                   14803735..14803915,14804764..14804925,14805338..14805485,
FT                   14805597..14805706,14811773..14812511,14812934..14813822)
FT                   /locus_tag="mCG_142774"
FT                   /product="mCG142774"
FT                   /note="gene_id=mCG142774.0 transcript_id=mCT185165.0
FT                   created on 02-JUN-2003"
FT   CDS             join(14798087..14798335,14800418..14800577,
FT                   14803735..14803915,14804764..14804925,14805338..14805485,
FT                   14805597..14805706,14811773..14811815)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142774"
FT                   /product="mCG142774"
FT                   /note="gene_id=mCG142774.0 transcript_id=mCT185165.0
FT                   protein_id=mCP106423.0"
FT                   /db_xref="GOA:A2RT05"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="InterPro:IPR016439"
FT                   /db_xref="UniProtKB/TrEMBL:A2RT05"
FT                   /protein_id="EDL28811.1"
FT                   /translation="MAAAAATPRLEAPEPMPSYAQMLQRSWASALAAAQGCGDCGWGLA
FT                   RRGLAEHAHLAAPELLLAVLCALGWTALRWAATTHIFRPLAKRCRLQPRDAARLPESAW
FT                   KLLFYLACWSYCAYLLLGTSYPFFHDPPSVFYDWRSGMAVPWDIAVAYLLQGSFYCHSI
FT                   YATVYMDSWRKDSVVMLVHHVVTLLLIASSYAFRYHNVGLLVFFLHDVSDVQLEFTKLN
FT                   IYFKARGGAYHRLHGLVANLGCLSFCFCWFWFRLYWFPLKVLYATCHCSLQSVPDIPYY
FT                   FFFNILLLLLMVMNIYWFLYIVAFAAKVLTGQMRELEDLREYDTLEAQTAKPCKAEKPL
FT                   RNGLVKDKLF"
FT   CDS             join(14812217..14812511,14812934..14813712)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23111"
FT                   /product="mCG23111"
FT                   /note="gene_id=mCG23111.2 transcript_id=mCT23126.3
FT                   protein_id=mCP13262.2"
FT                   /protein_id="EDL28812.1"
FT                   /translation="MLPVCHRFCDHLLLLLLLPSTTLAPAPASMGPAAALLQVLGLPEA
FT                   PRSVPTHRPVPPVMWRLFRRRDPQEARVGRPLRPCHVEELGVAGNIVRHIPDSGLSSRP
FT                   AQPARTSGLCPEWTVVFDLSNVEPTERPTRARLELRLEAECEDTGGWELSVALWADAEH
FT                   PGPELLRVPAPPGVLLRADLLGTAVAANASVPCTVRLALSLHPGATAACGRLAEASLLL
FT                   VTLDPRLCPLPRLRRHTEPRVEVGPVGTCRTRRLHVSFREVGWHRWVIAPRGFLANFCQ
FT                   GTCALPETLRGPGGPPALNHAVLRALMHAAAPTPGAGSPCCVPERLSPISVLFFDNSDN
FT                   VVLRHYEDMVVDECGCR"
FT   gene            complement(14813765..14835648)
FT                   /gene="Upf1"
FT                   /locus_tag="mCG_23102"
FT                   /note="gene_id=mCG23102.3"
FT   mRNA            complement(join(14813765..14814710,14814851..14814977,
FT                   14815208..14815425,14815506..14815667,14816128..14816209,
FT                   14816308..14816482,14816854..14816996,14817469..14817625,
FT                   14817890..14818007,14819253..14819466,14819725..14819868,
FT                   14820442..14820556,14820633..14820797,14821109..14821227,
FT                   14821303..14821462,14821547..14821655,14821966..14822064,
FT                   14822205..14822322,14822773..14822934,14823683..14823863,
FT                   14824233..14824400,14825559..14825648,14826450..14826589,
FT                   14834998..>14835493))
FT                   /gene="Upf1"
FT                   /locus_tag="mCG_23102"
FT                   /product="UPF1 regulator of nonsense transcripts homolog
FT                   (yeast), transcript variant mCT192539"
FT                   /note="gene_id=mCG23102.3 transcript_id=mCT192539.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(14813768..14814710,14814851..14814977,
FT                   14815208..14815425,14815506..14815667,14816128..14816209,
FT                   14816308..14816482,14816854..14816996,14817469..14817625,
FT                   14817890..14818007,14819253..14819466,14819725..14819868,
FT                   14820442..14820556,14820633..14820797,14821109..14821227,
FT                   14821303..14821462,14821547..14821655,14821966..14822064,
FT                   14822238..14822322,14822773..14822934,14823683..14823863,
FT                   14824233..14824400,14825559..14825648,14826450..14826589,
FT                   14834998..14835648))
FT                   /gene="Upf1"
FT                   /locus_tag="mCG_23102"
FT                   /product="UPF1 regulator of nonsense transcripts homolog
FT                   (yeast), transcript variant mCT23117"
FT                   /note="gene_id=mCG23102.3 transcript_id=mCT23117.2 created
FT                   on 26-JUN-2002"
FT   CDS             complement(join(14814858..14814977,14815208..14815425,
FT                   14815506..14815667,14816128..14816209,14816308..14816482,
FT                   14816854..14816996,14817469..14817625,14817890..14818007,
FT                   14819253..14819466,14819725..14819868,14820442..14820556,
FT                   14820633..14820797,14821109..14821227,14821303..14821462,
FT                   14821547..14821655,14821966..14822064,14822205..14822322,
FT                   14822773..14822934,14823683..14823863,14824233..14824400,
FT                   14825559..14825648,14826450..14826589,14834998..>14835234))
FT                   /codon_start=1
FT                   /gene="Upf1"
FT                   /locus_tag="mCG_23102"
FT                   /product="UPF1 regulator of nonsense transcripts homolog
FT                   (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG23102.3 transcript_id=mCT192539.0
FT                   protein_id=mCP113515.0 isoform=CRA_a"
FT                   /protein_id="EDL28813.1"
FT                   /translation="RRGPGGRMSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDF
FT                   TLPSQTQTPPGGPGGAGGPGGAGAGGAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAE
FT                   LNFEEDEEDTYYTKDLPVHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLV
FT                   RAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLK
FT                   DINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLED
FT                   LEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLN
FT                   KKRIAFFTLPKTDSGNEDLVIIWLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDN
FT                   YGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKL
FT                   LGHEVEDVVIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSAT
FT                   IVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHN
FT                   QIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGD
FT                   PRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLS
FT                   QSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWP
FT                   QPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQ
FT                   RSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRR
FT                   LNVALTRARYGVIIVGNPKALSKQPLWNHLLSYYKEQKALVEGPLNNLRESLMQFSKPR
FT                   KLVNTVNPGARFMTTAMYDAREAIIPGSVYDRSSQGRPSNMYFQTHDQISMISAGPSHV
FT                   AAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPKTKTGRGGRQKNRFGLPGPSQTTL
FT                   PNSQASQDVASQPFSQGALTQGYVSMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVA
FT                   LSQDSTYQGERAYQHGGVTGLSQY"
FT   CDS             complement(join(14814858..14814977,14815208..14815425,
FT                   14815506..14815667,14816128..14816209,14816308..14816482,
FT                   14816854..14816996,14817469..14817625,14817890..14818007,
FT                   14819253..14819466,14819725..14819868,14820442..14820556,
FT                   14820633..14820797,14821109..14821227,14821303..14821462,
FT                   14821547..14821655,14821966..14822064,14822238..14822322,
FT                   14822773..14822934,14823683..14823863,14824233..14824400,
FT                   14825559..14825648,14826450..14826589,14834998..14835213))
FT                   /codon_start=1
FT                   /gene="Upf1"
FT                   /locus_tag="mCG_23102"
FT                   /product="UPF1 regulator of nonsense transcripts homolog
FT                   (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG23102.3 transcript_id=mCT23117.2
FT                   protein_id=mCP13265.2 isoform=CRA_b"
FT                   /protein_id="EDL28814.1"
FT                   /translation="MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQ
FT                   TPPGGPGGAGGPGGAGAGGAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDE
FT                   EDTYYTKDLPVHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEV
FT                   TLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSS
FT                   QWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVD
FT                   EEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAFF
FT                   TLPKTDSDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVE
FT                   VTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVVIKCQLPKRF
FT                   TAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAP
FT                   SNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLK
FT                   DETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQ
FT                   ATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQ
FT                   VQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIA
FT                   SSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKL
FT                   YQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNP
FT                   KALSKQPLWNHLLSYYKEQKALVEGPLNNLRESLMQFSKPRKLVNTVNPGARFMTTAMY
FT                   DAREAIIPGSVYDRSSQGRPSNMYFQTHDQISMISAGPSHVAAMNIPIPFNLVMPPMPP
FT                   PGYFGQANGPAAGRGTPKTKTGRGGRQKNRFGLPGPSQTTLPNSQASQDVASQPFSQGA
FT                   LTQGYVSMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGV
FT                   TGLSQY"
FT   gene            14855735..14864246
FT                   /gene="Comp"
FT                   /locus_tag="mCG_23103"
FT                   /note="gene_id=mCG23103.2"
FT   mRNA            join(14855735..14855830,14856036..14856121,
FT                   14856556..14856607,14856988..14857157,14857913..14858050,
FT                   14858225..14858299,14858380..14858538,14858621..14858725,
FT                   14858819..14858926,14859280..14859439,14860797..14860915,
FT                   14861081..14861133,14861217..14861398,14861576..14861754,
FT                   14861862..14861910,14862286..14862482,14863426..14863598,
FT                   14863853..14863992,14864067..14864246)
FT                   /gene="Comp"
FT                   /locus_tag="mCG_23103"
FT                   /product="cartilage oligomeric matrix protein"
FT                   /note="gene_id=mCG23103.2 transcript_id=mCT23118.2 created
FT                   on 26-JUN-2002"
FT   CDS             join(14855755..14855830,14856036..14856121,
FT                   14856556..14856607,14856988..14857157,14857913..14858050,
FT                   14858225..14858299,14858380..14858538,14858621..14858725,
FT                   14858819..14858926,14859280..14859439,14860797..14860915,
FT                   14861081..14861133,14861217..14861398,14861576..14861754,
FT                   14861862..14861910,14862286..14862482,14863426..14863598,
FT                   14863853..14863992,14864067..14864113)
FT                   /codon_start=1
FT                   /gene="Comp"
FT                   /locus_tag="mCG_23103"
FT                   /product="cartilage oligomeric matrix protein"
FT                   /note="gene_id=mCG23103.2 transcript_id=mCT23118.2
FT                   protein_id=mCP13298.1"
FT                   /db_xref="GOA:Q9R0G6"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR008859"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017897"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR024665"
FT                   /db_xref="InterPro:IPR028492"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="MGI:MGI:88469"
FT                   /db_xref="PDB:1MZ9"
FT                   /db_xref="PDB:3V2N"
FT                   /db_xref="PDB:3V2P"
FT                   /db_xref="PDB:3V2Q"
FT                   /db_xref="PDB:3V2R"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0G6"
FT                   /protein_id="EDL28815.1"
FT                   /translation="MGPTACVLVLALAILRATGQGQIPLGGDLAPQMLRELQETNAALQ
FT                   DVRELLRQQVKEITFLKNTVMECDACGMQPARTPGLSVRPVPLCAPGSCFPGVVCSETA
FT                   TGARCGPCPPGYTGNGSHCTDVNECNAHPCFPRVRCINTSPGFHCEACPPGFSGPTHEG
FT                   VGLTFAKSNKQVCTDINECETGQHNCVPNSVCVNTRGSFQCGPCQPGFVGDQTSGCQRR
FT                   GQHFCPDGSPSPCHEKANCVLERDGSRSCVCAVGWAGNGLLCGRDTDLDGFPDEKLRCS
FT                   ERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEQDNCPLVRNPDQRNSDSD
FT                   KWGDACDNCRSKKNDDQKDTDLDGRGDACDDDIDGDRIRNVADNCPRVPNFDQSDSDGD
FT                   GVGDACDNCPQKDNPDQRDVDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQQDSD
FT                   HDGKGDACDDDDDNDGVPDSRDNCRLVPNPGQEDNDRDGVGDACQGDFDADKVIDKIDV
FT                   CPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFN
FT                   GVDFEGTFHVNTATDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQL
FT                   KAVKSSTGPGEQLRNALWHTGDTASQVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIR
FT                   VRFYEGPELVADSNVVLDTAMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYESHRLQ
FT                   RV"
FT   gene            complement(14867665..>14921775)
FT                   /gene="Crtc1"
FT                   /locus_tag="mCG_140606"
FT                   /note="gene_id=mCG140606.0"
FT   mRNA            complement(join(14867665..14868515,14869721..14869901,
FT                   14870255..14870341,14873340..14873441,14874029..14874331,
FT                   14875090..14875223,14879914..14880122,14880460..14880500,
FT                   14882777..14882862,14884589..14884683,14887417..14887470,
FT                   14891053..14891169,14921618..>14921775))
FT                   /gene="Crtc1"
FT                   /locus_tag="mCG_140606"
FT                   /product="CREB regulated transcription coactivator 1"
FT                   /note="gene_id=mCG140606.0 transcript_id=mCT170284.0
FT                   created on 26-JUN-2002"
FT   CDS             complement(join(14868304..14868515,14869721..14869901,
FT                   14870255..14870341,14873340..14873441,14874029..14874331,
FT                   14875090..14875223,14879914..14880122,14880460..14880500,
FT                   14882777..14882862,14884589..14884683,14887417..14887470,
FT                   14891053..>14891090))
FT                   /codon_start=1
FT                   /gene="Crtc1"
FT                   /locus_tag="mCG_140606"
FT                   /product="CREB regulated transcription coactivator 1"
FT                   /note="gene_id=mCG140606.0 transcript_id=mCT170284.0
FT                   protein_id=mCP93202.0"
FT                   /protein_id="EDL28816.1"
FT                   /translation="TRLEAAAWTWPSSCPYGTVYLSPPADTSWRRTNSDSALHQSTMTP
FT                   SQAESFTGGSQDAHQKRVLLLTVPGMEDTGAETDKTLSKQSWDSKKAGSRPKSCEVPGI
FT                   NIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPPFPALTSSSSTGS
FT                   LAHLGVGGAGQGMNTPSSSPQHRPAVVSPLSLSTEARRQQAQQVSPTLSPLSPITQAVA
FT                   MDALSLEQQLPYAFFTQTGSQQPPPQPQPPPPPPPVSQQQPPPPQVSVGLPQGGPLLPS
FT                   ASLTRGPQLPPLSVTVPSTLPQSPTENPGQSPMGIDATSAPALQYRTSAGSPATQSPTS
FT                   PVSNQGFSPGSSPQHTSTLGSVFGDAYYEQQMTARQANALSRQLEQFNMMENAISSSSL
FT                   YNPGSTLNYSQAAMMGLSGSHGGLQDPQQLGYTGHGGIPNIILTVTGESPPSLSKELSS
FT                   TLAGVSDVSFDSDHQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL"
FT   gene            complement(14931824..14959149)
FT                   /gene="Klhl26"
FT                   /locus_tag="mCG_23113"
FT                   /note="gene_id=mCG23113.2"
FT   mRNA            complement(join(14931824..14935338,14937785..14937967,
FT                   14959021..14959149))
FT                   /gene="Klhl26"
FT                   /locus_tag="mCG_23113"
FT                   /product="kelch-like 26 (Drosophila), transcript variant
FT                   mCT23128"
FT                   /note="gene_id=mCG23113.2 transcript_id=mCT23128.2 created
FT                   on 17-JUN-2003"
FT   mRNA            complement(join(14932539..14932763,14932999..14935338,
FT                   14937785..14937967,14957978..>14958069))
FT                   /gene="Klhl26"
FT                   /locus_tag="mCG_23113"
FT                   /product="kelch-like 26 (Drosophila), transcript variant
FT                   mCT192543"
FT                   /note="gene_id=mCG23113.2 transcript_id=mCT192543.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(14932547..14935172,14937785..14937967,
FT                   14959021..14959116))
FT                   /gene="Klhl26"
FT                   /locus_tag="mCG_23113"
FT                   /product="kelch-like 26 (Drosophila), transcript variant
FT                   mCT170287"
FT                   /note="gene_id=mCG23113.2 transcript_id=mCT170287.1 created
FT                   on 17-JUN-2003"
FT   mRNA            complement(join(14932547..14935236,14937785..14937967,
FT                   14959021..14959112))
FT                   /gene="Klhl26"
FT                   /locus_tag="mCG_23113"
FT                   /product="kelch-like 26 (Drosophila), transcript variant
FT                   mCT170285"
FT                   /note="gene_id=mCG23113.2 transcript_id=mCT170285.1 created
FT                   on 17-JUN-2003"
FT   mRNA            complement(join(14932547..14935338,14937785..14937967,
FT                   14957978..14958068))
FT                   /gene="Klhl26"
FT                   /locus_tag="mCG_23113"
FT                   /product="kelch-like 26 (Drosophila), transcript variant
FT                   mCT170286"
FT                   /note="gene_id=mCG23113.2 transcript_id=mCT170286.1 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(14933757..14935236,14937785..14937967,
FT                   14959021..14959076))
FT                   /codon_start=1
FT                   /gene="Klhl26"
FT                   /locus_tag="mCG_23113"
FT                   /product="kelch-like 26 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG23113.2 transcript_id=mCT170285.1
FT                   protein_id=mCP93204.1 isoform=CRA_a"
FT                   /protein_id="EDL28817.1"
FT                   /translation="MAESGGSSGSSQSPERPSSLADRNGALKCTFSAAGHSTGLLQGLA
FT                   ALRAQGQLLDVVLTVNSEAFHAHKVVLAACSDYFSAEVTLDLDCVQDVLGAAVFLQMLP
FT                   VVELCEDFLKAAMSVETCLHIGQMATTFSLTSLRESVDAFTFRHFLQIAAEEDFLRLPL
FT                   ERLVFFLQSNRLQSCAEIDLFRAAVRWLQHDPARRARASLVLRHVRFPLMQPAELVDSV
FT                   QTLDVMLDDALCRQYLLEAFSYHVLPCRQHDMQSPRTAVRSDVASLVAFGGTPYTDSDR
FT                   AVSSKVFQLPEPGARHFRELTEMELGCSHAGVAVLDNFVYVAGGQHLQHRSGEGAVDAC
FT                   YRYDPQRNRWLRLRALRESRVQFQLTALGGLLYATGGRNRAGSLASVERYCPRRDSWDF
FT                   ACPLKRRTWGHAGAAAAGRLYISGGYGVSAEDKKALQCYDPAADRWEPRAPMREPRVLH
FT                   AMLGAAGRIYALGGRMDHVDRCFDVLAVEYYVPDADQWTSVTPMRAGQSEAGCCLLERK
FT                   IYIVGGYNWRLNNVTGIVQVYNTETDEWERDLHFPESFAGIACAAVLLPRSGHGR"
FT   CDS             complement(join(14933757..14935338,14937785..14937967,
FT                   14959021..14959076))
FT                   /codon_start=1
FT                   /gene="Klhl26"
FT                   /locus_tag="mCG_23113"
FT                   /product="kelch-like 26 (Drosophila), isoform CRA_d"
FT                   /note="gene_id=mCG23113.2 transcript_id=mCT23128.2
FT                   protein_id=mCP13260.3 isoform=CRA_d"
FT                   /protein_id="EDL28820.1"
FT                   /translation="MAESGGSSGSSQSPERPSSLADRNGALKCTFSAAGHSTGLLQGLA
FT                   ALRAQGQLLDVVLTVNSEAFHAHKVVLAACSDYFRAMFTGGMREANQAVIQLQGVSARG
FT                   LRHIIDFAYSAEVTLDLDCVQDVLGAAVFLQMLPVVELCEDFLKAAMSVETCLHIGQMA
FT                   TTFSLTSLRESVDAFTFRHFLQIAAEEDFLRLPLERLVFFLQSNRLQSCAEIDLFRAAV
FT                   RWLQHDPARRARASLVLRHVRFPLMQPAELVDSVQTLDVMLDDALCRQYLLEAFSYHVL
FT                   PCRQHDMQSPRTAVRSDVASLVAFGGTPYTDSDRAVSSKVFQLPEPGARHFRELTEMEL
FT                   GCSHAGVAVLDNFVYVAGGQHLQHRSGEGAVDACYRYDPQRNRWLRLRALRESRVQFQL
FT                   TALGGLLYATGGRNRAGSLASVERYCPRRDSWDFACPLKRRTWGHAGAAAAGRLYISGG
FT                   YGVSAEDKKALQCYDPAADRWEPRAPMREPRVLHAMLGAAGRIYALGGRMDHVDRCFDV
FT                   LAVEYYVPDADQWTSVTPMRAGQSEAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTET
FT                   DEWERDLHFPESFAGIACAAVLLPRSGHGR"
FT   CDS             complement(join(14933757..14935338,14937785..14937967,
FT                   14957978..>14958012))
FT                   /codon_start=1
FT                   /gene="Klhl26"
FT                   /locus_tag="mCG_23113"
FT                   /product="kelch-like 26 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG23113.2 transcript_id=mCT192543.0
FT                   protein_id=mCP113518.0 isoform=CRA_c"
FT                   /protein_id="EDL28819.1"
FT                   /translation="QACISIPVVHASLADRNGALKCTFSAAGHSTGLLQGLAALRAQGQ
FT                   LLDVVLTVNSEAFHAHKVVLAACSDYFRAMFTGGMREANQAVIQLQGVSARGLRHIIDF
FT                   AYSAEVTLDLDCVQDVLGAAVFLQMLPVVELCEDFLKAAMSVETCLHIGQMATTFSLTS
FT                   LRESVDAFTFRHFLQIAAEEDFLRLPLERLVFFLQSNRLQSCAEIDLFRAAVRWLQHDP
FT                   ARRARASLVLRHVRFPLMQPAELVDSVQTLDVMLDDALCRQYLLEAFSYHVLPCRQHDM
FT                   QSPRTAVRSDVASLVAFGGTPYTDSDRAVSSKVFQLPEPGARHFRELTEMELGCSHAGV
FT                   AVLDNFVYVAGGQHLQHRSGEGAVDACYRYDPQRNRWLRLRALRESRVQFQLTALGGLL
FT                   YATGGRNRAGSLASVERYCPRRDSWDFACPLKRRTWGHAGAAAAGRLYISGGYGVSAED
FT                   KKALQCYDPAADRWEPRAPMREPRVLHAMLGAAGRIYALGGRMDHVDRCFDVLAVEYYV
FT                   PDADQWTSVTPMRAGQSEAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTETDEWERDL
FT                   HFPESFAGIACAAVLLPRSGHGR"
FT   CDS             complement(14933757..14935334)
FT                   /codon_start=1
FT                   /gene="Klhl26"
FT                   /locus_tag="mCG_23113"
FT                   /product="kelch-like 26 (Drosophila), isoform CRA_e"
FT                   /note="gene_id=mCG23113.2 transcript_id=mCT170286.1
FT                   protein_id=mCP93203.1 isoform=CRA_e"
FT                   /protein_id="EDL28821.1"
FT                   /translation="MFTGGMREANQAVIQLQGVSARGLRHIIDFAYSAEVTLDLDCVQD
FT                   VLGAAVFLQMLPVVELCEDFLKAAMSVETCLHIGQMATTFSLTSLRESVDAFTFRHFLQ
FT                   IAAEEDFLRLPLERLVFFLQSNRLQSCAEIDLFRAAVRWLQHDPARRARASLVLRHVRF
FT                   PLMQPAELVDSVQTLDVMLDDALCRQYLLEAFSYHVLPCRQHDMQSPRTAVRSDVASLV
FT                   AFGGTPYTDSDRAVSSKVFQLPEPGARHFRELTEMELGCSHAGVAVLDNFVYVAGGQHL
FT                   QHRSGEGAVDACYRYDPQRNRWLRLRALRESRVQFQLTALGGLLYATGGRNRAGSLASV
FT                   ERYCPRRDSWDFACPLKRRTWGHAGAAAAGRLYISGGYGVSAEDKKALQCYDPAADRWE
FT                   PRAPMREPRVLHAMLGAAGRIYALGGRMDHVDRCFDVLAVEYYVPDADQWTSVTPMRAG
FT                   QSEAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTETDEWERDLHFPESFAGIACAAVL
FT                   LPRSGHGR"
FT   CDS             complement(14933757..14935172)
FT                   /codon_start=1
FT                   /gene="Klhl26"
FT                   /locus_tag="mCG_23113"
FT                   /product="kelch-like 26 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG23113.2 transcript_id=mCT170287.1
FT                   protein_id=mCP93205.1 isoform=CRA_b"
FT                   /protein_id="EDL28818.1"
FT                   /translation="MLPVVELCEDFLKAAMSVETCLHIGQMATTFSLTSLRESVDAFTF
FT                   RHFLQIAAEEDFLRLPLERLVFFLQSNRLQSCAEIDLFRAAVRWLQHDPARRARASLVL
FT                   RHVRFPLMQPAELVDSVQTLDVMLDDALCRQYLLEAFSYHVLPCRQHDMQSPRTAVRSD
FT                   VASLVAFGGTPYTDSDRAVSSKVFQLPEPGARHFRELTEMELGCSHAGVAVLDNFVYVA
FT                   GGQHLQHRSGEGAVDACYRYDPQRNRWLRLRALRESRVQFQLTALGGLLYATGGRNRAG
FT                   SLASVERYCPRRDSWDFACPLKRRTWGHAGAAAAGRLYISGGYGVSAEDKKALQCYDPA
FT                   ADRWEPRAPMREPRVLHAMLGAAGRIYALGGRMDHVDRCFDVLAVEYYVPDADQWTSVT
FT                   PMRAGQSEAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTETDEWERDLHFPESFAGIA
FT                   CAAVLLPRSGHGR"
FT   gene            complement(14966029..>14969507)
FT                   /gene="5330410G16Rik"
FT                   /locus_tag="mCG_23115"
FT                   /note="gene_id=mCG23115.1"
FT   mRNA            complement(join(14966029..14966604,14966704..14966821,
FT                   14966902..14967016,14967250..14967352,14967845..14967997,
FT                   14968207..14968304,14968398..14968542,14969338..>14969507))
FT                   /gene="5330410G16Rik"
FT                   /locus_tag="mCG_23115"
FT                   /product="RIKEN cDNA 5330410G16"
FT                   /note="gene_id=mCG23115.1 transcript_id=mCT23130.1 created
FT                   on 26-JUN-2002"
FT   CDS             complement(join(14966473..14966604,14966704..14966821,
FT                   14966902..14967016,14967250..14967352,14967845..14967997,
FT                   14968207..14968304,14968398..14968542,14969338..>14969505))
FT                   /codon_start=1
FT                   /gene="5330410G16Rik"
FT                   /locus_tag="mCG_23115"
FT                   /product="RIKEN cDNA 5330410G16"
FT                   /note="gene_id=mCG23115.1 transcript_id=mCT23130.1
FT                   protein_id=mCP13282.1"
FT                   /protein_id="EDL28822.1"
FT                   /translation="RCASSAMAAVALPLLLLLASLVTPTPARDPFAPQLGDTQRCQQRC
FT                   RQHHPGSPPAQPEPEGPSESPNNKAILISACERGCRLFSICRFVAKSSRPNATETECEA
FT                   ACTEAYVKAAEQRACSEGCWGQIPEPETQLEQKDLALDPPRGRLSLRYLFSMLCSDLMS
FT                   SAQGFLSSSWTYSLQTDNRKVVVFQTQPVAENFAFQGSHLQRVEVTWRRSHPKALELHM
FT                   DPVGPLDKVRKAKPRVKTSKAKVESEDQQESDFLSCMSRRSGLPRWVLFCCLFLSILIM
FT                   LWLSCCTLVTTPGQHLKFQPLTAEQHKGLLVESDWPLYPPLPPPAYEDSTPPYKLKLDL
FT                   TTL"
FT   gene            <14970892..>14971273
FT                   /locus_tag="mCG_1049005"
FT                   /note="gene_id=mCG1049005.0"
FT   mRNA            join(<14970892..14971023,14971107..>14971273)
FT                   /locus_tag="mCG_1049005"
FT                   /product="mCG1049005"
FT                   /note="gene_id=mCG1049005.0 transcript_id=mCT166709.0
FT                   created on 26-JUN-2002"
FT   CDS             join(<14970894..14971023,14971107..14971273)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049005"
FT                   /product="mCG1049005"
FT                   /note="gene_id=mCG1049005.0 transcript_id=mCT166709.0
FT                   protein_id=mCP53989.0"
FT                   /protein_id="EDL28823.1"
FT                   /translation="RSLCAGTPTVSSSRTPWHMPIIPTRGKAEAEESVRGPGQSGLGRG
FT                   KPGTRTPGQSRNSSSHLSFAESRALNPSAITVLHSISNKHSFQQRFSCHDFFL"
FT   gene            14975325..14986250
FT                   /gene="Crlf1"
FT                   /locus_tag="mCG_23122"
FT                   /note="gene_id=mCG23122.1"
FT   mRNA            join(14975325..14975569,14980766..14981047,
FT                   14981262..14981391,14981499..14981668,14983053..14983210,
FT                   14983279..14983447,14985474..14985661,14985766..14985808,
FT                   14985990..14986250)
FT                   /gene="Crlf1"
FT                   /locus_tag="mCG_23122"
FT                   /product="cytokine receptor-like factor 1"
FT                   /note="gene_id=mCG23122.1 transcript_id=mCT23137.1 created
FT                   on 26-JUN-2002"
FT   CDS             join(14975446..14975569,14980766..14981047,
FT                   14981262..14981391,14981499..14981668,14983053..14983210,
FT                   14983279..14983447,14985474..14985661,14985766..14985808,
FT                   14985990..14986003)
FT                   /codon_start=1
FT                   /gene="Crlf1"
FT                   /locus_tag="mCG_23122"
FT                   /product="cytokine receptor-like factor 1"
FT                   /note="gene_id=mCG23122.1 transcript_id=mCT23137.1
FT                   protein_id=mCP13288.2"
FT                   /protein_id="EDL28824.1"
FT                   /translation="MPAGRPGPVAQSARRPPRPLSSLWSPLLLCVLGVPRGGSGAHTAV
FT                   ISPQDPTLLIGSSLQATCSIHGDTPGATAEGLYWTLNGRRLPSELSRLLNTSTLALALA
FT                   NLNGSRQQSGDNLVCHARDGSILAGSCLYVGLPPEKPFNISCWSRNMKDLTCRWTPGAH
FT                   GETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGS
FT                   ARSDVLTLDVLDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRV
FT                   EDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAAS
FT                   TPRSERPGPGGGVCEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQ
FT                   KSHKTRNQDEGILPSGRRGAARGPAG"
FT   gene            complement(14986465..14988914)
FT                   /gene="2810428I15Rik"
FT                   /locus_tag="mCG_23114"
FT                   /note="gene_id=mCG23114.1"
FT   mRNA            complement(join(14986465..14986678,14987153..14987229,
FT                   14987925..14988129,14988666..14988748,14988831..14988914))
FT                   /gene="2810428I15Rik"
FT                   /locus_tag="mCG_23114"
FT                   /product="RIKEN cDNA 2810428I15, transcript variant
FT                   mCT23129"
FT                   /note="gene_id=mCG23114.1 transcript_id=mCT23129.1 created
FT                   on 26-JUN-2002"
FT   mRNA            complement(join(14986534..14986678,14987925..14988129,
FT                   14988666..14988748,14988831..>14988876))
FT                   /gene="2810428I15Rik"
FT                   /locus_tag="mCG_23114"
FT                   /product="RIKEN cDNA 2810428I15, transcript variant
FT                   mCT170288"
FT                   /note="gene_id=mCG23114.1 transcript_id=mCT170288.0 created
FT                   on 26-JUN-2002"
FT   mRNA            complement(join(14986603..14986678,14987153..14987229,
FT                   14987925..14988129,14988461..>14988559))
FT                   /gene="2810428I15Rik"
FT                   /locus_tag="mCG_23114"
FT                   /product="RIKEN cDNA 2810428I15, transcript variant
FT                   mCT170289"
FT                   /note="gene_id=mCG23114.1 transcript_id=mCT170289.0 created
FT                   on 26-JUN-2002"
FT   CDS             complement(join(14986606..14986678,14987153..14987229,
FT                   14987925..14988129,14988666..14988748,14988831..14988902))
FT                   /codon_start=1
FT                   /gene="2810428I15Rik"
FT                   /locus_tag="mCG_23114"
FT                   /product="RIKEN cDNA 2810428I15, isoform CRA_c"
FT                   /note="gene_id=mCG23114.1 transcript_id=mCT23129.1
FT                   protein_id=mCP13296.1 isoform=CRA_c"
FT                   /protein_id="EDL28827.1"
FT                   /translation="MLTAATEVLAAADGPGSAESAWAWRDAPIATLVQRIQQLQNERAQ
FT                   AFRRLDQAHRQYLLSGQHYDFPSYRSVVHEVTQAFAAASREVLAVEAELAGPRAQPVLA
FT                   RHVRSLQELEQTRLATVALLQVMGTPGVSEQDPEKLHQLKIKVIKTMEAIGEVLQELRF
FT                   DAESAE"
FT   CDS             complement(join(14986606..14986678,14987153..14987229,
FT                   14987925..14988129,14988461..>14988477))
FT                   /codon_start=1
FT                   /gene="2810428I15Rik"
FT                   /locus_tag="mCG_23114"
FT                   /product="RIKEN cDNA 2810428I15, isoform CRA_b"
FT                   /note="gene_id=mCG23114.1 transcript_id=mCT170289.0
FT                   protein_id=mCP93207.0 isoform=CRA_b"
FT                   /protein_id="EDL28826.1"
FT                   /translation="KRSLEGAHRQYLLSGQHYDFPSYRSVVHEVTQAFAAASREVLAVE
FT                   AELAGPRAQPVLARHVRSLQELEQTRLATVALLQVMGTPGVSEQDPEKLHQLKIKVIKT
FT                   MEAIGEVLQELRFDAESAE"
FT   CDS             complement(join(14986670..14986678,14987925..14988129,
FT                   14988666..14988748,14988831..>14988875))
FT                   /codon_start=1
FT                   /gene="2810428I15Rik"
FT                   /locus_tag="mCG_23114"
FT                   /product="RIKEN cDNA 2810428I15, isoform CRA_a"
FT                   /note="gene_id=mCG23114.1 transcript_id=mCT170288.0
FT                   protein_id=mCP93206.0 isoform=CRA_a"
FT                   /protein_id="EDL28825.1"
FT                   /translation="AAADGPGSAESAWAWRDAPIATLVQRIQQLQNERAQAFRRLDQAH
FT                   RQYLLSGQHYDFPSYRSVVHEVTQAFAAASREVLAVEAELAGPRAQPVLARHVRSLQEL
FT                   EQTRLATGN"
FT   gene            complement(14990441..14992962)
FT                   /locus_tag="mCG_23116"
FT                   /note="gene_id=mCG23116.2"
FT   mRNA            complement(join(14990441..14990704,14991472..14991558,
FT                   14991697..14991810,14992860..14992962))
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, transcript variant mCT170293"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT170293.0 created
FT                   on 20-SEP-2002"
FT   mRNA            complement(join(14990441..14990704,14991472..14991558,
FT                   14991697..14991807,14992294..14992529))
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, transcript variant mCT173278"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT173278.0 created
FT                   on 20-SEP-2002"
FT   mRNA            complement(join(14990441..14990704,14991472..14991558,
FT                   14991697..14991810,14992294..14992521))
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, transcript variant mCT173279"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT173279.0 created
FT                   on 20-SEP-2002"
FT   mRNA            complement(join(14990441..14990704,14991472..14991558,
FT                   14991697..14991807,14992290..14992521))
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, transcript variant mCT170291"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT170291.0 created
FT                   on 20-SEP-2002"
FT   mRNA            complement(join(14990447..14990704,14991472..14991558,
FT                   14991697..14991810,14992514..14992577))
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, transcript variant mCT170290"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT170290.0 created
FT                   on 20-SEP-2002"
FT   mRNA            complement(join(14990450..14990704,14991472..14991558,
FT                   14991697..14991807,14992514..14992575))
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, transcript variant mCT23131"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT23131.2 created
FT                   on 20-SEP-2002"
FT   mRNA            complement(join(<14990508..14990704,14991472..14991558,
FT                   14991697..14991807,14992510..14992542))
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, transcript variant mCT170292"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT170292.0 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(14990508..14990704,14991472..14991558,
FT                   14991697..14991799))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, isoform CRA_a"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT170290.0
FT                   protein_id=mCP93211.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q66JP1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q66JP1"
FT                   /protein_id="EDL28828.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
FT   CDS             complement(join(14990508..14990704,14991472..14991558,
FT                   14991697..14991799))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, isoform CRA_a"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT170292.0
FT                   protein_id=mCP93210.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q66JP1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q66JP1"
FT                   /protein_id="EDL28829.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
FT   CDS             complement(join(14990508..14990704,14991472..14991558,
FT                   14991697..14991799))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, isoform CRA_a"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT173279.0
FT                   protein_id=mCP96197.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q66JP1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q66JP1"
FT                   /protein_id="EDL28830.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
FT   CDS             complement(join(14990508..14990704,14991472..14991558,
FT                   14991697..14991799))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, isoform CRA_a"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT23131.2
FT                   protein_id=mCP13303.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q66JP1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q66JP1"
FT                   /protein_id="EDL28831.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
FT   CDS             complement(join(14990508..14990704,14991472..14991558,
FT                   14991697..14991799))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, isoform CRA_a"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT170291.0
FT                   protein_id=mCP93208.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q66JP1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q66JP1"
FT                   /protein_id="EDL28832.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
FT   CDS             complement(join(14990508..14990704,14991472..14991558,
FT                   14991697..14991799))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, isoform CRA_a"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT170293.0
FT                   protein_id=mCP93209.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q66JP1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q66JP1"
FT                   /protein_id="EDL28833.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
FT   CDS             complement(join(14990508..14990704,14991472..14991558,
FT                   14991697..14991799))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23116"
FT                   /product="mCG23116, isoform CRA_a"
FT                   /note="gene_id=mCG23116.2 transcript_id=mCT173278.0
FT                   protein_id=mCP96198.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q66JP1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q66JP1"
FT                   /protein_id="EDL28834.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
FT   gene            <14992661..14995300
FT                   /locus_tag="mCG_1049006"
FT                   /note="gene_id=mCG1049006.0"
FT   mRNA            join(<14992661..14992829,14994608..14995300)
FT                   /locus_tag="mCG_1049006"
FT                   /product="mCG1049006"
FT                   /note="gene_id=mCG1049006.0 transcript_id=mCT166710.0
FT                   created on 26-JUN-2002"
FT   CDS             <14994841..14995143
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049006"
FT                   /product="mCG1049006"
FT                   /note="gene_id=mCG1049006.0 transcript_id=mCT166710.0
FT                   protein_id=mCP54109.0"
FT                   /protein_id="EDL28835.1"
FT                   /translation="SPICPGTGVVIFHVGTTVSFFFFFFFFLIFRDRVSLYIALDVLEL
FT                   FVDQAGLELSLCLPSAGIKGVHHHGSFLFDATMQCCCWTLGPSACLAWLCNHAMS"
FT   gene            complement(14995573..>15009932)
FT                   /locus_tag="mCG_140604"
FT                   /note="gene_id=mCG140604.0"
FT   mRNA            complement(join(14995573..14996344,14997571..14997617,
FT                   15000541..15000693,15002113..15002237,15005354..>15005455))
FT                   /locus_tag="mCG_140604"
FT                   /product="mCG140604, transcript variant mCT170264"
FT                   /note="gene_id=mCG140604.0 transcript_id=mCT170264.0
FT                   created on 26-JUN-2002"
FT   mRNA            complement(join(14995574..14996344,14997571..14997617,
FT                   15000541..15000693,15002113..15002237,15005239..>15005339))
FT                   /locus_tag="mCG_140604"
FT                   /product="mCG140604, transcript variant mCT170265"
FT                   /note="gene_id=mCG140604.0 transcript_id=mCT170265.0
FT                   created on 26-JUN-2002"
FT   CDS             complement(join(14996112..14996344,14997571..14997617,
FT                   15000541..15000693,15002113..15002237,15005354..15005455))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140604"
FT                   /product="mCG140604, isoform CRA_a"
FT                   /note="gene_id=mCG140604.0 transcript_id=mCT170264.0
FT                   protein_id=mCP93182.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR019371"
FT                   /db_xref="MGI:MGI:1922870"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9Z9"
FT                   /protein_id="EDL28836.1"
FT                   /translation="MFGTQRVRVSSAAIAHPFGVHVRASTIWSSRLLAALEAEEKEMDT
FT                   PDSASRVFCGRFLSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSVRLQQMSER
FT                   FMHHTRTLVDMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEGSFLEDEDEDPIPPSIT
FT                   TTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHIQPGSPAINGHRQTDDEEETHEE"
FT   CDS             complement(join(14996112..14996344,14997571..14997617,
FT                   15000541..15000693,15002113..15002237,15005239..>15005271))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140604"
FT                   /product="mCG140604, isoform CRA_c"
FT                   /note="gene_id=mCG140604.0 transcript_id=mCT170265.0
FT                   protein_id=mCP93184.0 isoform=CRA_c"
FT                   /protein_id="EDL28838.1"
FT                   /translation="PEARARPPDVQALEAEEKEMDTPDSASRVFCGRFLSMVNTDDVNA
FT                   IILAQKNMLDRFEKTNEMLLNFNNLSSVRLQQMSERFMHHTRTLVDMKRDLDSIFRRIR
FT                   TLKGKLARQHPEAFSHIPEGSFLEDEDEDPIPPSITTTIATSEQSTGSCDTSPDTVSPS
FT                   LSPGFEDLSHIQPGSPAINGHRQTDDEEETHEE"
FT   mRNA            complement(join(15000609..15000693,15002048..15002237,
FT                   15009824..>15009932))
FT                   /locus_tag="mCG_140604"
FT                   /product="mCG140604, transcript variant mCT170267"
FT                   /note="gene_id=mCG140604.0 transcript_id=mCT170267.0
FT                   created on 26-JUN-2002"
FT   mRNA            complement(join(15001245..15002237,15005239..>15005283))
FT                   /locus_tag="mCG_140604"
FT                   /product="mCG140604, transcript variant mCT170266"
FT                   /note="gene_id=mCG140604.0 transcript_id=mCT170266.0
FT                   created on 26-JUN-2002"
FT   CDS             complement(15001801..>15002043)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140604"
FT                   /product="mCG140604, isoform CRA_d"
FT                   /note="gene_id=mCG140604.0 transcript_id=mCT170266.0
FT                   protein_id=mCP93185.0 isoform=CRA_d"
FT                   /protein_id="EDL28839.1"
FT                   /translation="RKRAPGSNLGMGSDLGAVHDRAKWFCPQARAGRAGETGILRGSSG
FT                   LAFGIGTQSPVWVCREPCSGCFIPLLGQLHPEFSF"
FT   CDS             complement(join(15002109..15002237,15009824..>15009931))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140604"
FT                   /product="mCG140604, isoform CRA_b"
FT                   /note="gene_id=mCG140604.0 transcript_id=mCT170267.0
FT                   protein_id=mCP93183.0 isoform=CRA_b"
FT                   /protein_id="EDL28837.1"
FT                   /translation="IRSPAPAHPLAVHTASAVFIGLCTRPSRALDTTSFLALEAEEKEM
FT                   DTPDSASRVFCGRFLSMVNTDDVNAIILAQKNM"
FT   gene            15009968..15017511
FT                   /gene="Fkbp8"
FT                   /locus_tag="mCG_23117"
FT                   /note="gene_id=mCG23117.2"
FT   mRNA            join(15009968..15010021,15011576..15011854,
FT                   15013119..15013288,15013364..15013452,15013701..15013921,
FT                   15014756..15014928,15016295..15016372,15016666..15016797,
FT                   15017050..15017169)
FT                   /gene="Fkbp8"
FT                   /locus_tag="mCG_23117"
FT                   /product="FK506 binding protein 8, transcript variant
FT                   mCT170294"
FT                   /note="gene_id=mCG23117.2 transcript_id=mCT170294.0 created
FT                   on 26-JUN-2002"
FT   mRNA            join(<15010161..15010214,15011570..15011854,
FT                   15013119..15013212,15017187..15017511)
FT                   /gene="Fkbp8"
FT                   /locus_tag="mCG_23117"
FT                   /product="FK506 binding protein 8, transcript variant
FT                   mCT170295"
FT                   /note="gene_id=mCG23117.2 transcript_id=mCT170295.0 created
FT                   on 26-JUN-2002"
FT   CDS             join(<15010163..15010214,15011570..15011854,
FT                   15013119..15013212,15017187..15017337)
FT                   /codon_start=1
FT                   /gene="Fkbp8"
FT                   /locus_tag="mCG_23117"
FT                   /product="FK506 binding protein 8, isoform CRA_b"
FT                   /note="gene_id=mCG23117.2 transcript_id=mCT170295.0
FT                   protein_id=mCP93213.0 isoform=CRA_b"
FT                   /protein_id="EDL28841.1"
FT                   /translation="SGREGLRSGPDPGRSPAGPVPDPSSMASWAEPSEPAALRLPGAPL
FT                   LEGFEVLDGVDDAEEEDDLSGLPPLEDMGQPTVEEAEQPGALAREFLAATEPEPAPAPA
FT                   PEEWLDILGNGLLRMKTLVPGPKGSSRPLKGQVVTVHLQMLPVHCPPWLRCLLWVWGAR
FT                   IEGQITQEAGRTETLRGDMGCSPEGGTLFF"
FT   CDS             join(15011593..15011854,15013119..15013288,
FT                   15013364..15013452,15013701..15013921,15014756..15014928,
FT                   15016295..15016372,15016666..15016797,15017050..15017136)
FT                   /codon_start=1
FT                   /gene="Fkbp8"
FT                   /locus_tag="mCG_23117"
FT                   /product="FK506 binding protein 8, isoform CRA_a"
FT                   /note="gene_id=mCG23117.2 transcript_id=mCT170294.0
FT                   protein_id=mCP93212.0 isoform=CRA_a"
FT                   /protein_id="EDL28840.1"
FT                   /translation="MASWAEPSEPAALRLPGAPLLEGFEVLDGVDDAEEEDDLSGLPPL
FT                   EDMGQPTVEEAEQPGALAREFLAATEPEPAPAPAPEEWLDILGNGLLRMKTLVPGPKGS
FT                   SRPLKGQVVTVHLQMSLENGTRVQEEPELAFTLGDCDVIQALDLSVPLMDVGETAMVTA
FT                   DSKYCYGPQGSRSPYIPPHAALCLEVTLKTAEDGPDLEMLSGQERVALANRKRECGNAH
FT                   YQRADFVLAANSYDLAIKAITSNTKVDMTCEEEEELLQLKVKCLNNLAASQLKLDHYRA
FT                   ALRSCSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKL
FT                   VKKRAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVI
FT                   AARN"
FT   mRNA            join(15011706..15011854,15013119..15013288,
FT                   15013364..15013452,15013704..15013921,15014756..15014928,
FT                   15016295..15016372,15016666..15016797,15017050..15017505)
FT                   /gene="Fkbp8"
FT                   /locus_tag="mCG_23117"
FT                   /product="FK506 binding protein 8, transcript variant
FT                   mCT23132"
FT                   /note="gene_id=mCG23117.2 transcript_id=mCT23132.1 created
FT                   on 26-JUN-2002"
FT   CDS             join(15011734..15011854,15013119..15013288,
FT                   15013364..15013452,15013704..15013921,15014756..15014928,
FT                   15016295..15016372,15016666..15016797,15017050..15017136)
FT                   /codon_start=1
FT                   /gene="Fkbp8"
FT                   /locus_tag="mCG_23117"
FT                   /product="FK506 binding protein 8, isoform CRA_c"
FT                   /note="gene_id=mCG23117.2 transcript_id=mCT23132.1
FT                   protein_id=mCP13308.1 isoform=CRA_c"
FT                   /protein_id="EDL28842.1"
FT                   /translation="MGQPTVEEAEQPGALAREFLAATEPEPAPAPAPEEWLDILGNGLL
FT                   RMKTLVPGPKGSSRPLKGQVVTVHLQMSLENGTRVQEEPELAFTLGDCDVIQALDLSVP
FT                   LMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAEDGPDLEMLSGQERVAL
FT                   ANRKRECGNAHYQRADFVLAANSYDLAIKAITSNTKVDMTCEEEEELLQLKVKCLNNLA
FT                   ASQLKLDHYRAALRSCSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPS
FT                   NKTIHAELSKLVKKRAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAV
FT                   ALGGVALSVVIAARN"
FT   gene            15021885..15074729
FT                   /gene="Ell"
FT                   /locus_tag="mCG_23118"
FT                   /note="gene_id=mCG23118.2"
FT   mRNA            join(15021885..15022024,15055057..15055104,
FT                   15060709..15060830,15060965..15061128,15063427..15063692,
FT                   15065744..15065868,15067029..15067107,15067426..15067900,
FT                   15072401..15072461,15072575..15072746,15073242..15073286,
FT                   15073370..15074729)
FT                   /gene="Ell"
FT                   /locus_tag="mCG_23118"
FT                   /product="elongation factor RNA polymerase II"
FT                   /note="gene_id=mCG23118.2 transcript_id=mCT23133.2 created
FT                   on 26-JUN-2002"
FT   CDS             join(15021890..15022024,15055057..15055104,
FT                   15060709..15060830,15060965..15061128,15063427..15063692,
FT                   15065744..15065868,15067029..15067107,15067426..15067900,
FT                   15072401..15072461,15072575..15072746,15073242..15073286,
FT                   15073370..15073486)
FT                   /codon_start=1
FT                   /gene="Ell"
FT                   /locus_tag="mCG_23118"
FT                   /product="elongation factor RNA polymerase II"
FT                   /note="gene_id=mCG23118.2 transcript_id=mCT23133.2
FT                   protein_id=mCP13313.2"
FT                   /db_xref="GOA:O08856"
FT                   /db_xref="InterPro:IPR010844"
FT                   /db_xref="InterPro:IPR019464"
FT                   /db_xref="MGI:MGI:109377"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08856"
FT                   /protein_id="EDL28843.1"
FT                   /translation="MAALKEARSYGLSCGRVSDGSRVSVFHVKLTDSALKAFESYRAHQ
FT                   DSVSLRPSIRFEGSQGHISIPQPDCPEEVRAFSFYLSNIGRDSPQGSFDCIQQYVSSYG
FT                   DVHLDCLGSIQDKVTVCATDDSYQKARQSMAQAEEETRSRSAIVIKAGGRYMGKKVQFR
FT                   KPAPGAADAVPSRKRATPINLASAIRKSSGSGASSVVQRPFRDRVLHLLALRPYRKAEL
FT                   LLRLQKDGLTQADKDTLDSLLQQVASVNPKDGTCTLQDCMYKSLQKDWPGYSEGDRQLL
FT                   KRMLMRKLCQPQNATTDSSPPREHGRSASPSQKRPTDFIDPLASKKPRISHFTQRAQPT
FT                   LNGKLGAPNGHETLLPAPGPTPSDTLSSSHLPPRLEPPRTHDPLADVSNDLGHSTQDYK
FT                   HQEATPAPAPHLGLPLLTDFPQAEQPTSSSHTHSRPKKKSKKHKDKERPPEERPPAPQP
FT                   DAPTAPALPPDAPGLNGACDNEPTSSSETPDYLLKYPAISSSEQRQSYKNDFNAEYSEY
FT                   RSLHARIEQITRRFTQLDAQLRQLSQGSDEYETTRGQILQEYRKIKKTNTNYSCEKRRC
FT                   EYLHRKLAHIKRLIAEYDQRQLQAWP"
FT   gene            15038109..15038840
FT                   /pseudo
FT                   /locus_tag="mCG_140607"
FT                   /note="gene_id=mCG140607.0"
FT   mRNA            15038109..15038840
FT                   /pseudo
FT                   /locus_tag="mCG_140607"
FT                   /note="gene_id=mCG140607.0 transcript_id=mCT170296.0
FT                   created on 26-JUN-2002"
FT   gene            15076078..15079161
FT                   /gene="Isyna1"
FT                   /locus_tag="mCG_23119"
FT                   /note="gene_id=mCG23119.2"
FT   mRNA            join(15076078..15076416,15076493..15076621,
FT                   15076696..15076857,15077012..15077144,15077234..15077427,
FT                   15077578..15077727,15077823..15078038,15078121..15078285,
FT                   15078369..15078482,15078567..15078784,15078870..15079161)
FT                   /gene="Isyna1"
FT                   /locus_tag="mCG_23119"
FT                   /product="myo-inositol 1-phosphate synthase A1"
FT                   /note="gene_id=mCG23119.2 transcript_id=mCT23134.2 created
FT                   on 26-JUN-2002"
FT   CDS             join(15076502..15076621,15076696..15076857,
FT                   15077012..15077144,15077234..15077427,15077578..15077727,
FT                   15077823..15078038,15078121..15078285,15078369..15078482,
FT                   15078567..15078784,15078870..15079071)
FT                   /codon_start=1
FT                   /gene="Isyna1"
FT                   /locus_tag="mCG_23119"
FT                   /product="myo-inositol 1-phosphate synthase A1"
FT                   /note="gene_id=mCG23119.2 transcript_id=mCT23134.2
FT                   protein_id=mCP13261.2"
FT                   /protein_id="EDL28844.1"
FT                   /translation="MEPAAEILVDSPDVVYSPETIEARYEYRTTRVSREGGVLRVQPRA
FT                   TRFTFRTARQVPRLGVMLVGWGGNNGSTLTAAVLANRLRLTWPTRTGRKEANYYGSLTQ
FT                   AGTVNLGLDENGREVFVPFSALLPMVAPNDLVFDGWDISSLNLAEAMRRAQVLDCGLQE
FT                   QLWPHMESLRPRPSVYIPEFIAANQTARADNLIPGTRAQQLEQIRKDIRDFRSSAGLDK
FT                   VIVLWTANTERFCEVVPGRNDTAENLLHTIQLGLEVSPSTLFAVASILEDCAFLNGSPQ
FT                   NTLVPGALELASQRHVFVGGDDFKSGQTKVKSVLVDFLIGSGLKTMSIVSYNHLGNNDG
FT                   QNLSAPLQFRSKEVTKSSVVDDMVHSNHVLYAPGERPDHCVVIKYVPYVGDSKRALDEY
FT                   TSELMLGGTNTLVLHNTCEDSLLAAPIMLDLVLLTELCQRVSFCTDSDPEPQGFHTVLS
FT                   LLSFLFKAPLVPPGSPVVNALFRQRSCIENIFRACVGLPPQNHMLLEHKMERPGPGIKP
FT                   GEVVATSPLPCKKEPTPATNGCTGDANGHPQAPTPKLSTA"
FT   gene            complement(15079361..>15090746)
FT                   /gene="Ssbp4"
FT                   /locus_tag="mCG_23121"
FT                   /note="gene_id=mCG23121.2"
FT   mRNA            complement(join(15079361..15079641,15079886..15079993,
FT                   15080079..15080107,15080412..15080490,15080575..15080645,
FT                   15080727..15080781,15080866..15080901,15080991..15081036,
FT                   15081247..15081317,15081398..15081468,15081561..15081630,
FT                   15081713..15081772,15082269..15082358,15084105..15084189,
FT                   15084274..15084335,15084447..15084519,15089998..15090259))
FT                   /gene="Ssbp4"
FT                   /locus_tag="mCG_23121"
FT                   /product="single stranded DNA binding protein 4, transcript
FT                   variant mCT23136"
FT                   /note="gene_id=mCG23121.2 transcript_id=mCT23136.2 created
FT                   on 26-JUN-2002"
FT   mRNA            complement(join(15079364..15079993,15080079..15080107,
FT                   15080412..15080490,15080575..15080645,15080727..15080781,
FT                   15080866..15080901,15080991..15081036,15081247..15081317,
FT                   15081398..15081468,15081561..15081630,15081713..15081772,
FT                   15082269..15082358,15084105..15084189,15084274..15084335,
FT                   15084447..15084519,15090445..>15090746))
FT                   /gene="Ssbp4"
FT                   /locus_tag="mCG_23121"
FT                   /product="single stranded DNA binding protein 4, transcript
FT                   variant mCT170299"
FT                   /note="gene_id=mCG23121.2 transcript_id=mCT170299.0 created
FT                   on 26-JUN-2002"
FT   CDS             complement(join(15079612..15079641,15079886..15079993,
FT                   15080079..15080107,15080412..15080490,15080575..15080645,
FT                   15080727..15080781,15080866..15080901,15080991..15081036,
FT                   15081247..15081317,15081398..15081468,15081561..15081630,
FT                   15081713..15081772,15082269..15082358,15084105..15084189,
FT                   15084274..15084335,15084447..15084519,15089998..15090053))
FT                   /codon_start=1
FT                   /gene="Ssbp4"
FT                   /locus_tag="mCG_23121"
FT                   /product="single stranded DNA binding protein 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23121.2 transcript_id=mCT23136.2
FT                   protein_id=mCP13285.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U4B1"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR008116"
FT                   /db_xref="MGI:MGI:1924150"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4B1"
FT                   /protein_id="EDL28846.1"
FT                   /translation="MYGKASKGCAPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIR
FT                   WEKNITLGEPPGFLHSWWCVFWDLYCAAPDRREACEHSSEAKVFQDYSAAAAPSPVMGA
FT                   MTPNDAMAAGPVAPGFFQPFMSPRFPGGARPILRMPGQPPVGLPGSQPLIPAAMDPSPR
FT                   VQGHPSLGGPMQRVTPPRGMASVGPQGYGTGMRPPPNSLATSQVLPSMNMGPGVRGPWA
FT                   SPSGNSIPYSSSSPGSYSGPAGGGGAPGTPIMPSPGDSTNSSENMYTIMNPIGPGAGRA
FT                   NFPLGPSPEGPMASMSTMEPHHVNGSLGSGDMDGLPKNSPGAVGGLSNAPGTPRDDGEM
FT                   AAAGTFLHPFPSESYSPGMTMSV"
FT   CDS             complement(join(15079784..15079993,15080079..15080107,
FT                   15080412..15080490,15080575..15080645,15080727..15080781,
FT                   15080866..15080901,15080991..15081036,15081247..15081317,
FT                   15081398..15081468,15081561..15081630,15081713..15081772,
FT                   15082269..15082358,15084105..15084189,15084274..15084335,
FT                   15084447..15084519,15090445..>15090521))
FT                   /codon_start=1
FT                   /gene="Ssbp4"
FT                   /locus_tag="mCG_23121"
FT                   /product="single stranded DNA binding protein 4, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG23121.2 transcript_id=mCT170299.0
FT                   protein_id=mCP93217.0 isoform=CRA_d"
FT                   /protein_id="EDL28848.1"
FT                   /translation="VETEISTAPHPHPQICTTGSLAPQPRLALYVYEYLLHVGAQKSAQ
FT                   TFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPDRREACEHSSEAKVFQDYSAAAA
FT                   PSPVMGAMTPNDAMAAGPVAPGFFQPFMSPRFPGGARPILRMPGQPPVGLPGSQPLIPA
FT                   AMDPSPRVQGHPSLGGPMQRVTPPRGMASVGPQGYGTGMRPPPNSLATSQVLPSMNMGP
FT                   GVRGPWASPSGNSIPYSSSSPGSYSGPAGGGGAPGTPIMPSPGDSTNSSENMYTIMNPI
FT                   GPGAGRANFPLGPSPEGPMASMSTMEPHHVNGSLGSGDMDGLPKNSPGAVGGLSNAPGT
FT                   PRDDGEMAAAGTFLHPFPSESVSACVDSPPAAAAGRRGLAGRPRRGGRGARARP"
FT   mRNA            complement(join(<15079784..15079993,15080079..15080107,
FT                   15080412..15080490,15080575..15080645,15080727..15080781,
FT                   15080866..15080901,15080991..15081036,15081247..15081317,
FT                   15081398..15081468,15081561..15081630,15081713..15081772,
FT                   15082269..15082358,15084105..15084189,15084308..15084335,
FT                   15084447..15084519,15089998..>15090042))
FT                   /gene="Ssbp4"
FT                   /locus_tag="mCG_23121"
FT                   /product="single stranded DNA binding protein 4, transcript
FT                   variant mCT170297"
FT                   /note="gene_id=mCG23121.2 transcript_id=mCT170297.0 created
FT                   on 26-JUN-2002"
FT   CDS             complement(join(15079784..15079993,15080079..15080107,
FT                   15080412..15080490,15080575..15080645,15080727..15080781,
FT                   15080866..15080901,15080991..15081036,15081247..15081317,
FT                   15081398..15081468,15081561..15081630,15081713..15081772,
FT                   15082269..15082358,15084105..15084189,15084308..15084335,
FT                   15084447..>15084447))
FT                   /codon_start=1
FT                   /gene="Ssbp4"
FT                   /locus_tag="mCG_23121"
FT                   /product="single stranded DNA binding protein 4, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG23121.2 transcript_id=mCT170297.0
FT                   protein_id=mCP93215.0 isoform=CRA_c"
FT                   /protein_id="EDL28847.1"
FT                   /translation="DPLGKEHHIGVFWDLYCAAPDRREACEHSSEAKVFQDYSAAAAPS
FT                   PVMGAMTPNDAMAAGPVAPGFFQPFMSPRFPGGARPILRMPGQPPVGLPGSQPLIPAAM
FT                   DPSPRVQGHPSLGGPMQRVTPPRGMASVGPQGYGTGMRPPPNSLATSQVLPSMNMGPGV
FT                   RGPWASPSGNSIPYSSSSPGSYSGPAGGGGAPGTPIMPSPGDSTNSSENMYTIMNPIGP
FT                   GAGRANFPLGPSPEGPMASMSTMEPHHVNGSLGSGDMDGLPKNSPGAVGGLSNAPGTPR
FT                   DDGEMAAAGTFLHPFPSESVSACVDSPPAAAAGRRGLAGRPRRGGRGARARP"
FT   mRNA            complement(join(15079859..15080107,15080412..15080645,
FT                   15080727..15080781,15080866..15080901,15080991..15081036,
FT                   15081247..15081317,15081398..15081468,15081561..15081630,
FT                   15081713..15081772,15082269..15082358,15084105..15084189,
FT                   15084274..15084335,15084447..15084519,15089998..15090223))
FT                   /gene="Ssbp4"
FT                   /locus_tag="mCG_23121"
FT                   /product="single stranded DNA binding protein 4, transcript
FT                   variant mCT170298"
FT                   /note="gene_id=mCG23121.2 transcript_id=mCT170298.0 created
FT                   on 26-JUN-2002"
FT   CDS             complement(join(15080010..15080107,15080412..15080645,
FT                   15080727..15080781,15080866..15080901,15080991..15081036,
FT                   15081247..15081317,15081398..15081468,15081561..15081630,
FT                   15081713..15081772,15082269..15082358,15084105..15084189,
FT                   15084274..15084335,15084447..15084519,15089998..15090053))
FT                   /codon_start=1
FT                   /gene="Ssbp4"
FT                   /locus_tag="mCG_23121"
FT                   /product="single stranded DNA binding protein 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23121.2 transcript_id=mCT170298.0
FT                   protein_id=mCP93216.0 isoform=CRA_a"
FT                   /protein_id="EDL28845.1"
FT                   /translation="MYGKASKGCAPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIR
FT                   WEKNITLGEPPGFLHSWWCVFWDLYCAAPDRREACEHSSEAKVFQDYSAAAAPSPVMGA
FT                   MTPNDAMAAGPVAPGFFQPFMSPRFPGGARPILRMPGQPPVGLPGSQPLIPAAMDPSPR
FT                   VQGHPSLGGPMQRVTPPRGMASVGPQGYGTGMRPPPNSLATSQVLPSMNMGPGVRGPWA
FT                   SPSGNSIPYSSSSPGSYSGPAGGGGAPGTPIMPSPGDSTNSSENMYTIMNPIGPGAGRA
FT                   NVSAGRCASPDGDSAGGGRPEPHAALCPQFPLGPSPEGPMASMSTMEPHHVNGSLGSGD
FT                   MDGLPKVRSCTLDGWEGRWPGEGWGPTR"
FT   gene            15098027..15103356
FT                   /gene="Lrrc25"
FT                   /locus_tag="mCG_23112"
FT                   /note="gene_id=mCG23112.2"
FT   mRNA            join(15098027..15098159,15098806..15098898,
FT                   15099434..15100236,15102436..15103356)
FT                   /gene="Lrrc25"
FT                   /locus_tag="mCG_23112"
FT                   /product="leucine rich repeat containing 25, transcript
FT                   variant mCT23127"
FT                   /note="gene_id=mCG23112.2 transcript_id=mCT23127.2 created
FT                   on 17-JUN-2003"
FT   mRNA            join(15098715..15098898,15099434..15100236,
FT                   15102436..15103356)
FT                   /gene="Lrrc25"
FT                   /locus_tag="mCG_23112"
FT                   /product="leucine rich repeat containing 25, transcript
FT                   variant mCT128901"
FT                   /note="gene_id=mCG23112.2 transcript_id=mCT128901.1 created
FT                   on 17-JUN-2003"
FT   CDS             join(15099443..15100236,15102436..15102535)
FT                   /codon_start=1
FT                   /gene="Lrrc25"
FT                   /locus_tag="mCG_23112"
FT                   /product="leucine rich repeat containing 25, isoform CRA_a"
FT                   /note="gene_id=mCG23112.2 transcript_id=mCT128901.1
FT                   protein_id=mCP53993.1 isoform=CRA_a"
FT                   /db_xref="GOA:B9EHD0"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="MGI:MGI:2445284"
FT                   /db_xref="UniProtKB/TrEMBL:B9EHD0"
FT                   /protein_id="EDL28849.1"
FT                   /translation="MGSIRTRLLWLCLLMLLALLHKSGSQDLTCMVHPSRVDWTQTFNG
FT                   TCLNFSGLGLSLPRSPLQASHAQVLDLSKNGLQVLPGAFFDKLEKLQTLIVTHNQLDSV
FT                   DRSLALRCDLELKADCSCGLASWYALRQNCSGQQQLLCLHPATEAPRNLSTFLQVSCPP
FT                   SWGPGTIGALVAGTISLAVAVSGSVLAWRLLRRRRRASEHSLSKAQMSPHDIPKPVTDF
FT                   LPRYSSRRPGPKAPDSPPSRFTMDYENVFIGQPAEDCSWSAARNSPSGDSDCYMNYRSV
FT                   DQDSQPVYCNLESLGR"
FT   CDS             join(15099443..15100236,15102436..15102535)
FT                   /codon_start=1
FT                   /gene="Lrrc25"
FT                   /locus_tag="mCG_23112"
FT                   /product="leucine rich repeat containing 25, isoform CRA_a"
FT                   /note="gene_id=mCG23112.2 transcript_id=mCT23127.2
FT                   protein_id=mCP13271.2 isoform=CRA_a"
FT                   /db_xref="GOA:B9EHD0"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="MGI:MGI:2445284"
FT                   /db_xref="UniProtKB/TrEMBL:B9EHD0"
FT                   /protein_id="EDL28850.1"
FT                   /translation="MGSIRTRLLWLCLLMLLALLHKSGSQDLTCMVHPSRVDWTQTFNG
FT                   TCLNFSGLGLSLPRSPLQASHAQVLDLSKNGLQVLPGAFFDKLEKLQTLIVTHNQLDSV
FT                   DRSLALRCDLELKADCSCGLASWYALRQNCSGQQQLLCLHPATEAPRNLSTFLQVSCPP
FT                   SWGPGTIGALVAGTISLAVAVSGSVLAWRLLRRRRRASEHSLSKAQMSPHDIPKPVTDF
FT                   LPRYSSRRPGPKAPDSPPSRFTMDYENVFIGQPAEDCSWSAARNSPSGDSDCYMNYRSV
FT                   DQDSQPVYCNLESLGR"
FT   gene            complement(15111933..15114634)
FT                   /gene="Gdf15"
FT                   /locus_tag="mCG_14787"
FT                   /note="gene_id=mCG14787.1"
FT   mRNA            complement(join(15111933..15112713,15113872..15114634))
FT                   /gene="Gdf15"
FT                   /locus_tag="mCG_14787"
FT                   /product="growth differentiation factor 15"
FT                   /note="gene_id=mCG14787.1 transcript_id=mCT20481.1 created
FT                   on 26-JUN-2002"
FT   CDS             complement(join(15112082..15112713,15113872..15114151))
FT                   /codon_start=1
FT                   /gene="Gdf15"
FT                   /locus_tag="mCG_14787"
FT                   /product="growth differentiation factor 15"
FT                   /note="gene_id=mCG14787.1 transcript_id=mCT20481.1
FT                   protein_id=mCP13292.2"
FT                   /db_xref="GOA:Q9Z0J7"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:1346047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z0J7"
FT                   /protein_id="EDL28851.1"
FT                   /translation="MAPPALQAQPPGGSQLRFLLFLLLLLLLLSWPSQGDALAMPEQRP
FT                   SGPESQLNADELRGRFQDLLSRLHANQSREDSNSEPSPDPAVRILSPEVRLGSHGQLLL
FT                   RVNRASLSQGLPEAYRVHRALLLLTPTARPWDITRPLKRALSLRGPRAPALRLRLTPPP
FT                   DLAMLPSGGTQLELRLRVAAGRGRRSAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSD
FT                   WVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMH
FT                   RTDSGVSLQTYDDLVARGCHCA"
FT   gene            <15132404..15133028
FT                   /locus_tag="mCG_140605"
FT                   /note="gene_id=mCG140605.0"
FT   mRNA            join(<15132404..15132808,15132885..15133028)
FT                   /locus_tag="mCG_140605"
FT                   /product="mCG140605"
FT                   /note="gene_id=mCG140605.0 transcript_id=mCT170279.0
FT                   created on 27-JUN-2002"
FT   gene            complement(15132405..15142336)
FT                   /gene="Pgpep1"
FT                   /locus_tag="mCG_14790"
FT                   /note="gene_id=mCG14790.2"
FT   mRNA            complement(join(15132405..15133305,15133702..15133934,
FT                   15134925..15135041,15139944..15139996,15142126..15142336))
FT                   /gene="Pgpep1"
FT                   /locus_tag="mCG_14790"
FT                   /product="pyroglutamyl-peptidase I, transcript variant
FT                   mCT20484"
FT                   /note="gene_id=mCG14790.2 transcript_id=mCT20484.2 created
FT                   on 27-JUN-2002"
FT   mRNA            complement(join(15132405..15133305,15133702..15133934,
FT                   15139944..15139996,15142126..15142178))
FT                   /gene="Pgpep1"
FT                   /locus_tag="mCG_14790"
FT                   /product="pyroglutamyl-peptidase I, transcript variant
FT                   mCT170278"
FT                   /note="gene_id=mCG14790.2 transcript_id=mCT170278.0 created
FT                   on 27-JUN-2002"
FT   CDS             <15132405..15132671
FT                   /codon_start=1
FT                   /locus_tag="mCG_140605"
FT                   /product="mCG140605"
FT                   /note="gene_id=mCG140605.0 transcript_id=mCT170279.0
FT                   protein_id=mCP93197.0"
FT                   /protein_id="EDL28852.1"
FT                   /translation="RVSKILRVLKYQKENKKDHGRVGSPQAPEATAARPLVAIAACSSE
FT                   QREPTMETQSMMAFSGQEAKEAALPRRKERHLLVRPEVLTMGT"
FT   CDS             complement(join(15133113..15133305,15133702..15133934,
FT                   15139944..15139996,15142126..15142159))
FT                   /codon_start=1
FT                   /gene="Pgpep1"
FT                   /locus_tag="mCG_14790"
FT                   /product="pyroglutamyl-peptidase I, isoform CRA_c"
FT                   /note="gene_id=mCG14790.2 transcript_id=mCT170278.0
FT                   protein_id=mCP93195.0 isoform=CRA_c"
FT                   /protein_id="EDL28855.1"
FT                   /translation="MEQPRKAVVVTGFGPFGEHTVNASWIAVQLVVHVGVSGMATTVTL
FT                   EKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQD
FT                   AGRYLCDFTYYTSLYQGRGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLGVLEQAEGD
FT                   ISCCRQL"
FT   CDS             complement(join(15133113..15133305,15133702..15133934,
FT                   15134925..15135041,15139944..15139996,15142126..15142159))
FT                   /codon_start=1
FT                   /gene="Pgpep1"
FT                   /locus_tag="mCG_14790"
FT                   /product="pyroglutamyl-peptidase I, isoform CRA_b"
FT                   /note="gene_id=mCG14790.2 transcript_id=mCT20484.2
FT                   protein_id=mCP13293.1 isoform=CRA_b"
FT                   /protein_id="EDL28854.1"
FT                   /translation="MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVY
FT                   EIPVEYQTVQRLIPALWEKHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPG
FT                   SQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQGRGR
FT                   SAFVHVPPLGKPYNADQLGRALRAIIEEMLGVLEQAEGDISCCRQL"
FT   mRNA            complement(join(<15133113..15133305,15133702..15133934,
FT                   15134925..15135041,15139944..15139996,15141294..>15141387))
FT                   /gene="Pgpep1"
FT                   /locus_tag="mCG_14790"
FT                   /product="pyroglutamyl-peptidase I, transcript variant
FT                   mCT170277"
FT                   /note="gene_id=mCG14790.2 transcript_id=mCT170277.0 created
FT                   on 27-JUN-2002"
FT   CDS             complement(join(15133113..15133305,15133702..15133934,
FT                   15134925..15135041,15139944..15139996,15141294..>15141294))
FT                   /codon_start=1
FT                   /gene="Pgpep1"
FT                   /locus_tag="mCG_14790"
FT                   /product="pyroglutamyl-peptidase I, isoform CRA_a"
FT                   /note="gene_id=mCG14790.2 transcript_id=mCT170277.0
FT                   protein_id=mCP93196.0 isoform=CRA_a"
FT                   /protein_id="EDL28853.1"
FT                   /translation="GFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQR
FT                   LIPALWEKHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPES
FT                   IDSIIDMDAVCKRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQGRGRSAFVHVPPLGK
FT                   PYNADQLGRALRAIIEEMLGVLEQAEGDISCCRQL"
FT   gene            <15155633..15161119
FT                   /gene="Lsm4"
FT                   /locus_tag="mCG_14793"
FT                   /note="gene_id=mCG14793.1"
FT   mRNA            join(<15155633..15155662,15158923..15158964,
FT                   15160146..15160244,15160322..15160502,15160728..15160968)
FT                   /gene="Lsm4"
FT                   /locus_tag="mCG_14793"
FT                   /product="LSM4 homolog, U6 small nuclear RNA associated (S.
FT                   cerevisiae), transcript variant mCT170280"
FT                   /note="gene_id=mCG14793.1 transcript_id=mCT170280.0 created
FT                   on 27-JUN-2002"
FT   mRNA            join(15155638..15155826,15158923..15158964,
FT                   15160146..15160244,15160322..15160502,15160728..15161119)
FT                   /gene="Lsm4"
FT                   /locus_tag="mCG_14793"
FT                   /product="LSM4 homolog, U6 small nuclear RNA associated (S.
FT                   cerevisiae), transcript variant mCT20486"
FT                   /note="gene_id=mCG14793.1 transcript_id=mCT20486.2 created
FT                   on 27-JUN-2002"
FT   CDS             join(<15155645..15155662,15158923..15158964,
FT                   15160146..15160244,15160322..15160502,15160728..15160819)
FT                   /codon_start=1
FT                   /gene="Lsm4"
FT                   /locus_tag="mCG_14793"
FT                   /product="LSM4 homolog, U6 small nuclear RNA associated (S.
FT                   cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG14793.1 transcript_id=mCT170280.0
FT                   protein_id=mCP93198.0 isoform=CRA_a"
FT                   /protein_id="EDL28856.1"
FT                   /translation="GRPSCSLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINL
FT                   REVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVREEAAKGRGRGGPQQQKQQK
FT                   GRGMGGAGRGVFGGRGRGGIPGAGRGQPEKKPGRQAGKQ"
FT   CDS             join(15155824..15155826,15158923..15158964,
FT                   15160146..15160244,15160322..15160502,15160728..15160819)
FT                   /codon_start=1
FT                   /gene="Lsm4"
FT                   /locus_tag="mCG_14793"
FT                   /product="LSM4 homolog, U6 small nuclear RNA associated (S.
FT                   cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG14793.1 transcript_id=mCT20486.2
FT                   protein_id=mCP13300.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9CY46"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027141"
FT                   /db_xref="MGI:MGI:1354692"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CY46"
FT                   /protein_id="EDL28857.1"
FT                   /translation="MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVIC
FT                   TSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVREEAAKGRGRGGPQQQKQQKGRGMG
FT                   GAGRGVFGGRGRGGIPGAGRGQPEKKPGRQAGKQ"
FT   gene            15181292..15182871
FT                   /gene="Jund1"
FT                   /locus_tag="mCG_127576"
FT                   /note="gene_id=mCG127576.0"
FT   mRNA            15181292..15182871
FT                   /gene="Jund1"
FT                   /locus_tag="mCG_127576"
FT                   /product="Jun proto-oncogene related gene d1"
FT                   /note="gene_id=mCG127576.0 transcript_id=mCT128862.0
FT                   created on 27-JUN-2002"
FT   CDS             15181316..15182341
FT                   /codon_start=1
FT                   /gene="Jund1"
FT                   /locus_tag="mCG_127576"
FT                   /product="Jun proto-oncogene related gene d1"
FT                   /note="gene_id=mCG127576.0 transcript_id=mCT128862.0
FT                   protein_id=mCP53999.1"
FT                   /protein_id="EDL28858.1"
FT                   /translation="METPFYGEEALSGLAAGASSVAGATGAPGGGGFAPPGRAFPGAPP
FT                   TSSMLKKDALTLSLAEQGAAGLKPGSATAPSALRPDGAPDGLLASPDLGLLKLASPELE
FT                   RLIIQSNGLVTTTPTSTQFLYPKVAASEEQEFAEGFVKALEDLHKQSQLGAATAATSGA
FT                   PAPPAPADLAATPGATETPVYANLSSFAGGAGPPGGAATVAFAAEPVPFPPPPGALGPP
FT                   PPPHPPRLAALKDEPQTVPDVPSFGDSPPLSPIDMDTQERIKAERKRLRNRIAASKCRK
FT                   RKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPA
FT                   Y"
FT   gene            <15183423..15184612
FT                   /locus_tag="mCG_1049012"
FT                   /note="gene_id=mCG1049012.0"
FT   mRNA            join(<15183423..15183683,15184378..15184612)
FT                   /locus_tag="mCG_1049012"
FT                   /product="mCG1049012"
FT                   /note="gene_id=mCG1049012.0 transcript_id=mCT166716.0
FT                   created on 27-JUN-2002"
FT   CDS             join(<15183615..15183683,15184378..15184524)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049012"
FT                   /product="mCG1049012"
FT                   /note="gene_id=mCG1049012.0 transcript_id=mCT166716.0
FT                   protein_id=mCP54133.0"
FT                   /protein_id="EDL28859.1"
FT                   /translation="SRSSSSAQWEHLTLGLVSPPLPHCWDQRCVPPLPSWAKIIVPLLH
FT                   SSGPETCSTGCEQHSRNLNSDLSFGP"
FT   gene            <15190416..>15199823
FT                   /locus_tag="mCG_1048898"
FT                   /note="gene_id=mCG1048898.0"
FT   mRNA            <15190416..>15199823
FT                   /locus_tag="mCG_1048898"
FT                   /product="mCG1048898"
FT                   /note="gene_id=mCG1048898.0 transcript_id=mCT166602.0
FT                   created on 27-JUN-2002"
FT   CDS             15190416..15199823
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048898"
FT                   /product="mCG1048898"
FT                   /note="gene_id=mCG1048898.0 transcript_id=mCT166602.0
FT                   protein_id=mCP54108.0"
FT                   /protein_id="EDL28860.1"
FT                   /translation="MQPAAQLQFQNLMSPSGPSLPQPTPIHQEKVAKLCPQLQHDFYPS
FT                   EELAVLPSQEVPRLRAVVESQAFRNILVDEMDMMVSRAATVIQASWKGYRLRQKLISQM
FT                   TAAKAIQEAWRRFSTRRLMHSNRLTVKKAKREDEEDIPYHQPQQVRFHAPEDQPPVMVT
FT                   KETQFPSFDNLVPSQATAGPCASRVPGGGLHPQYVINRLTVPKYQPCMLTKTFRSSCLM
FT                   RHLEGDSLKIRHVASKTIKVGALEAAATGRYGQAMHGSLKTQTQAHTESDVPKAPLRIY
FT                   PVNKTHTKVCPMAAAVPESSATMSTAPRSAPQARPTSPATVMKMQATTSPTSPVIRLPA
FT                   PVGPNSSLSNTTPQMQVRYMMPGARIQPPGSAVASTIKALPHFGAPVMKVPLQTGPGFT
FT                   MTKTSLQMRPMTRSQAQTYTVSTSSKTSPSSPTVKPSPQTRLAAMLTKTPAQLRSVAAV
FT                   FRTLCGGTTEAVASSPRCSPQSPVVAGNTPSQVHLNSTRTKVTVSTKQATTVVKVNSQS
FT                   YLGRCGSQGNLDTIVPKPPATYPLEVEKMKSCPARSPKKEAALKTNTTIAARALSWTKM
FT                   MEDRSKALTQIKQRAEIIKVHFRVYMPEEIPVTLTQAQLAVPLTKSSSQIQPPPCHART
FT                   QPTSPFCKAVSQSCMPSGLAHGTPEGQRPPVGLSASLSSSPLAAHLMSLTAQLQPACEQ
FT                   ARSVSRDHLTRSCPASASLQARSSGTIVPPEVYPNTYSPTSAPQHHMASLLAKSSSQLH
FT                   PPAEHAKTMNTKTTKAACQVCPSTKLSKAPSLAQLITCLAKVPSQAQLATETAKCLLAA
FT                   HPTTDHRSKTQSQTFLSSSKASVQLWQHLGTLSTGSRAKPDDRSVAQPQLHSHAPNKTM
FT                   QNPRSVVTDSQGMLIPLMTPSGHPVCNAESWGDSGRAQTPPPSPVPNQAVPCHDDLAAS
FT                   VASLCADLVAMLGSPEDLRTLLVKTLSQGEVRTALSQALSREVLGPSVVKALPQGMLGM
FT                   ALMKALSWGELGISLSRALSRGELRPELNKATQGKLAEVLCKALTEEERATLSQALCQG
FT                   ELGAVFTQSLAQMAQRTGTFLPKATSKTVGSRMTTAPAPVEVTCSGSLSVAWGPAMGPV
FT                   GARCSKVRPPWEGLPWEQPDGILGEKRVTLEGSPCSPQSTIGSFTGGKVTGTYCCPLLK
FT                   IPMLSGEVGSVLYSGLYLRSFDLDSMACGEGPHVPKRLSQPPPPSPWQPLVANGVGPSS
FT                   NQPPVISNSTAPSSCQPSVASRVPYPGSSYQEGNVVASKRSGRVGDGKSPMSPWPSTTC
FT                   HGNVCQCPTPGMHKKSPCGYCSSLVRSRSTLPKETCRQVLPSGHRRVTAPLGSKDMVTI
FT                   VRKVAEEQCSAQPSPVFLNPKSQKVTSRSTLKQEKHPQVSSAPPHSLSQATDHHRSLLD
FT                   ELLAKIPQHPQIVLAKSYPRVRCQDSCTSQNSLQNSPFASASIPSSLPPSEGLECSREG
FT                   DMQEFQPKLKEIREARYRLQGHLERTCPTGLQRTLPKFQQPTLGLGPLLSSSTSLASNL
FT                   HWDSDSGSDYSTGDLTEGLSQDSTWHRRSQVQARDQKPNGVTFLDPVQPKDKLAHGGAP
FT                   SPGQARKTSEGSQFLSQPLEARGLYPSSSQSAGSSAVAPSLAQPSTGTGVAPSLAHPSA
FT                   ATRVSPTLAQPSMDTGVFPGLTEPLIYYGSPTNFSQPFMYTGGSPVYTQKLMASSVPSN
FT                   FTQTSAAGVVTLNNQSVSIGATSSQAQPSATTHRAPRPTQSPLSSCPPPGSSSLPTQGA
FT                   GHPDSVQTSVATGVYPSFFQPFPPYSMPSHFAQPYMATVVTPNYVQPCMSHSMSPSLAQ
FT                   AFMVSVRSPTLAHASVANRASPNHNQPTTASTVVPGVLKVPLSNRVPPSLNSPFLAPRV
FT                   YPDLSNVPTATLGALSLLPPTVVCGVGRGVSKPAFGPQQHTQQDSRATQSQPPMSNRGG
FT                   AQPCAKSTAGQPSLGVCSSPGGNLIGARSRSAPQNPTVHSEPTQASKGSPSPVAQPMHG
FT                   LGQPSVAPAVGASVPCQALFGGVAPGMPQGPLTTGLFLSVCQGGNPPPMAAWASPSDVH
FT                   WTQNQAAMATGVGQSSCPAVMPRMQVPAELFPNQLGTSIPQPCATLPITLDPQLFSMAT
FT                   MVQPSYQYVGMIIADPAGAVGGALPQGSVDGEASSAPAAKPVLESKTPNLPQVSMIRDV
FT                   GKSVPPESTADGLAQYVPPESMVEGVVQNVPPESTIGVRTQNLLTESVISGEDQSPPRD
FT                   AGASDVALNLPPCPVASSKAPSHPQETDGSRKKLSPAIEPSPSSQSPRTCPSFVASRTS
FT                   STAPLGSMLVGICPRPFQATQCREVSQVSFLAPSVNSLANAHSPALQKLAEDLHHSPTV
FT                   LSSASQISQDPGLTKHVGVNDLTLPKPGQMADTVSSIVAPSRDSVKPQGTETESELRAG
FT                   LGATGRESHGQKPLAAENALKDQIFSKALLNKEAPRQVNSVPPVPKQAPSLGKHPIASS
FT                   ITVQPLASESNSDPQSLLPAPRVPSLQKAAVDNSSQLLASSVSVAPLSTGKAGTAELSL
FT                   GSEEVKPGNPRAVESSGGTDSAPPSKNGVSSASQFGGPQGHTKSDHQESLTAKKSYQPS
FT                   QVSFVSELLEGPMNRLPPFSHPLKLVPRVSLDSHKEPSGTSTVGITPINHVGDARRQKA
FT                   TSGVQRMSLVHEPSSSGSQRSLLDEAAQDSREAGLPKTMLGLTTHPDQRPTLVTCPRVS
FT                   YDRSSLVPTMPHNQNVEYINRPVTGYDGVSRISTAPHSQEHPQVTVPKTSFSEGSGRVP
FT                   TMLYGHRLQHIKVGETSLGGSSQGPRTTPHSHRPHLVTHPKTGHNTISLPPTVSQGPVD
FT                   AGLASGQSWNSKVPNVSVRATAHAGAPQGVWYPSRGHKPWDPIGAEAELDRKPSAELLM
FT                   SVQGMEKVVVQAVVTIQACARGYLVRRTVKVWHQWATIIQATWRGYRVRRNLERLFRAT
FT                   TIIQAAWRGYCIRRARARQVLLPIAWPEHSGRTKGTLDNRNSSEHRCFLSCQPDVCSVC
FT                   QSLGPPVESPPSVVMLVGSQPRTCHVCGHTLSTRVVQGFGQGISGQPVSRWASASQQNT
FT                   LLSQQHRACTIIQAAWKGYRTRRQLSQKQSAAKMVQAVWRGHYTRSCLTTDALLGTGGP
FT                   WSISRDTSRHSSRAYSLHWPGV"
FT   gene            <15200798..15205064
FT                   /locus_tag="mCG_14782"
FT                   /note="gene_id=mCG14782.2"
FT   mRNA            join(<15200798..15200888,15202840..15203148,
FT                   15204208..15204368,15204475..15205063)
FT                   /locus_tag="mCG_14782"
FT                   /product="mCG14782, transcript variant mCT20397"
FT                   /note="gene_id=mCG14782.2 transcript_id=mCT20397.1 created
FT                   on 27-JUN-2002"
FT   CDS             join(<15200798..15200888,15202840..15203148,
FT                   15204208..15204368,15204475..15204522)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14782"
FT                   /product="mCG14782, isoform CRA_b"
FT                   /note="gene_id=mCG14782.2 transcript_id=mCT20397.1
FT                   protein_id=mCP13280.0 isoform=CRA_b"
FT                   /protein_id="EDL28862.1"
FT                   /translation="QTAGMASSWLLPLALALLLLGDSSVILASRDVNFTLFLKSLIAKK
FT                   ASDTISPSPETTPVPTSTSPETTPDSTYTSLETISPPDSTTPNPGSASPDPETASLPTS
FT                   GFPSSEPTTTSQSTNLPPQGLSTVSSPHQDAGSLWTPTSYRNPGVVIAVCLLVSVLLVG
FT                   SAFVAVRHYNRDAPAFHNLDTVSMGSVSQRLPFADRLQS"
FT   mRNA            join(<15200799..15200888,15204208..15204368,
FT                   15204475..15205064)
FT                   /locus_tag="mCG_14782"
FT                   /product="mCG14782, transcript variant mCT170270"
FT                   /note="gene_id=mCG14782.2 transcript_id=mCT170270.0 created
FT                   on 27-JUN-2002"
FT   CDS             <15204485..15204838
FT                   /codon_start=1
FT                   /locus_tag="mCG_14782"
FT                   /product="mCG14782, isoform CRA_a"
FT                   /note="gene_id=mCG14782.2 transcript_id=mCT170270.0
FT                   protein_id=mCP93188.0 isoform=CRA_a"
FT                   /protein_id="EDL28861.1"
FT                   /translation="ARGCHLLTAYSRDSQRTRDMVGVTPGKSSVWKHSPPPPVPCYPDL
FT                   GISGKEDNWSPGISRPVWPTDLVHNSEMNQGGMEHSCHPCTWEVETGGSCVQVHPELYM
FT                   GFEVSLGYMGLYL"
FT   gene            <15206492..15238234
FT                   /gene="Pde4c"
FT                   /locus_tag="mCG_127589"
FT                   /note="gene_id=mCG127589.1"
FT   mRNA            join(15206492..15206645,15206943..15206995,
FT                   15209279..15209484,15232343..15232534,15232936..15232972,
FT                   15233057..15233127,15233249..15233301,15233594..15233706,
FT                   15233848..15233941,15234281..15234441,15234528..15234626,
FT                   15234876..15235040,15235118..15235217,15235429..15235583,
FT                   15235972..15236094,15236386..15236466,15236902..15238234)
FT                   /gene="Pde4c"
FT                   /locus_tag="mCG_127589"
FT                   /product="phosphodiesterase 4C, cAMP specific, transcript
FT                   variant mCT173572"
FT                   /note="gene_id=mCG127589.1 transcript_id=mCT173572.0
FT                   created on 23-SEP-2002"
FT   mRNA            join(<15206492..15206645,15206943..15206995,
FT                   15209279..15209484,15232343..15232534,15232936..15232972,
FT                   15233057..15233127,15233249..15233301,15233594..15233706,
FT                   15233848..15233941,15234281..15234441,15234528..15234626,
FT                   15234876..15235040,15235118..15235217,15235429..15235583,
FT                   15235972..15236094,15236284..15236466,15236902..15237480)
FT                   /gene="Pde4c"
FT                   /locus_tag="mCG_127589"
FT                   /product="phosphodiesterase 4C, cAMP specific, transcript
FT                   variant mCT128875"
FT                   /note="gene_id=mCG127589.1 transcript_id=mCT128875.1
FT                   created on 23-SEP-2002"
FT   CDS             join(<15206549..15206645,15206943..15206995,
FT                   15209279..15209484,15232343..15232534,15232936..15232972,
FT                   15233057..15233127,15233249..15233301,15233594..15233706,
FT                   15233848..15233941,15234281..15234441,15234528..15234626,
FT                   15234876..15235040,15235118..15235217,15235429..15235583,
FT                   15235972..15236094,15236284..15236466,15236902..15237168)
FT                   /codon_start=1
FT                   /gene="Pde4c"
FT                   /locus_tag="mCG_127589"
FT                   /product="phosphodiesterase 4C, cAMP specific, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG127589.1 transcript_id=mCT128875.1
FT                   protein_id=mCP54003.1 isoform=CRA_a"
FT                   /protein_id="EDL28863.1"
FT                   /translation="RTQLGVGQDRLSSAPGRSQSTLTAQVPTGAAGKACTMRRSGTALS
FT                   FLWTERVREPVDSGVAPVSPLGGGVILRRFSGTLLLPPLSSRLGSSGEAESAAHVVFTI
FT                   GTQGTQRNLGSAQSSFDLENGLPGGKGLLDAQSGPSLGRALQPPVHHVQRRESFLYRSD
FT                   SDHEPSPKAVSRTSSAASDLHGEDMIVTPFAQVLASLRTVRNNVAALAHGPGSATRQVL
FT                   LGTPPHSSQQAAPTEDSGLQLVQETLEELDWCLEQLETLQTRRSVGEMASNKFKRMLNR
FT                   ELSYLSETSRSGNQVSEYISQTFLDQQAEVELPQPPTEDDPWPMAQITELRRSSHTSLP
FT                   TAAIPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAVIFSVFQERDLLKT
FT                   FQIPADTLLAYLLTLEGHYHSDVAYHNSMHAADVVQSAHVLLGTPALEAVFTDLEVLAA
FT                   IFACAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQGENCDIFRNL
FT                   STKQRLSLRRMVIDMVLATDMSKHMSLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQ
FT                   SLVHCADLSNPAKPLPLYRQWTERIMAEFFQQGDRERESGLDISPMCDKHTASMEKSQV
FT                   GFIDYIAQPLWETWADLVHPDAQELLDTLEDNREWYQSRIPCSPPHTMGSDRFKFELTL
FT                   EEAEEEEEEEDEGQCTALNRESSELPST"
FT   CDS             join(15206954..15206995,15209279..15209484,
FT                   15232343..15232534,15232936..15232972,15233057..15233127,
FT                   15233249..15233301,15233594..15233706,15233848..15233941,
FT                   15234281..15234441,15234528..15234626,15234876..15235040,
FT                   15235118..15235217,15235429..15235583,15235972..15236094,
FT                   15236386..15236466,15236902..15237168)
FT                   /codon_start=1
FT                   /gene="Pde4c"
FT                   /locus_tag="mCG_127589"
FT                   /product="phosphodiesterase 4C, cAMP specific, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG127589.1 transcript_id=mCT173572.0
FT                   protein_id=mCP96491.0 isoform=CRA_b"
FT                   /protein_id="EDL28864.1"
FT                   /translation="MRRSGTALSFLWTERVREPVDSGVAPVSPLGGGVILRRFSGTLLL
FT                   PPLSSRLGSSGEAESAAHVVFTIGTQGTQRNLGSAQSSFDLENGLPGGKGLLDAQSGPS
FT                   LGRALQPPVHHVQRRESFLYRSDSDHEPSPKAVSRTSSAASDLHGEDMIVTPFAQVLAS
FT                   LRTVRNNVAALAHGPGSATRQVLLGTPPHSSQQAAPTEDSGLQLVQETLEELDWCLEQL
FT                   ETLQTRRSVGEMASNKFKRMLNRELSYLSETSRSGNQVSEYISQTFLDQQAEVELPQPP
FT                   TEDDPWPMAQITELRRSSHTSLPTAAIPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAE
FT                   LSGNRPLTAVIFSVFQERDLLKTFQIPADTLLAYLLTLEGHYHSDVAYHNSMHAADVVQ
FT                   SAHVLLGTPALEAVFTDLEVLAAIFACAIHDVDHPGVSNQFLINTNSELALMYNDSSVL
FT                   ENHHLAVGFKLLQGENCDIFRNLSTKQRLSLRRMVIDMVLATDMSKHMSLLADLKTMVE
FT                   TKKVTSLGVLLLDNYSDRIQQGDRERESGLDISPMCDKHTASMEKSQVGFIDYIAQPLW
FT                   ETWADLVHPDAQELLDTLEDNREWYQSRIPCSPPHTMGSDRFKFELTLEEAEEEEEEED
FT                   EGQCTALNRESSELPST"
FT   mRNA            join(<15212537..15212713,15232343..15232534,
FT                   15232936..15232972,15233057..15233127,15233249..15233301,
FT                   15233594..15233706,15233848..15233941,15234281..15234441,
FT                   15234528..15234626,15234876..15235040,15235118..15235217,
FT                   15235429..15235583,15235972..15236094,15236284..15236466,
FT                   15236902..15237480)
FT                   /gene="Pde4c"
FT                   /locus_tag="mCG_127589"
FT                   /product="phosphodiesterase 4C, cAMP specific, transcript
FT                   variant mCT170263"
FT                   /note="gene_id=mCG127589.1 transcript_id=mCT170263.0
FT                   created on 23-SEP-2002"
FT   CDS             join(<15212538..15212713,15232343..15232534,
FT                   15232936..15232972,15233057..15233127,15233249..15233301,
FT                   15233594..15233706,15233848..15233941,15234281..15234441,
FT                   15234528..15234626,15234876..15235040,15235118..15235217,
FT                   15235429..15235583,15235972..15236094,15236284..15236466,
FT                   15236902..15237168)
FT                   /codon_start=1
FT                   /gene="Pde4c"
FT                   /locus_tag="mCG_127589"
FT                   /product="phosphodiesterase 4C, cAMP specific, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG127589.1 transcript_id=mCT170263.0
FT                   protein_id=mCP93181.0 isoform=CRA_c"
FT                   /protein_id="EDL28865.1"
FT                   /translation="LMETQLVGRAGVPRSPKHLWGQLQRPIRIQRRFHSDPERPDRPAP
FT                   VKSRLSWPSSFHRRFDLENGLPGGKGLLDAQSGPSLGRALQPPVHHVQRRESFLYRSDS
FT                   DHEPSPKAVSRTSSAASDLHGEDMIVTPFAQVLASLRTVRNNVAALAHGPGSATRQVLL
FT                   GTPPHSSQQAAPTEDSGLQLVQETLEELDWCLEQLETLQTRRSVGEMASNKFKRMLNRE
FT                   LSYLSETSRSGNQVSEYISQTFLDQQAEVELPQPPTEDDPWPMAQITELRRSSHTSLPT
FT                   AAIPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAVIFSVFQERDLLKTF
FT                   QIPADTLLAYLLTLEGHYHSDVAYHNSMHAADVVQSAHVLLGTPALEAVFTDLEVLAAI
FT                   FACAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQGENCDIFRNLS
FT                   TKQRLSLRRMVIDMVLATDMSKHMSLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQS
FT                   LVHCADLSNPAKPLPLYRQWTERIMAEFFQQGDRERESGLDISPMCDKHTASMEKSQVG
FT                   FIDYIAQPLWETWADLVHPDAQELLDTLEDNREWYQSRIPCSPPHTMGSDRFKFELTLE
FT                   EAEEEEEEEDEGQCTALNRESSELPST"
FT   gene            15241767..15245733
FT                   /gene="Rab3a"
FT                   /locus_tag="mCG_14795"
FT                   /note="gene_id=mCG14795.1"
FT   mRNA            join(15241767..15241922,15242913..15243140,
FT                   15243504..15243622,15244194..15244318,15244954..15245702)
FT                   /gene="Rab3a"
FT                   /locus_tag="mCG_14795"
FT                   /product="RAB3A, member RAS oncogene family, transcript
FT                   variant mCT170281"
FT                   /note="gene_id=mCG14795.1 transcript_id=mCT170281.0 created
FT                   on 27-JUN-2002"
FT   mRNA            join(15241781..15241927,15242913..15243140,
FT                   15243504..15243622,15244194..15244318,15244954..15245733)
FT                   /gene="Rab3a"
FT                   /locus_tag="mCG_14795"
FT                   /product="RAB3A, member RAS oncogene family, transcript
FT                   variant mCT20489"
FT                   /note="gene_id=mCG14795.1 transcript_id=mCT20489.1 created
FT                   on 27-JUN-2002"
FT   CDS             join(15242913..15243140,15243504..15243622,
FT                   15244194..15244318,15244954..15245144)
FT                   /codon_start=1
FT                   /gene="Rab3a"
FT                   /locus_tag="mCG_14795"
FT                   /product="RAB3A, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG14795.1 transcript_id=mCT20489.1
FT                   protein_id=mCP13311.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q0PD63"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:97843"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PD63"
FT                   /protein_id="EDL28866.1"
FT                   /translation="MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADD
FT                   SFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDI
FT                   TNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFE
FT                   ASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC"
FT   CDS             join(15242913..15243140,15243504..15243622,
FT                   15244194..15244318,15244954..15245144)
FT                   /codon_start=1
FT                   /gene="Rab3a"
FT                   /locus_tag="mCG_14795"
FT                   /product="RAB3A, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG14795.1 transcript_id=mCT170281.0
FT                   protein_id=mCP93199.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q0PD63"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:97843"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PD63"
FT                   /protein_id="EDL28867.1"
FT                   /translation="MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADD
FT                   SFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDI
FT                   TNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFE
FT                   ASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC"
FT   gene            complement(15245129..15248018)
FT                   /gene="BC051227"
FT                   /locus_tag="mCG_14785"
FT                   /note="gene_id=mCG14785.3"
FT   mRNA            complement(join(15245129..15246080,15246165..15246293,
FT                   15246447..15246523,15247425..15247595,15247777..15248018))
FT                   /gene="BC051227"
FT                   /locus_tag="mCG_14785"
FT                   /product="cDNA sequence BC051227, transcript variant
FT                   mCT20479"
FT                   /note="gene_id=mCG14785.3 transcript_id=mCT20479.2 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(15245129..15246080,15246165..15246293,
FT                   15246447..15246564,15247425..15247595,15247777..15248018))
FT                   /gene="BC051227"
FT                   /locus_tag="mCG_14785"
FT                   /product="cDNA sequence BC051227, transcript variant
FT                   mCT170273"
FT                   /note="gene_id=mCG14785.3 transcript_id=mCT170273.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(15245129..15246080,15246165..15246293,
FT                   15246447..15246523,15247149..>15247179))
FT                   /gene="BC051227"
FT                   /locus_tag="mCG_14785"
FT                   /product="cDNA sequence BC051227, transcript variant
FT                   mCT170272"
FT                   /note="gene_id=mCG14785.3 transcript_id=mCT170272.1 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(15246042..15246080,15246165..15246293,
FT                   15246447..15246523,15247425..15247595,15247777..15247963))
FT                   /codon_start=1
FT                   /gene="BC051227"
FT                   /locus_tag="mCG_14785"
FT                   /product="cDNA sequence BC051227, isoform CRA_c"
FT                   /note="gene_id=mCG14785.3 transcript_id=mCT20479.2
FT                   protein_id=mCP13283.2 isoform=CRA_c"
FT                   /protein_id="EDL28870.1"
FT                   /translation="MALGGWRWARKALAAGRPLFQGRALLLTNTLGCGVLMAAGDGARQ
FT                   VWEVRARPGQRFSARRSASMFAVGCSMGPFLHFWYLWLDRLLPASGLRSLPSVMKKVLV
FT                   DQTVASPILGVWYFLGLGSLEGQTLEESCQELRAKFWDFYKADWCVWPAAQLVNFLFIP
FT                   SHFRVTYINGLTLGWDTYLSYLKYWVPEPLQTPGCAD"
FT   CDS             complement(join(15246042..15246080,15246165..15246293,
FT                   15246447..15246523,15247149..>15247179))
FT                   /codon_start=1
FT                   /gene="BC051227"
FT                   /locus_tag="mCG_14785"
FT                   /product="cDNA sequence BC051227, isoform CRA_a"
FT                   /note="gene_id=mCG14785.3 transcript_id=mCT170272.1
FT                   protein_id=mCP93191.0 isoform=CRA_a"
FT                   /protein_id="EDL28868.1"
FT                   /translation="TLAALSLLPTGLGSLEGQTLEESCQELRAKFWDFYKADWCVWPAA
FT                   QLVNFLFIPSHFRVTYINGLTLGWDTYLSYLKYWVPEPLQTPGCAD"
FT   CDS             complement(join(15246494..15246564,15247425..15247595,
FT                   15247777..15247963))
FT                   /codon_start=1
FT                   /gene="BC051227"
FT                   /locus_tag="mCG_14785"
FT                   /product="cDNA sequence BC051227, isoform CRA_b"
FT                   /note="gene_id=mCG14785.3 transcript_id=mCT170273.1
FT                   protein_id=mCP93190.1 isoform=CRA_b"
FT                   /protein_id="EDL28869.1"
FT                   /translation="MALGGWRWARKALAAGRPLFQGRALLLTNTLGCGVLMAAGDGARQ
FT                   VWEVRARPGQRFSARRSASMFAVGCSMGPFLHFWYLWLDRLLPASGLRSLPSVMKKVLV
FT                   DQTVASPILGVWYFLATSAFITTSWSSSQALAAWRVRH"
FT   gene            <15249817..15250828
FT                   /locus_tag="mCG_140603"
FT                   /note="gene_id=mCG140603.0"
FT   mRNA            join(<15249817..15250091,15250179..15250233,
FT                   15250776..15250828)
FT                   /locus_tag="mCG_140603"
FT                   /product="mCG140603"
FT                   /note="gene_id=mCG140603.0 transcript_id=mCT170260.0
FT                   created on 27-JUN-2002"
FT   gene            complement(15249830..15253712)
FT                   /gene="Ifi30"
FT                   /locus_tag="mCG_55802"
FT                   /note="gene_id=mCG55802.1"
FT   mRNA            complement(join(15249830..15250096,15250184..15250237,
FT                   15250783..15250935,15251603..15251695,15251775..15251849,
FT                   15251975..15252157,15253568..15253712))
FT                   /gene="Ifi30"
FT                   /locus_tag="mCG_55802"
FT                   /product="interferon gamma inducible protein 30"
FT                   /note="gene_id=mCG55802.1 transcript_id=mCT55985.1 created
FT                   on 27-JUN-2002"
FT   CDS             join(<15249887..15250091,15250179..15250233,
FT                   15250776..15250827)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140603"
FT                   /product="mCG140603"
FT                   /note="gene_id=mCG140603.0 transcript_id=mCT170260.0
FT                   protein_id=mCP93178.0"
FT                   /protein_id="EDL28871.1"
FT                   /translation="GKILVSEKSGVWALWDMCKVFIARQQLLQVGNLKKLGSFSWDEFE
FT                   VMPLLIADLPGGVGNGGADVWLLPYLVQLTDYAQELAGVLQSSYLIDQHPGHILVGWV"
FT   CDS             complement(join(15250031..15250096,15250184..15250237,
FT                   15250783..15250935,15251603..15251695,15251775..15251849,
FT                   15251975..15252157,15253568..15253690))
FT                   /codon_start=1
FT                   /gene="Ifi30"
FT                   /locus_tag="mCG_55802"
FT                   /product="interferon gamma inducible protein 30"
FT                   /note="gene_id=mCG55802.1 transcript_id=mCT55985.1
FT                   protein_id=mCP34704.0"
FT                   /db_xref="GOA:Q9ESY9"
FT                   /db_xref="InterPro:IPR004911"
FT                   /db_xref="MGI:MGI:2137648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ESY9"
FT                   /protein_id="EDL28872.1"
FT                   /translation="MSWSPILPFLSLLLLLFPLEVPRAATASLSQASSEGTTTCKAHDV
FT                   CLLGPRPLPPSPPVRVSLYYESLCGACRYFLVRDLFPTWLMVMEIMNITLVPYGNAQER
FT                   NVSGTWEFTCQHGELECRLNMVEACLLDKLEKEAAFLTIVCMEEMDDMEKKLGPCLQVY
FT                   APEVSPESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNEKPLKDPSELLSIV
FT                   CQLYQGTEKPDICSSIADSPRKVCYK"
FT   gene            complement(15255232..15263774)
FT                   /gene="Pik3r2"
FT                   /locus_tag="mCG_14779"
FT                   /note="gene_id=mCG14779.2"
FT   mRNA            complement(join(15255232..15255956,15256121..15256291,
FT                   15256407..15256478,15256648..15256824,15256964..15257106,
FT                   15257436..15257561,15257643..15257823,15257906..15258004,
FT                   15258113..15258221,15258348..15258433,15258892..15259090,
FT                   15259192..15259323,15259411..15259461,15259663..15259755,
FT                   15261730..15262426,15263681..15263774))
FT                   /gene="Pik3r2"
FT                   /locus_tag="mCG_14779"
FT                   /product="phosphatidylinositol 3-kinase, regulatory
FT                   subunit, polypeptide 2 (p85 beta)"
FT                   /note="gene_id=mCG14779.2 transcript_id=mCT20398.2 created
FT                   on 27-JUN-2002"
FT   CDS             complement(join(15255749..15255956,15256121..15256291,
FT                   15256407..15256478,15256648..15256824,15256964..15257106,
FT                   15257436..15257561,15257643..15257823,15257906..15258004,
FT                   15258113..15258221,15258348..15258433,15258892..15259090,
FT                   15259192..15259323,15259411..15259461,15259663..15259755,
FT                   15261730..15262051))
FT                   /codon_start=1
FT                   /gene="Pik3r2"
FT                   /locus_tag="mCG_14779"
FT                   /product="phosphatidylinositol 3-kinase, regulatory
FT                   subunit, polypeptide 2 (p85 beta)"
FT                   /note="gene_id=mCG14779.2 transcript_id=mCT20398.2
FT                   protein_id=mCP13312.2"
FT                   /db_xref="GOA:O08908"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001720"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="MGI:MGI:1098772"
FT                   /db_xref="PDB:2Y3A"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08908"
FT                   /protein_id="EDL28873.1"
FT                   /translation="MAGAEGFQYRAVYPFRRERPEDLELLPGDLLVVSRVALQALGVAD
FT                   GGERCPHNVGWMPGFNERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPLDGS
FT                   SESGHILPDLAEQFSPPDPAPPILVKLVEAIEQAELDSECYSKPELPATRTDWSLSDLE
FT                   QWDRTALYDAVKGFLLALPAAVVTPEAAAEAYRALREVAGPVGLVLEPPTLPLHQALTL
FT                   RFLLQHLGRVARRAPSPDTAVHALASAFGPLLLRIPPSGGEGDGSEPVPDFPVLLLERL
FT                   VQEHVEEQDAAPPALPPKPSKAKPAPTALANGGSPPSLQDAEWYWGDISREEVNERLRD
FT                   TPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVELISHY
FT                   RHESLAQYNAKLDTRLLYPVSKYQQDQVVKEDSIEAVGAQLKVYHQQYQDKSREYDQLY
FT                   EEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILL
FT                   NSERLKSRIAEIHESRTKLEQDLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLT
FT                   QKGARQRKINEWLGIKNETEDQYSLMEDEDALPHHEERTWYVGKINRTQAEEMLSGKRD
FT                   GTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHAS
FT                   LVQHNDALTVTLAHPVRAPGPGPPSAAR"
FT   gene            complement(15265191..>15284079)
FT                   /locus_tag="mCG_127588"
FT                   /note="gene_id=mCG127588.1"
FT   mRNA            complement(join(15265191..15267011,15267347..15267528,
FT                   15267613..15267749,15267942..15268064,15268221..15268447,
FT                   15268585..15268797,15268973..15269214,15270538..15270671,
FT                   15270773..15270882,15271216..15271338,15271587..15271688,
FT                   15271801..15271966,15272434..15272566,15273230..15273368,
FT                   15273643..15273851,15273929..15274014,15274380..15274438,
FT                   15274735..15274867,15274941..15275042,15275203..15275412,
FT                   15275800..15275875,15275952..15276109,15276279..15276357,
FT                   15276923..15276995,15277072..15277160,15283791..15283880,
FT                   15283978..>15284079))
FT                   /locus_tag="mCG_127588"
FT                   /product="mCG127588"
FT                   /note="gene_id=mCG127588.1 transcript_id=mCT128874.1
FT                   created on 27-JUN-2002"
FT   CDS             complement(join(15266488..15267011,15267347..15267528,
FT                   15267613..15267749,15267942..15268064,15268221..15268447,
FT                   15268585..15268797,15268973..15269214,15270538..15270671,
FT                   15270773..15270882,15271216..15271338,15271587..15271688,
FT                   15271801..15271966,15272434..15272566,15273230..15273368,
FT                   15273643..15273851,15273929..15274014,15274380..15274438,
FT                   15274735..15274867,15274941..15275042,15275203..15275412,
FT                   15275800..15275875,15275952..15276109,15276279..15276357,
FT                   15276923..15276995,15277072..15277160,15283791..15283880,
FT                   15283978..>15284078))
FT                   /codon_start=1
FT                   /locus_tag="mCG_127588"
FT                   /product="mCG127588"
FT                   /note="gene_id=mCG127588.1 transcript_id=mCT128874.1
FT                   protein_id=mCP54181.1"
FT                   /protein_id="EDL28874.1"
FT                   /translation="QRVCSRPVPPGVGSRGAAMKSRREKLLIPALTLDLSPSSQSPCLL
FT                   SPGSPCSPCSPSLGLQPWSCRSGNRKSLVVGTPSPTLSRPLSPLSVPTAGNSPLDSPRN
FT                   FSAAAAISFPFARRADGRRWSLASLPSSGYGTNTPSSTVSSSSSSRERLHQLPFQPTAD
FT                   ELRFLSKHFRSSESVVDEDGGRSPRLRPRSRSLSPGRTSGTFDNEIVMMNHVYRERFPK
FT                   ATAQMEGRLQDFLAAFAPGDRLALADGVLGFIHHQIVELARDCLAKSGEALVTSRYFLE
FT                   MQDKLERLLQDAHERSDSAEVGFIVQLVRKLLIIISRPARLLECLEFDPEEFYHLLEAA
FT                   EGQAREDQGVKTDLPRYIIRQLGLAKDPLEEIQPLNDLDESQPPAPGSPESRGLGGPSR
FT                   RKPCESDFETIKLISNGAYGAVYLVRHRDTRQRFAIKKINKQNLILRNQIQQVFVERDI
FT                   LTFAENPFVVGMFCSFETRRHLCMVMEYVEGGDCATLLKNMGPLPVDMARMYFAETVLA
FT                   LEYLHNYGIVHRDLKPDNLLITSLGHIKLTDFGLSKIGLMSMATNLYEGHIEKDAREFV
FT                   DKQVCGTPEYIAPEVIFRQGYGKPVDWWAMGVILYEFLVGCVPFFGDTPEELFGQVVSD
FT                   EIMWPEGDEALPLDAQDLITRLLRQSPMDRLGTGGTHEVKQHPFFLALDWAGLLRHKAE
FT                   FVPQLEAEDDTSYFDTRSERYRHLGSEDDETNDEESSTEIPQFSSCSHRFSKVYSSSEF
FT                   LAVQPTPTFAERSFSEDREDGWGQSLGDRGRRLSADLRLRSWTPASSCQPSSCQTDRGP
FT                   SPSLLSTISLDVMPKFAFSSEDEGASSGPADPQKPVFILGEPDPPPPTTPVTPKPCNLS
FT                   ADTAVLSHARLRSNSTGARHSTPRPLDAGRGRRLGGSRDPGPEKPRASPGGSGGRVPKS
FT                   ASVSALSLIITADDGSGGPLMSPLSPRSLSSNPSSRDSSPSRDPSPVCGSLRPPIVIHS
FT                   SGKKYGFSLRAIRVYMGDSDVYTVHHVVWSVEEGSPAQEAGLRAGDLITHINGESVLGL
FT                   VHMDVVELLLKSGNKISLRTTALENTSIKVGPARKNVAKGRMARRSKRSRRRETQDRRK
FT                   SLFKRISKPSSVLHTSRSFSSGLQHSLSSSESLPGSPTHSLSPSPTTPCRSPAPDAPTD
FT                   TASPPNVSPSSSSPASPATGHTRPSSLHGLAAKLGPPRHKSGRRKSTSSIPPSPLACPP
FT                   VPTPPPRSPSPLPGHIPIPARSPRLRRGQSADKLGLGTSERLDGDGGRRARGAEAELVV
FT                   MRRLHLSERRDSFKKQEAVQEVSFDEEPGPPRGVPKIAVQGAEATPGTPGHARKD"
FT   gene            15295552..15308517
FT                   /gene="Il12rb1"
FT                   /locus_tag="mCG_14780"
FT                   /note="gene_id=mCG14780.2"
FT   mRNA            join(15295552..15295694,15296907..15296966,
FT                   15297631..15297745,15298115..15298308,15299560..15299696,
FT                   15300387..15300453,15300735..15300860,15301148..15301230,
FT                   15301519..15301756,15302784..15302951,15303515..15303649,
FT                   15303966..15304121,15304294..15304428,15306415..15306511,
FT                   15306772..15306853,15307610..15308517)
FT                   /gene="Il12rb1"
FT                   /locus_tag="mCG_14780"
FT                   /product="interleukin 12 receptor, beta 1, transcript
FT                   variant mCT20399"
FT                   /note="gene_id=mCG14780.2 transcript_id=mCT20399.2 created
FT                   on 27-JUN-2002"
FT   mRNA            join(<15295560..15295694,15296907..15296966,
FT                   15297631..15297745,15298115..15298308,15299560..15299696,
FT                   15300387..15300453,15300735..15300860,15301148..15301230,
FT                   15301519..15301756,15302784..15302951,15303515..15303649,
FT                   15303966..15304121,15304294..15304428,15306772..15306853,
FT                   15307610..15308516)
FT                   /gene="Il12rb1"
FT                   /locus_tag="mCG_14780"
FT                   /product="interleukin 12 receptor, beta 1, transcript
FT                   variant mCT192537"
FT                   /note="gene_id=mCG14780.2 transcript_id=mCT192537.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<15295562..15295694,15296907..15296966,
FT                   15297631..15297745,15298115..15298308,15299560..15299696,
FT                   15300387..15300453,15300735..15300860,15301148..15301230,
FT                   15301519..15301756,15302784..15302951,15303515..15303649,
FT                   15303966..15304121,15304294..15304428,15306772..15306853,
FT                   15307610..15307853)
FT                   /codon_start=1
FT                   /gene="Il12rb1"
FT                   /locus_tag="mCG_14780"
FT                   /product="interleukin 12 receptor, beta 1, isoform CRA_a"
FT                   /note="gene_id=mCG14780.2 transcript_id=mCT192537.0
FT                   protein_id=mCP113506.0 isoform=CRA_a"
FT                   /protein_id="EDL28875.1"
FT                   /translation="VDKAAGPLQPCRSSWGLTTRLLMDMMGLAGTSKHITFLLLCQLGA
FT                   SGPGDGCCVEKTSFPEGASGSPLGPRNLSCYRVSKTDYECSWQYDGPEDNVSHVLWCCF
FT                   VPPNHTHTGQERCRYFSSGPDRTVQFWEQDGIPVLSKVNFWVESRLGNRTMKSQKISQY
FT                   LYNWTKTTPPLGHIKVSQSHGQLRMDWNVSEEAGAEVQFRRRMPTTNWTLGDCGPQVNS
FT                   GSGVLGDIRGSMSESCLCPSENMAQEIQIRRRRRLSSGAPGGPWSDWSMPVCVPPEVLP
FT                   QAKIKFLVEPLNQGGRRRLTMQGQSPQLAVPEGCRGRPGAQVKKHLVLVRMLSCRCQAQ
FT                   TSKTVPLGKKLNLSGATYDLNVLAKTRFGRSTIQKWHLPAQELTETRALNVSVGGNMTS
FT                   MQWAAQAPGTTYCLEWQPWFQHRNHTHCTLIVPEEEDPAKMVTHSWSSKPTLEQEECYR
FT                   ITVFASKNPKNPMLWATVLSSYYFGGNASRAGTPRHVSVRNQTGDSVSVEWTASQLSTC
FT                   PGVLTQYVVRCEAEDGAWESEWLVPPTKTQVTLDGLRSRVMYKVQVRADTARLPGAWSH
FT                   PQRFSFGPPGTCAHPCLHPVAALPWSSLAARASRLGSGATLRTSRRCCTREMRWWSRCP
FT                   ETEATGQSRPRPPLSAPWTQGGPWRLRGRGRCRHCQRPGAWAWLGRTVPVVTWPT"
FT   CDS             join(15295628..15295694,15296907..15296966,
FT                   15297631..15297745,15298115..15298308,15299560..15299696,
FT                   15300387..15300453,15300735..15300860,15301148..15301230,
FT                   15301519..15301756,15302784..15302951,15303515..15303649,
FT                   15303966..15304121,15304294..15304428,15306415..15306511,
FT                   15306772..15306853,15307610..15307966)
FT                   /codon_start=1
FT                   /gene="Il12rb1"
FT                   /locus_tag="mCG_14780"
FT                   /product="interleukin 12 receptor, beta 1, isoform CRA_b"
FT                   /note="gene_id=mCG14780.2 transcript_id=mCT20399.2
FT                   protein_id=mCP13259.2 isoform=CRA_b"
FT                   /protein_id="EDL28876.1"
FT                   /translation="MDMMGLAGTSKHITFLLLCQLGASGPGDGCCVEKTSFPEGASGSP
FT                   LGPRNLSCYRVSKTDYECSWQYDGPEDNVSHVLWCCFVPPNHTHTGQERCRYFSSGPDR
FT                   TVQFWEQDGIPVLSKVNFWVESRLGNRTMKSQKISQYLYNWTKTTPPLGHIKVSQSHGQ
FT                   LRMDWNVSEEAGAEVQFRRRMPTTNWTLGDCGPQVNSGSGVLGDIRGSMSESCLCPSEN
FT                   MAQEIQIRRRRRLSSGAPGGPWSDWSMPVCVPPEVLPQAKIKFLVEPLNQGGRRRLTMQ
FT                   GQSPQLAVPEGCRGRPGAQVKKHLVLVRMLSCRCQAQTSKTVPLGKKLNLSGATYDLNV
FT                   LAKTRFGRSTIQKWHLPAQELTETRALNVSVGGNMTSMQWAAQAPGTTYCLEWQPWFQH
FT                   RNHTHCTLIVPEEEDPAKMVTHSWSSKPTLEQEECYRITVFASKNPKNPMLWATVLSSY
FT                   YFGGNASRAGTPRHVSVRNQTGDSVSVEWTASQLSTCPGVLTQYVVRCEAEDGAWESEW
FT                   LVPPTKTQVTLDGLRSRVMYKVQVRADTARLPGAWSHPQRFSFEVQISRLSIIFASLGS
FT                   FASVLLVGSLGYIGLNRAAWHLCPPLPTPCGSTAVEFPGSQGKQAWQWCNPEDFPEVLY
FT                   PRDALVVEMPGDRGDGTESPQAAPECALDTRRPLETQRQRQVQALSEARRLGLAREDCP
FT                   RGDLAHVTLPLLLGGVTQGASVLDDLWRTHKTAEPGPPTLGQEA"
FT   gene            complement(15322189..>15326773)
FT                   /gene="Arrdc2"
FT                   /locus_tag="mCG_14786"
FT                   /note="gene_id=mCG14786.2"
FT   mRNA            complement(join(15322189..15323048,15323274..15323431,
FT                   15323912..15324074,15324164..15324420,15324498..15324600,
FT                   15325748..15325895,15326033..15326099,15326182..>15326773))
FT                   /gene="Arrdc2"
FT                   /locus_tag="mCG_14786"
FT                   /product="arrestin domain containing 2, transcript variant
FT                   mCT20480"
FT                   /note="gene_id=mCG14786.2 transcript_id=mCT20480.2 created
FT                   on 23-SEP-2002"
FT   CDS             complement(join(15322995..15323048,15323274..15323431,
FT                   15323912..15324074,15324164..15324420,15324498..15324600,
FT                   15325748..15325895,15326033..15326099,15326182..>15326614))
FT                   /codon_start=1
FT                   /gene="Arrdc2"
FT                   /locus_tag="mCG_14786"
FT                   /product="arrestin domain containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG14786.2 transcript_id=mCT20480.2
FT                   protein_id=mCP13310.2 isoform=CRA_b"
FT                   /protein_id="EDL28878.1"
FT                   /translation="VRRSCGSPAVFRPVVPLVCVRSSSPLRSQSLALSFRGFEHLADLF
FT                   FGFATVTAMLFDKVKAFVVEIDGARTGTEPVFHGGQAVAGRVLLELAGAARVGALRLRA
FT                   RGRARAHWTESRSAGSSTAYTQSYSERVEVVNHRATLLAPDSGDIATLPAGRHEFPFSF
FT                   QLPISLVTSFEGKHGSVRYSIKATLHRPWVPARCARKVFTVIEPVDINTPALLEPQAGA
FT                   REKVARSWYCTRGLVSLSAKIDRKGYTPGEVIPIFAEIDNGSTRAVQPRAALVQTQTFM
FT                   ARGARKQKRAVVASVDGEPVGPNRRALWPGRALRIPPVGPSILQCRVLSVDYSLKVFVD
FT                   IPGSSKLLLELPLVIGTVPLHPLGSRSASVGSRASFLQDWGLCTMMDRPEAPPEYSEVV
FT                   RESQLVCASPGPSSLLHDLGVTTEGPYFACLQEFRYCPPPLYSEEDPNPPSEAVRPRCM
FT                   TC"
FT   mRNA            complement(join(<15322995..15323048,15323274..15323431,
FT                   15323912..15324074,15324164..15324420,15324498..15324600,
FT                   15325748..15325895,15326033..>15326572))
FT                   /gene="Arrdc2"
FT                   /locus_tag="mCG_14786"
FT                   /product="arrestin domain containing 2, transcript variant
FT                   mCT170274"
FT                   /note="gene_id=mCG14786.2 transcript_id=mCT170274.0 created
FT                   on 23-SEP-2002"
FT   CDS             complement(join(15322995..15323048,15323274..15323431,
FT                   15323912..15324074,15324164..15324420,15324498..15324600,
FT                   15325748..15325895,15326033..>15326208))
FT                   /codon_start=1
FT                   /gene="Arrdc2"
FT                   /locus_tag="mCG_14786"
FT                   /product="arrestin domain containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG14786.2 transcript_id=mCT170274.0
FT                   protein_id=mCP93192.0 isoform=CRA_a"
FT                   /protein_id="EDL28877.1"
FT                   /translation="TTAPRCSRQVRAGDLLGRTEHAIPRPTSAEPRVLFLDSGDIATLP
FT                   AGRHEFPFSFQLPISLVTSFEGKHGSVRYSIKATLHRPWVPARCARKVFTVIEPVDINT
FT                   PALLEPQAGAREKVARSWYCTRGLVSLSAKIDRKGYTPGEVIPIFAEIDNGSTRAVQPR
FT                   AALVQTQTFMARGARKQKRAVVASVDGEPVGPNRRALWPGRALRIPPVGPSILQCRVLS
FT                   VDYSLKVFVDIPGSSKLLLELPLVIGTVPLHPLGSRSASVGSRASFLQDWGLCTMMDRP
FT                   EAPPEYSEVVRESQLVCASPGPSSLLHDLGVTTEGPYFACLQEFRYCPPPLYSEEDPNP
FT                   PSEAVRPRCMTC"
FT   gene            complement(15330219..>15342646)
FT                   /gene="Kcnn1"
FT                   /locus_tag="mCG_14789"
FT                   /note="gene_id=mCG14789.1"
FT   mRNA            complement(join(15330219..15331622,15333556..15333625,
FT                   15335236..15335363,15335839..15335949,15337661..15337802,
FT                   15339715..15340133,15341688..15341783,15342062..>15342646))
FT                   /gene="Kcnn1"
FT                   /locus_tag="mCG_14789"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 1,
FT                   transcript variant mCT20483"
FT                   /note="gene_id=mCG14789.1 transcript_id=mCT20483.2 created
FT                   on 27-JUN-2002"
FT   mRNA            complement(join(15330219..15331622,15333556..15333625,
FT                   15335232..15335363,15335839..15335949,15337661..15337802,
FT                   15339715..15340133,15341688..15341783,15342062..15342646))
FT                   /gene="Kcnn1"
FT                   /locus_tag="mCG_14789"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 1,
FT                   transcript variant mCT170276"
FT                   /note="gene_id=mCG14789.1 transcript_id=mCT170276.0 created
FT                   on 27-JUN-2002"
FT   CDS             complement(join(15331377..15331622,15333556..15333625,
FT                   15335236..15335363,15335839..15335949,15337661..15337802,
FT                   15339715..15340133,15341688..15341783,15342062..>15342610))
FT                   /codon_start=1
FT                   /gene="Kcnn1"
FT                   /locus_tag="mCG_14789"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG14789.1 transcript_id=mCT20483.2
FT                   protein_id=mCP13316.2 isoform=CRA_b"
FT                   /protein_id="EDL28880.1"
FT                   /translation="SWTLLSLGMFWNGQGDVQPLLSPQVHSEALLRNHAGPQRACCTPS
FT                   PRRQVAMSSHSHNGSVGQPLGSGPGFLGWEPVDPEAGRPLQPTQGPGLQMVAKGQPVRL
FT                   SPGGSRGHPQEQEEEEEEEEEEEDKTGSGKPPTVSHRLGHRRALFEKRKRLSDYALIFG
FT                   MFGIVVMVTETELSWGVYTKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNG
FT                   ADDWRIAMTWERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSI
FT                   PMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSV
FT                   SSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLT
FT                   GIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHT
FT                   RLVKKPDQGRVRKHQRKFLQAIHQLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSEL
FT                   QAQQEELEARLAALESRLDVLGASLQALPGLIAQAICPLPPPWPGPGHLATATQSPQSH
FT                   WLPTMGSDCG"
FT   mRNA            complement(join(<15331377..15331622,15333556..15333625,
FT                   15333825..15333833,15335236..15335363,15335839..15335949,
FT                   15337661..15337802,15339715..15340133,15341688..15341783,
FT                   15342062..>15342586))
FT                   /gene="Kcnn1"
FT                   /locus_tag="mCG_14789"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 1,
FT                   transcript variant mCT170275"
FT                   /note="gene_id=mCG14789.1 transcript_id=mCT170275.0 created
FT                   on 27-JUN-2002"
FT   CDS             complement(join(15331377..15331622,15333556..15333625,
FT                   15333825..15333833,15335236..15335363,15335839..15335949,
FT                   15337661..15337802,15339715..15340133,15341688..15341783,
FT                   15342062..15342586))
FT                   /codon_start=1
FT                   /gene="Kcnn1"
FT                   /locus_tag="mCG_14789"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG14789.1 transcript_id=mCT170275.0
FT                   protein_id=mCP93193.0 isoform=CRA_a"
FT                   /protein_id="EDL28879.1"
FT                   /translation="MFWNGQGDVQPLLSPQVHSEALLRNHAGPQRACCTPSPRRQVAMS
FT                   SHSHNGSVGQPLGSGPGFLGWEPVDPEAGRPLQPTQGPGLQMVAKGQPVRLSPGGSRGH
FT                   PQEQEEEEEEEEEEEDKTGSGKPPTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMV
FT                   TETELSWGVYTKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAM
FT                   TWERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYL
FT                   LARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAW
FT                   TVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCT
FT                   ALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQ
FT                   GRVRKHQRKFLQAIHQAQKLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQE
FT                   ELEARLAALESRLDVLGASLQALPGLIAQAICPLPPPWPGPGHLATATQSPQSHWLPTM
FT                   GSDCG"
FT   CDS             complement(join(15335232..15335363,15335839..15335949,
FT                   15337661..15337802,15339715..15340133,15341688..15341783,
FT                   15342062..15342586))
FT                   /codon_start=1
FT                   /gene="Kcnn1"
FT                   /locus_tag="mCG_14789"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG14789.1 transcript_id=mCT170276.0
FT                   protein_id=mCP93194.0 isoform=CRA_c"
FT                   /protein_id="EDL28881.1"
FT                   /translation="MFWNGQGDVQPLLSPQVHSEALLRNHAGPQRACCTPSPRRQVAMS
FT                   SHSHNGSVGQPLGSGPGFLGWEPVDPEAGRPLQPTQGPGLQMVAKGQPVRLSPGGSRGH
FT                   PQEQEEEEEEEEEEEDKTGSGKPPTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMV
FT                   TETELSWGVYTKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAM
FT                   TWERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYL
FT                   LARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAW
FT                   TVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCT
FT                   ALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQ
FT                   GRVRKHQRKFLQAIHQ"
FT   gene            complement(15355065..15360996)
FT                   /gene="1810023B24Rik"
FT                   /locus_tag="mCG_14784"
FT                   /note="gene_id=mCG14784.2"
FT   mRNA            complement(join(15355065..15355706,15355798..15355912,
FT                   15355994..15356168,15356966..15357135,15360105..15360443))
FT                   /gene="1810023B24Rik"
FT                   /locus_tag="mCG_14784"
FT                   /product="RIKEN cDNA 1810023B24, transcript variant
FT                   mCT20478"
FT                   /note="gene_id=mCG14784.2 transcript_id=mCT20478.2 created
FT                   on 27-JUN-2002"
FT   mRNA            complement(join(15355289..15355706,15355798..15355912,
FT                   15355994..15356168,15356966..15357135,15360520..15360996))
FT                   /gene="1810023B24Rik"
FT                   /locus_tag="mCG_14784"
FT                   /product="RIKEN cDNA 1810023B24, transcript variant
FT                   mCT170271"
FT                   /note="gene_id=mCG14784.2 transcript_id=mCT170271.0 created
FT                   on 27-JUN-2002"
FT   CDS             complement(join(15355502..15355706,15355798..15355912,
FT                   15355994..15356168,15356966..15357124))
FT                   /codon_start=1
FT                   /gene="1810023B24Rik"
FT                   /locus_tag="mCG_14784"
FT                   /product="RIKEN cDNA 1810023B24, isoform CRA_a"
FT                   /note="gene_id=mCG14784.2 transcript_id=mCT20478.2
FT                   protein_id=mCP13305.1 isoform=CRA_a"
FT                   /protein_id="EDL28882.1"
FT                   /translation="MPKKFQGENSKSAAARARRAEAKAAADAKKQKELEDAYWKDEDKH
FT                   VMRKEQRKEEKEKRRLEQLERKKETQRLLEEEDSRLKGGKAPRVAPAKVTRAQIEDSLR
FT                   REQRAEPVEKAKSHLELPLEENLNRRLQEEGSVEARTVEDAIAVLSVAEEADRHPERRM
FT                   RAAFTAFEEVQLPRLKQENPNMRLSQLKQLLKKEWLRSPDNPMNQRALPFNAPK"
FT   CDS             complement(join(15355502..15355706,15355798..15355912,
FT                   15355994..15356168,15356966..15357124))
FT                   /codon_start=1
FT                   /gene="1810023B24Rik"
FT                   /locus_tag="mCG_14784"
FT                   /product="RIKEN cDNA 1810023B24, isoform CRA_a"
FT                   /note="gene_id=mCG14784.2 transcript_id=mCT170271.0
FT                   protein_id=mCP93189.0 isoform=CRA_a"
FT                   /protein_id="EDL28883.1"
FT                   /translation="MPKKFQGENSKSAAARARRAEAKAAADAKKQKELEDAYWKDEDKH
FT                   VMRKEQRKEEKEKRRLEQLERKKETQRLLEEEDSRLKGGKAPRVAPAKVTRAQIEDSLR
FT                   REQRAEPVEKAKSHLELPLEENLNRRLQEEGSVEARTVEDAIAVLSVAEEADRHPERRM
FT                   RAAFTAFEEVQLPRLKQENPNMRLSQLKQLLKKEWLRSPDNPMNQRALPFNAPK"
FT   gene            complement(15369952..15379818)
FT                   /gene="Slc5a5"
FT                   /locus_tag="mCG_14796"
FT                   /note="gene_id=mCG14796.2"
FT   mRNA            complement(join(15369952..15371029,15371982..15372097,
FT                   15373091..15373215,15374755..15374936,15375015..15375101,
FT                   15375442..15375512,15375584..15375696,15375887..15375975,
FT                   15376401..15376530,15376628..15376768,15377278..15377432,
FT                   15378175..15378242,15378339..15378390,15378713..15378778,
FT                   15379366..15379818))
FT                   /gene="Slc5a5"
FT                   /locus_tag="mCG_14796"
FT                   /product="solute carrier family 5 (sodium iodide
FT                   symporter), member 5"
FT                   /note="gene_id=mCG14796.2 transcript_id=mCT20490.2 created
FT                   on 02-JUL-2002"
FT   CDS             complement(join(15370925..15371029,15371982..15372097,
FT                   15373091..15373215,15374755..15374936,15375015..15375101,
FT                   15375442..15375512,15375584..15375696,15375887..15375975,
FT                   15376401..15376530,15376628..15376768,15377278..15377432,
FT                   15378175..15378242,15378339..15378390,15378713..15378778,
FT                   15379366..15379722))
FT                   /codon_start=1
FT                   /gene="Slc5a5"
FT                   /locus_tag="mCG_14796"
FT                   /product="solute carrier family 5 (sodium iodide
FT                   symporter), member 5"
FT                   /note="gene_id=mCG14796.2 transcript_id=mCT20490.2
FT                   protein_id=mCP13278.2"
FT                   /db_xref="GOA:G3X8P5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="MGI:MGI:2149330"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8P5"
FT                   /protein_id="EDL28884.1"
FT                   /translation="MEGAEAGARATFGPWDYGVFATMLLVSTGIGLWVGLARGGQRSAD
FT                   DFFTGGRQLAAVPVGLSLAASFMSAVQVLGVPAEAARYGLKFLWMCVGQLLNSLLTALL
FT                   FLPIFYRLGLTSTYQYLELRFSRAVRLCGTLQYLVATMLYTGIVIYAPALILNQVTGLD
FT                   IWASLLSTGIICTLYTTVGGMKAVVWTDVFQVVVMLVGFWVILARGVMLMGGPWNVLSL
FT                   AQNHSRINLMDFDPDPRSRYTFWTFVVGGSLVWLSMYGVNQAQVQRYVACHTERKAKLA
FT                   LLVNQLGLFLIVASAACCGIVMFVYYKDCDPLLTGRIAAPDQYMPLLVLDIFEDLPGVP
FT                   GLFLACAYSGTLSTASTSINAMAAVTVEDLIKPRMPSLAPRKLVFISKGLSFIYGSTCL
FT                   TVAALSSLLGGGVLQGSFTVMGVISGPLLGAFTLGMLLPACNTPGVLSGLTAGLAVSLW
FT                   VAVGATLYPPGEQTMGVLPTSAAGCTNASVLPSPPGAANTSRGIPSSGMDSGRPAFADT
FT                   FYAVSYLYYGALGTLTTMLCGALISYLTGPTKRSSLGPGLLWWDLARQTASVAPKEDTT
FT                   TLEDSLVKGPEDIPAATKKPPGFRPEAETHPLYLGHDAETNL"
FT   gene            complement(15382363..15384492)
FT                   /locus_tag="mCG_14783"
FT                   /note="gene_id=mCG14783.2"
FT   mRNA            complement(join(15382363..15382767,15382974..15383107,
FT                   15383195..15383374,15384421..15384458))
FT                   /locus_tag="mCG_14783"
FT                   /product="mCG14783, transcript variant mCT178302"
FT                   /note="gene_id=mCG14783.2 transcript_id=mCT178302.0 created
FT                   on 10-JAN-2003"
FT   mRNA            complement(join(15382436..15382565,15382658..15382767,
FT                   15382978..15383107,15383195..15383374,15384421..15384492))
FT                   /locus_tag="mCG_14783"
FT                   /product="mCG14783, transcript variant mCT20477"
FT                   /note="gene_id=mCG14783.2 transcript_id=mCT20477.1 created
FT                   on 10-JAN-2003"
FT   mRNA            complement(join(15382437..15382565,15382658..15382767,
FT                   15382978..15383107,15383208..15383374,15384421..15384462))
FT                   /locus_tag="mCG_14783"
FT                   /product="mCG14783, transcript variant mCT170459"
FT                   /note="gene_id=mCG14783.2 transcript_id=mCT170459.0 created
FT                   on 10-JAN-2003"
FT   mRNA            complement(join(15382440..15382565,15382658..15382767,
FT                   15382978..15383107,15383195..15383374,15384433..>15384455))
FT                   /locus_tag="mCG_14783"
FT                   /product="mCG14783, transcript variant mCT170458"
FT                   /note="gene_id=mCG14783.2 transcript_id=mCT170458.0 created
FT                   on 10-JAN-2003"
FT   mRNA            complement(join(15382463..15382565,15382658..15383107,
FT                   15383195..15383374,15384421..15384442))
FT                   /locus_tag="mCG_14783"
FT                   /product="mCG14783, transcript variant mCT170460"
FT                   /note="gene_id=mCG14783.2 transcript_id=mCT170460.0 created
FT                   on 10-JAN-2003"
FT   mRNA            complement(join(<15382473..15382565,15382658..15382767,
FT                   15382978..15383107,15383195..15383374,15384395..>15384457))
FT                   /locus_tag="mCG_14783"
FT                   /product="mCG14783, transcript variant mCT170457"
FT                   /note="gene_id=mCG14783.2 transcript_id=mCT170457.0 created
FT                   on 10-JAN-2003"
FT   CDS             complement(join(15382473..15382565,15382658..15382767,
FT                   15382978..15383107,15383195..15383374,15384395..>15384454))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14783"
FT                   /product="mCG14783, isoform CRA_a"
FT                   /note="gene_id=mCG14783.2 transcript_id=mCT170457.0
FT                   protein_id=mCP93375.0 isoform=CRA_a"
FT                   /protein_id="EDL28885.1"
FT                   /translation="TSAQCHEGLGHGKEAAAGQKLREYKVVGRCLPTPKCHTPPLYRMR
FT                   IFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGT
FT                   HNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAAGKCRRPAVKQFHDSK
FT                   IKFPLPHRVLRRQHKPRFTTKRPNTFF"
FT   CDS             complement(join(15382473..15382565,15382658..15382767,
FT                   15382978..15383107,15383195..15383374,15384433..>15384453))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14783"
FT                   /product="mCG14783, isoform CRA_b"
FT                   /note="gene_id=mCG14783.2 transcript_id=mCT170458.0
FT                   protein_id=mCP93377.0 isoform=CRA_b"
FT                   /protein_id="EDL28886.1"
FT                   /translation="RVRSAMKLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRF
FT                   WYFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTA
FT                   GAVTQCYRDMGARHRARAHSIQIMKVEEIAAGKCRRPAVKQFHDSKIKFPLPHRVLRRQ
FT                   HKPRFTTKRPNTFF"
FT   CDS             complement(join(15382473..15382565,15382658..15382767,
FT                   15382978..15383107,15383195..15383374,15384421..15384438))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14783"
FT                   /product="mCG14783, isoform CRA_e"
FT                   /note="gene_id=mCG14783.2 transcript_id=mCT20477.1
FT                   protein_id=mCP13254.1 isoform=CRA_e"
FT                   /protein_id="EDL28889.1"
FT                   /translation="MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFW
FT                   YFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAG
FT                   AVTQCYRDMGARHRARAHSIQIMKVEEIAAGKCRRPAVKQFHDSKIKFPLPHRVLRRQH
FT                   KPRFTTKRPNTFF"
FT   CDS             complement(join(15382650..15382767,15382974..15383107,
FT                   15383195..15383374,15384421..15384438))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14783"
FT                   /product="mCG14783, isoform CRA_d"
FT                   /note="gene_id=mCG14783.2 transcript_id=mCT178302.0
FT                   protein_id=mCP101224.0 isoform=CRA_d"
FT                   /protein_id="EDL28888.1"
FT                   /translation="MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFW
FT                   YFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAG
FT                   AVTQCCEPRHGCPTPCPCPLHPDHEGGRDCSWQVPPASCQAVPRE"
FT   CDS             complement(join(15382832..15383107,15383195..15383374,
FT                   15384421..15384438))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14783"
FT                   /product="mCG14783, isoform CRA_f"
FT                   /note="gene_id=mCG14783.2 transcript_id=mCT170460.0
FT                   protein_id=mCP93374.1 isoform=CRA_f"
FT                   /protein_id="EDL28890.1"
FT                   /translation="MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFW
FT                   YFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAG
FT                   AVTQCCESPTLCQFLAPNPRTVAACSGCLNSGAHSKGASSPLGGCAVPPRVNQ"
FT   CDS             complement(join(15383080..15383107,15383208..15383374,
FT                   15384421..15384438))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14783"
FT                   /product="mCG14783, isoform CRA_c"
FT                   /note="gene_id=mCG14783.2 transcript_id=mCT170459.0
FT                   protein_id=mCP93378.1 isoform=CRA_c"
FT                   /protein_id="EDL28887.1"
FT                   /translation="MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFW
FT                   YFVSQLKKMKKSSGEIVCLRSHPCV"
FT   gene            <15392822..15404380
FT                   /gene="Mtap1s"
FT                   /locus_tag="mCG_127609"
FT                   /note="gene_id=mCG127609.1"
FT   mRNA            join(<15392822..15392979,15397797..15397901,
FT                   15398698..15398780,15399365..15399505,15399758..15401846,
FT                   15403203..15403426,15403904..15404380)
FT                   /gene="Mtap1s"
FT                   /locus_tag="mCG_127609"
FT                   /product="microtubule-associated protein 1S, transcript
FT                   variant mCT128896"
FT                   /note="gene_id=mCG127609.1 transcript_id=mCT128896.1
FT                   created on 02-JUL-2002"
FT   CDS             join(<15392823..15392979,15397797..15397901,
FT                   15398698..15398780,15399365..15399505,15399758..15401846,
FT                   15403203..15403426,15403904..15404059)
FT                   /codon_start=1
FT                   /gene="Mtap1s"
FT                   /locus_tag="mCG_127609"
FT                   /product="microtubule-associated protein 1S, isoform CRA_a"
FT                   /note="gene_id=mCG127609.1 transcript_id=mCT128896.1
FT                   protein_id=mCP53978.1 isoform=CRA_a"
FT                   /protein_id="EDL28891.1"
FT                   /translation="AGRSERRGGAKMAAVMAAPEAVEAPSSLLLLVVGGECGCPGLLAY
FT                   VMEELERGVRSWEDVDPAVCSLDEQLKAFVSRHSATFSSIVKGQRSLHHRGETLETLVL
FT                   LNPSDKSLCDELRNLLMDPAPHKLLVLAGPCLEETGELLLQTGGFSAHHFLQVLGDKEV
FT                   QDALASAPAAPALTVSCPTFGDWALLGPVPGLQLRLNPPAQLPASEGLRAFLEYVAESL
FT                   EPPSPFELLEPPAAGGFLRLARPCCYVFPGGLGDAAFFAVNGFTVLVNGGSNPKSSFWK
FT                   LVRHLDRVDAVLVTHAGADSLPGLNSLLRRKLAEREAAAGPQGQHEERLRRLLSPALGV
FT                   VFLNAREAASRLRGGEDEAVCARSLLRSLGIAPLPLQRGPQPSCPTVLFEKLGVGRLEL
FT                   FVLHPPPGDPAAPACALLVWQPAAPGDKVVRVLFPGRTPPARLLDGLQRLQHLPCLRRP
FT                   VVTTHDLEAPSRANSQDSLASRDSARKEPVRGTVGSIANRSTVRREPALATRDQKKDTR
FT                   SGPTQPTARDTRRSGPGVVNTKPRVSQNGPRAPVLAAPLTAPVAECPGEAENILESERP
FT                   PAPSPTLSPAQSPPPTAPGNSPERLSLSPLRPEPAPDASPSATTPTLTTPSLPAELGSP
FT                   HSTEVDESLSVSFEQVLPAGDPGLSLPLRLARRSTSPHDVDLCLVSPCEFSHRKPPPPA
FT                   SPGSSDSSARSQERPPETPPTSVSESLPTLSDSDPVPVADSDDDAGSESAARDPPPTPR
FT                   VPPPLPDVPGICMVDPEALPPRARQPLNTTNPSRSRKAPARPSSASATPRAATVAAKTK
FT                   GPAGDRNRPLSARSEPADRPGRVPLTRKPSVPKTVPKMASATRLSSGPSGRPAPLAAGS
FT                   PVYLDLAYLPGGGAGHLDQNFFLRVRALCYVISGQGQRQEEGLRAVLDALLAGKRQWDL
FT                   DLQVTLIPTFDSAVMHRWYEETHAQHQALGIRVLGSGSLVSMQDEAFPACKVEF"
FT   mRNA            join(<15392845..15392979,15397797..15397901,
FT                   15398698..15398780,15399365..15399505,15399758..15401846,
FT                   15402326..15402393,15403203..15403426,15403904..15404380)
FT                   /gene="Mtap1s"
FT                   /locus_tag="mCG_127609"
FT                   /product="microtubule-associated protein 1S, transcript
FT                   variant mCT192546"
FT                   /note="gene_id=mCG127609.1 transcript_id=mCT192546.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<15392847..15392979,15397797..15397901,
FT                   15398698..15398780,15399365..15399505,15399758..15401846,
FT                   15402326..15402378)
FT                   /codon_start=1
FT                   /gene="Mtap1s"
FT                   /locus_tag="mCG_127609"
FT                   /product="microtubule-associated protein 1S, isoform CRA_b"
FT                   /note="gene_id=mCG127609.1 transcript_id=mCT192546.0
FT                   protein_id=mCP113504.0 isoform=CRA_b"
FT                   /protein_id="EDL28892.1"
FT                   /translation="GAKMAAVMAAPEAVEAPSSLLLLVVGGECGCPGLLAYVMEELERG
FT                   VRSWEDVDPAVCSLDEQLKAFVSRHSATFSSIVKGQRSLHHRGETLETLVLLNPSDKSL
FT                   CDELRNLLMDPAPHKLLVLAGPCLEETGELLLQTGGFSAHHFLQVLGDKEVQDALASAP
FT                   AAPALTVSCPTFGDWALLGPVPGLQLRLNPPAQLPASEGLRAFLEYVAESLEPPSPFEL
FT                   LEPPAAGGFLRLARPCCYVFPGGLGDAAFFAVNGFTVLVNGGSNPKSSFWKLVRHLDRV
FT                   DAVLVTHAGADSLPGLNSLLRRKLAEREAAAGPQGQHEERLRRLLSPALGVVFLNAREA
FT                   ASRLRGGEDEAVCARSLLRSLGIAPLPLQRGPQPSCPTVLFEKLGVGRLELFVLHPPPG
FT                   DPAAPACALLVWQPAAPGDKVVRVLFPGRTPPARLLDGLQRLQHLPCLRRPVVTTHDLE
FT                   APSRANSQDSLASRDSARKEPVRGTVGSIANRSTVRREPALATRDQKKDTRSGPTQPTA
FT                   RDTRRSGPGVVNTKPRVSQNGPRAPVLAAPLTAPVAECPGEAENILESERPPAPSPTLS
FT                   PAQSPPPTAPGNSPERLSLSPLRPEPAPDASPSATTPTLTTPSLPAELGSPHSTEVDES
FT                   LSVSFEQVLPAGDPGLSLPLRLARRSTSPHDVDLCLVSPCEFSHRKPPPPASPGSSDSS
FT                   ARSQERPPETPPTSVSESLPTLSDSDPVPVADSDDDAGSESAARDPPPTPRVPPPLPDV
FT                   PGICMVDPEALPPRARQPLNTTNPSRSRKAPARPSSASATPRAATVAAKTKGPAGDRNR
FT                   PLSARSEPADRPGRVPLTRKPSVPKTVPKMASATRLSSAQVGLEPEMIPLASLPL"
FT   gene            15418580..15419787
FT                   /pseudo
FT                   /locus_tag="mCG_127596"
FT                   /note="gene_id=mCG127596.1"
FT   mRNA            15418580..15419787
FT                   /pseudo
FT                   /locus_tag="mCG_127596"
FT                   /note="gene_id=mCG127596.1 transcript_id=mCT128882.1
FT                   created on 02-JUL-2002"
FT   gene            <15492485..15510649
FT                   /locus_tag="mCG_140641"
FT                   /note="gene_id=mCG140641.0"
FT   mRNA            join(<15492485..15492840,15493933..15493987,
FT                   15509352..15509423,15510461..15510649)
FT                   /locus_tag="mCG_140641"
FT                   /product="mCG140641"
FT                   /note="gene_id=mCG140641.0 transcript_id=mCT170455.0
FT                   created on 02-JUL-2002"
FT   gene            complement(15506756..>15508451)
FT                   /locus_tag="mCG_127591"
FT                   /note="gene_id=mCG127591.1"
FT   mRNA            complement(join(15506756..15507167,15508060..15508120,
FT                   15508325..>15508451))
FT                   /locus_tag="mCG_127591"
FT                   /product="mCG127591"
FT                   /note="gene_id=mCG127591.1 transcript_id=mCT128877.1
FT                   created on 02-JUL-2002"
FT   CDS             complement(15506894..>15507154)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127591"
FT                   /product="mCG127591"
FT                   /note="gene_id=mCG127591.1 transcript_id=mCT128877.1
FT                   protein_id=mCP54024.1"
FT                   /protein_id="EDL28894.1"
FT                   /translation="ERLLEHSKGTESKEIFRQIPNTIVNRKISHRTMLSENHVYKDNML
FT                   ISQSSLTVSVPLQTTMNMSYMERTSINLENVRKPSFIQNAF"
FT   CDS             join(<15509363..15509423,15510461..15510609)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140641"
FT                   /product="mCG140641"
FT                   /note="gene_id=mCG140641.0 transcript_id=mCT170455.0
FT                   protein_id=mCP93373.0"
FT                   /protein_id="EDL28893.1"
FT                   /translation="PAASCSCSLDFSIRKNCILNWFVFLHKTPWPSRKLERKGFIQLKL
FT                   PHCCDSPKEVRIGTHTRQDLGGRS"
FT   gene            <15543593..15549322
FT                   /locus_tag="mCG_68187"
FT                   /note="gene_id=mCG68187.2"
FT   mRNA            join(<15543593..15543840,15545375..15545489,
FT                   15546357..15546530,15547408..15547490,15548409..15548567,
FT                   15549268..15549322)
FT                   /locus_tag="mCG_68187"
FT                   /product="mCG68187"
FT                   /note="gene_id=mCG68187.2 transcript_id=mCT68374.2 created
FT                   on 02-JUL-2002"
FT   CDS             join(<15543761..15543840,15545375..15545489,
FT                   15546357..15546530,15547408..15547490,15548409..15548529)
FT                   /codon_start=1
FT                   /locus_tag="mCG_68187"
FT                   /product="mCG68187"
FT                   /note="gene_id=mCG68187.2 transcript_id=mCT68374.2
FT                   protein_id=mCP43437.2"
FT                   /protein_id="EDL28895.1"
FT                   /translation="LEASVGDLDILIHSSQHHVDESDRKNRTSLHYAFAHNHPDVVTLL
FT                   LENNSSINIRDDEGCTPLIKATQRDNVDCVSVLLTHNADPNLIDSSGNTALHHAISRGN
FT                   IRIVKMLLEHNVDIEAKTEYGLTLLQLATFEQKPEMVEFLAAKCANSSLTPLLVTQSHT
FT                   LSLSLLHFTSEQFGTPCMSTPWHFLSL"
FT   gene            complement(15579223..15869006)
FT                   /locus_tag="mCG_1051063"
FT                   /note="gene_id=mCG1051063.0"
FT   mRNA            complement(join(15579223..15580764,15582840..15583073,
FT                   15584741..15584857,15868977..15869006))
FT                   /locus_tag="mCG_1051063"
FT                   /product="mCG1051063"
FT                   /note="gene_id=mCG1051063.0 transcript_id=mCT194852.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(15579481..15579780)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051063"
FT                   /product="mCG1051063"
FT                   /note="gene_id=mCG1051063.0 transcript_id=mCT194852.0
FT                   protein_id=mCP115881.0"
FT                   /protein_id="EDL28896.1"
FT                   /translation="MCLHYSACVMLVCVFLPILCLSVSLCLCLSLLCVSICVCVCVCVC
FT                   VCVCVCVCVCVYRLEGNFRSWLSSSTELERGSDHFCCSLWSNLSSLSFRAVLFS"
FT   gene            <15582476..15583858
FT                   /locus_tag="mCG_127599"
FT                   /note="gene_id=mCG127599.0"
FT   mRNA            join(<15582476..15582703,15582895..15583170,
FT                   15583744..15583858)
FT                   /locus_tag="mCG_127599"
FT                   /product="mCG127599"
FT                   /note="gene_id=mCG127599.0 transcript_id=mCT128885.0
FT                   created on 02-JUL-2002"
FT   CDS             join(<15582478..15582703,15582895..15583061)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127599"
FT                   /product="mCG127599"
FT                   /note="gene_id=mCG127599.0 transcript_id=mCT128885.0
FT                   protein_id=mCP53946.0"
FT                   /protein_id="EDL28897.1"
FT                   /translation="DIEPTPSQLAPGRGAPADVEPTHSTCAADTRIPAEIEPSPSQCAP
FT                   DSPAPSDIEKIHSPCPSDSSESDEKHDSETGEEPSPFPDLDEDLAENFYDALESADHTG
FT                   YSGSTVQEPGFFWAPDMLLLPVMPLM"
FT   gene            complement(15699778..15721532)
FT                   /gene="2410004L22Rik"
FT                   /locus_tag="mCG_10364"
FT                   /note="gene_id=mCG10364.2"
FT   mRNA            complement(join(15699778..15700613,15702110..15702293,
FT                   15703560..15703701,15704446..15704604,15704686..15704751,
FT                   15705047..15705159,15705498..15705590,15706395..15706464,
FT                   15712124..15712176,15718260..15718318,15721325..15721532))
FT                   /gene="2410004L22Rik"
FT                   /locus_tag="mCG_10364"
FT                   /product="RIKEN cDNA 2410004L22, transcript variant
FT                   mCT10973"
FT                   /note="gene_id=mCG10364.2 transcript_id=mCT10973.2 created
FT                   on 02-JUL-2002"
FT   mRNA            complement(join(15700179..15700613,15702110..15702293,
FT                   15703560..15703701,15704446..15704604,15704686..15704751,
FT                   15705047..15705159,15705498..15705593,15706395..15706464,
FT                   15712124..15712176,15718260..15718318,15721325..15721532))
FT                   /gene="2410004L22Rik"
FT                   /locus_tag="mCG_10364"
FT                   /product="RIKEN cDNA 2410004L22, transcript variant
FT                   mCT170447"
FT                   /note="gene_id=mCG10364.2 transcript_id=mCT170447.0 created
FT                   on 02-JUL-2002"
FT   CDS             complement(join(15700463..15700613,15702110..15702293,
FT                   15703560..15703701,15704446..15704604,15704686..15704751,
FT                   15705047..15705159,15705498..15705590,15706395..15706464,
FT                   15712124..15712176,15718260..15718318,15721325..15721353))
FT                   /codon_start=1
FT                   /gene="2410004L22Rik"
FT                   /locus_tag="mCG_10364"
FT                   /product="RIKEN cDNA 2410004L22, isoform CRA_c"
FT                   /note="gene_id=mCG10364.2 transcript_id=mCT10973.2
FT                   protein_id=mCP11195.2 isoform=CRA_c"
FT                   /protein_id="EDL28900.1"
FT                   /translation="MADSSERDAGKSAAAGACAVPKTKGRRVQGRRVVESRYLQYDKKA
FT                   KKVSGAAKEEKPPEGRKASTVPRSRESQVMGTGNLQSTMLEGHGMNPPDLDLSAIDDKI
FT                   LSRKASWPDREMTDKAKSTSFISCDKKRILRKKRRDLQETMDMMESQTLLMTLLSVKME
FT                   NNLALLEERAEKDLAAMCHEKERLQRQALELRRQLLLRQKHQELAATLDAQIEVLSPLQ
FT                   PVLERFKEEYMTLGRALDTTRHELPMQAVHMEGSGQELLDDLEPALRITLQLLGDLSIC
FT                   SPYATAQVQGASAQEPGASTQLSCLLKELKGLVTEKDLELRRLVSQVVELSSQASKEAA
FT                   LMNQEVWEEAEGALTSSQWYFSPDACRDDSPS"
FT   CDS             complement(join(15700463..15700613,15702110..15702293,
FT                   15703560..15703701,15704446..15704604,15704686..15704751,
FT                   15705047..15705159,15705498..15705593,15706395..15706464,
FT                   15712124..15712176,15718260..15718318,15721325..15721353))
FT                   /codon_start=1
FT                   /gene="2410004L22Rik"
FT                   /locus_tag="mCG_10364"
FT                   /product="RIKEN cDNA 2410004L22, isoform CRA_a"
FT                   /note="gene_id=mCG10364.2 transcript_id=mCT170447.0
FT                   protein_id=mCP93365.0 isoform=CRA_a"
FT                   /protein_id="EDL28898.1"
FT                   /translation="MADSSERDAGKSAAAGACAVPKTKGRRVQGRRVVESRYLQYDKKA
FT                   KKVSGAAKEEKPPEGRKASTVPRSREESQVMGTGNLQSTMLEGHGMNPPDLDLSAIDDK
FT                   ILSRKASWPDREMTDKAKSTSFISCDKKRILRKKRRDLQETMDMMESQTLLMTLLSVKM
FT                   ENNLALLEERAEKDLAAMCHEKERLQRQALELRRQLLLRQKHQELAATLDAQIEVLSPL
FT                   QPVLERFKEEYMTLGRALDTTRHELPMQAVHMEGSGQELLDDLEPALRITLQLLGDLSI
FT                   CSPYATAQVQGASAQEPGASTQLSCLLKELKGLVTEKDLELRRLVSQVVELSSQASKEA
FT                   ALMNQEVWEEAEGALTSSQWYFSPDACRDDSPS"
FT   mRNA            complement(join(<15703579..15703701,15704446..15704604,
FT                   15704686..15704751,15705047..15705159,15705498..15705593,
FT                   15706395..15706464,15712124..15712176,15721325..>15721524))
FT                   /gene="2410004L22Rik"
FT                   /locus_tag="mCG_10364"
FT                   /product="RIKEN cDNA 2410004L22, transcript variant
FT                   mCT192542"
FT                   /note="gene_id=mCG10364.2 transcript_id=mCT192542.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<15703579..15703701,15704446..15704604,
FT                   15704686..15704751,15705047..15705159,15705498..15705593,
FT                   15706395..15706464,15712124..15712176,15721325..>15721484))
FT                   /codon_start=1
FT                   /gene="2410004L22Rik"
FT                   /locus_tag="mCG_10364"
FT                   /product="RIKEN cDNA 2410004L22, isoform CRA_b"
FT                   /note="gene_id=mCG10364.2 transcript_id=mCT192542.0
FT                   protein_id=mCP113495.0 isoform=CRA_b"
FT                   /protein_id="EDL28899.1"
FT                   /translation="TNCSKLGARPAARVKRAPSGFQHYSLPPSGRDPETLAFEWKAGEW
FT                   RIPQNGTQGRRVVESRYLQYDKKAKKVSGAAKEEKPPEGRKASTVPRSREESQVMGTGN
FT                   LQSTMLEGHGMNPPDLDLSAIDDKILSRKASWPDREMTDKAKSTSFISCDKKRILRKKR
FT                   RDLQETMDMMESQTLLMTLLSVKMENNLALLEERAEKDLAAMCHEKERLQRQALELRRQ
FT                   LLLRQKHQELAATLDAQIEVLSPLQPVLERFKEEYMTLGRALDTTRHELPMQAVHMEG"
FT   gene            15721753..15809556
FT                   /gene="Myo9b"
FT                   /locus_tag="mCG_10363"
FT                   /note="gene_id=mCG10363.2"
FT   mRNA            join(15721753..15721869,15739182..15740076,
FT                   15764024..15764118,15770668..15770730,15771819..15771918,
FT                   15772150..15772250,15772749..15772878,15774692..15774781,
FT                   15776719..15776835,15777385..15777519,15779547..15779668,
FT                   15782093..15782234,15782466..15782670,15783155..15783233,
FT                   15787746..15787859,15789599..15789638,15791601..15791723,
FT                   15792452..15792532,15792929..15793039,15794869..15794991,
FT                   15796453..15796769,15797170..15798033,15798974..15799028,
FT                   15799766..15799887,15800726..15800853,15801009..15801184,
FT                   15802581..15802679,15802801..15802974,15803356..15803394,
FT                   15803555..15803666,15804077..15804150,15804534..15804726,
FT                   15804805..15804933,15805124..15805229,15805360..15805491,
FT                   15806952..15807075,15807802..15807936,15808168..15808291,
FT                   15808503..15809556)
FT                   /gene="Myo9b"
FT                   /locus_tag="mCG_10363"
FT                   /product="myosin IXb, transcript variant mCT10972"
FT                   /note="gene_id=mCG10363.2 transcript_id=mCT10972.2 created
FT                   on 15-AUG-2002"
FT   mRNA            join(<15721775..15721869,15739182..15740076,
FT                   15764024..15764118,15770668..15770730,15771819..15771918,
FT                   15772150..15772250,15772749..15772878,15774692..15774781,
FT                   15776719..15776835,15777385..15777519,15779547..15779668,
FT                   15782093..15782234,15782466..15782670,15783155..15783233,
FT                   15787746..15787859,15789599..15789638,15791601..15791723,
FT                   15792452..15792532,15792929..15793039,15794869..15794991,
FT                   15796453..15796769,15797170..15798033,15798974..15799028,
FT                   15799766..15799887,15800726..15800853,15801009..15801184,
FT                   15802581..15802679,15802801..15802974,15803356..15803394,
FT                   15803555..15803666,15804077..15804150,15804534..15804726,
FT                   15804805..15804933,15805124..15805233,15805362..15805491,
FT                   15806952..15807075,15807802..15807938,15808168..15808291,
FT                   15808503..15809556)
FT                   /gene="Myo9b"
FT                   /locus_tag="mCG_10363"
FT                   /product="myosin IXb, transcript variant mCT192540"
FT                   /note="gene_id=mCG10363.2 transcript_id=mCT192540.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<15739219..15740076,15764024..15764118,
FT                   15770668..15770730,15771819..15771918,15772150..15772250,
FT                   15772749..15772878,15774692..15774781,15776719..15776835,
FT                   15777385..15777519,15779547..15779668,15782093..15782234,
FT                   15782466..15782670,15783155..15783233,15787746..15787859,
FT                   15789599..15789638,15791601..15791723,15792452..15792532,
FT                   15792929..15793039,15794869..15794991,15796453..15796769,
FT                   15797170..15798033,15798974..15799028,15799766..15799887,
FT                   15800726..15800853,15801009..15801184,15802581..15802679,
FT                   15802801..15802974,15803356..15803394,15803555..15803666,
FT                   15804077..15804150,15804534..15804726,15804805..15804933,
FT                   15805124..15805233,15805362..15805382)
FT                   /codon_start=1
FT                   /gene="Myo9b"
FT                   /locus_tag="mCG_10363"
FT                   /product="myosin IXb, isoform CRA_b"
FT                   /note="gene_id=mCG10363.2 transcript_id=mCT192540.0
FT                   protein_id=mCP113494.0 isoform=CRA_b"
FT                   /protein_id="EDL28902.1"
FT                   /translation="GQEAGSMSAHEAGSSGRRQQATYHLHIYPQLSSAGSQTSCRVTAT
FT                   KDSTTSDVIQDVVASLHLDGSKHYVLVEVKESGGEEWVLDASDSPVHRVLLWPRRAQDE
FT                   HPQEDGYYFLLQERNADGSIQYLPIQLLAQPTAACRLVERGLLPRPQADFDDLCNLPEL
FT                   TEANLLQNLKLRFMQQKIYTYAGSILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVF
FT                   ALADVAYYAMLRKHVNQCIVISGESGSGKTQSTNFLIHCLTALSQKGYASGVERTILGA
FT                   GPVLEAFGNAKTAHNNNSSRFGKFIQVNYLENGIVRGAVVEKYLLEKSRLVSQEKDERN
FT                   YHVFYYLLLGVSEEERLEFQLKQPQDYFYLNQHNLNIEDGEDLKHDFERLQQAMEMVGF
FT                   LPATKKQIFSVLSAILYLGNVTYKKRATGRDEGLEVGPPEVLDTLSQLLKVKRETLVEV
FT                   LTKRKTVTVNDKLILPYSLSEAITARDSMAKSLYSALFDWIVLRINHALLNKKDMEEAV
FT                   SCLSIGVLDIFGFEDFERNSFEQFCINYANEQLQYYFTQHIFKLEQEEYQGEGISWHNI
FT                   DYTDNVGCIHLISKKPTGLFYLLDEESNFPHATSHTLLAKFKQQHEDNKYFLGTPVLEP
FT                   AFIIQHFAGRVKYQIKDFREKNMDYMRPDIVALLRGSDSSYVRQLIGMDPVAVFRWAVL
FT                   RAAIRAMAVLREAGRLRAERAEKAAGISSPATRSHMEELPRGASTPSEKLYRDLHNQII
FT                   KSLKGLPWQGEDPRRLLQSLSLFQKPRTSFLKSKGIKQKQIIPKNLLDSKSLRLIISMT
FT                   LHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLEALGKAEPFFIRCIRSNAEKKELCFD
FT                   DELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTEQFQVLLPKDVQPCREAIAALLEKL
FT                   QVDRQNYQIGKTKVFLKETERQTLQEKLHGEVLRRILQLQSWFRMVLERKHFVQMKHAA
FT                   LTIQACWRSYRVRRALERTQAAVYLQAAWRGYLQRQAYHHQRHSIIRLQSLCRGHLQRR
FT                   SFSQMVSEKQKAEQAREAAGGKLSEGEPGPVAAGEQLSEHPVEDPESLGVEAETWMNKS
FT                   PDGMSPKKETPSPEMETAAQKTVPAESHEKVSSSREKRESRRQRGLEHVERQNKHIQSC
FT                   REESSTHREPSRRASLEIGESFPEGTKGPREDGLEAWTETTAPSSSKQAQVVGDPPGSP
FT                   SPVQRPTTLALDSRVSPMLPSSSLEVSPVLPSSSLESPKDKDKDESSTKAQDKPESPSG
FT                   STQIQRYQHPDTERLATAVEIWRGKKLASAVLSQSLDLSEKHRATGAALTPTEERRISF
FT                   STSDVSKLSPVKTSAEIDGDFSSKKPSIHKKKSGDPSAGPDAGLSPGSQGDSKSAFKRL
FT                   FLHKAKDKKPSLEGVEETESNGGQAAQETPARKTLDVPSSQQHRHTTGEKPLKGKKNRN
FT                   RKVGQITVSEKWRESVFRKITNANELKFLDEFLLNKVNDLRSQKTPIESLFIEATERFR
FT                   SNIKTMYSVPNGKIHVGYKDLMENYQIVVSNLAAERGEKDTNLVLNVFQSLLDEFTRSY
FT                   NKTDFERAKSKAQKKKRKQERAVQEHNGHVFASYQVNIPQSCEQCLSYIWLMDKALLCS
FT                   VCKMTCHKKCVHKIQSYCSYTGRRKSELGAEPGHFGVCVDSLTSDKASVPIVLEKLLEH
FT                   VEMHGLYTEGLYRKSGAANRTRELRQALQTDPAAVKLEDFPIHAITGVLKQWLRELPEP
FT                   LMTFAQYGDFLRAVELPEKQEQLSAIYAVLDHLPEANHTSLERLIFHLVKQWPCLKM"
FT   CDS             join(15739237..15740076,15764024..15764118,
FT                   15770668..15770730,15771819..15771918,15772150..15772250,
FT                   15772749..15772878,15774692..15774781,15776719..15776835,
FT                   15777385..15777519,15779547..15779668,15782093..15782234,
FT                   15782466..15782670,15783155..15783233,15787746..15787859,
FT                   15789599..15789638,15791601..15791723,15792452..15792532,
FT                   15792929..15793039,15794869..15794991,15796453..15796769,
FT                   15797170..15798033,15798974..15799028,15799766..15799887,
FT                   15800726..15800853,15801009..15801184,15802581..15802679,
FT                   15802801..15802974,15803356..15803394,15803555..15803666,
FT                   15804077..15804150,15804534..15804726,15804805..15804933,
FT                   15805124..15805229,15805360..15805491,15806952..15807075,
FT                   15807802..15807936,15808168..15808291,15808503..15808507)
FT                   /codon_start=1
FT                   /gene="Myo9b"
FT                   /locus_tag="mCG_10363"
FT                   /product="myosin IXb, isoform CRA_a"
FT                   /note="gene_id=mCG10363.2 transcript_id=mCT10972.2
FT                   protein_id=mCP11208.2 isoform=CRA_a"
FT                   /protein_id="EDL28901.1"
FT                   /translation="MSAHEAGSSGRRQQATYHLHIYPQLSSAGSQTSCRVTATKDSTTS
FT                   DVIQDVVASLHLDGSKHYVLVEVKESGGEEWVLDASDSPVHRVLLWPRRAQDEHPQEDG
FT                   YYFLLQERNADGSIQYLPIQLLAQPTAACRLVERGLLPRPQADFDDLCNLPELTEANLL
FT                   QNLKLRFMQQKIYTYAGSILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVA
FT                   YYAMLRKHVNQCIVISGESGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEA
FT                   FGNAKTAHNNNSSRFGKFIQVNYLENGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYY
FT                   LLLGVSEEERLEFQLKQPQDYFYLNQHNLNIEDGEDLKHDFERLQQAMEMVGFLPATKK
FT                   QIFSVLSAILYLGNVTYKKRATGRDEGLEVGPPEVLDTLSQLLKVKRETLVEVLTKRKT
FT                   VTVNDKLILPYSLSEAITARDSMAKSLYSALFDWIVLRINHALLNKKDMEEAVSCLSIG
FT                   VLDIFGFEDFERNSFEQFCINYANEQLQYYFTQHIFKLEQEEYQGEGISWHNIDYTDNV
FT                   GCIHLISKKPTGLFYLLDEESNFPHATSHTLLAKFKQQHEDNKYFLGTPVLEPAFIIQH
FT                   FAGRVKYQIKDFREKNMDYMRPDIVALLRGSDSSYVRQLIGMDPVAVFRWAVLRAAIRA
FT                   MAVLREAGRLRAERAEKAAGISSPATRSHMEELPRGASTPSEKLYRDLHNQIIKSLKGL
FT                   PWQGEDPRRLLQSLSLFQKPRTSFLKSKGIKQKQIIPKNLLDSKSLRLIISMTLHDRTT
FT                   KSLLHLHKKKKPPSISAQFQTSLNKLLEALGKAEPFFIRCIRSNAEKKELCFDDELVLQ
FT                   QLRYTGMLETVRIRRSGYSAKYTFQDFTEQFQVLLPKDVQPCREAIAALLEKLQVDRQN
FT                   YQIGKTKVFLKETERQTLQEKLHGEVLRRILQLQSWFRMVLERKHFVQMKHAALTIQAC
FT                   WRSYRVRRALERTQAAVYLQAAWRGYLQRQAYHHQRHSIIRLQSLCRGHLQRRSFSQMV
FT                   SEKQKAEQAREAAGGKLSEGEPGPVAAGEQLSEHPVEDPESLGVEAETWMNKSPDGMSP
FT                   KKETPSPEMETAAQKTVPAESHEKVSSSREKRESRRQRGLEHVERQNKHIQSCREESST
FT                   HREPSRRASLEIGESFPEGTKGPREDGLEAWTETTAPSSSKQAQVVGDPPGSPSPVQRP
FT                   TTLALDSRVSPMLPSSSLEVSPVLPSSSLESPKDKDKDESSTKAQDKPESPSGSTQIQR
FT                   YQHPDTERLATAVEIWRGKKLASAVLSQSLDLSEKHRATGAALTPTEERRISFSTSDVS
FT                   KLSPVKTSAEIDGDFSSKKPSIHKKKSGDPSAGPDAGLSPGSQGDSKSAFKRLFLHKAK
FT                   DKKPSLEGVEETESNGGQAAQETPARKTLDVPSSQQHRHTTGEKPLKGKKNRNRKVGQI
FT                   TVSEKWRESVFRKITNANELKFLDEFLLNKVNDLRSQKTPIESLFIEATERFRSNIKTM
FT                   YSVPNGKIHVGYKDLMENYQIVVSNLAAERGEKDTNLVLNVFQSLLDEFTRSYNKTDFE
FT                   RAKSKAQKKKRKQERAVQEHNGHVFASYQVNIPQSCEQCLSYIWLMDKALLCSVCKMTC
FT                   HKKCVHKIQSYCSYTGRRKSELGAEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGL
FT                   YTEGLYRKSGAANRTRELRQALQTDPAAVKLEDFPIHAITGVLKQWLRELPEPLMTFAQ
FT                   YGDFLRAVELPEKQEQLSAIYAVLDHLPEANHTSLERLIFHLVKVALLEDVNRMSPGAL
FT                   AIIFAPCLLRCPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKMKMEEINHLEAAESIA
FT                   FRRLSLLRQNAIKSPRTPVVQDLELGALPEEAAGGDEDREKEILMERIQSIKEEKQDIT
FT                   YRLPELDPRGSDEENLDSETSASTESLLEERGVRGAVEE"
FT   gene            15815780..15818578
FT                   /gene="2010315L10Rik"
FT                   /locus_tag="mCG_10380"
FT                   /note="gene_id=mCG10380.2"
FT   mRNA            join(15815780..15815925,15816082..15816216,
FT                   15816491..15816540,15816617..15816695,15816806..15816958,
FT                   15817397..15817409,15817697..15817724,15817979..15818150,
FT                   15818374..15818577)
FT                   /gene="2010315L10Rik"
FT                   /locus_tag="mCG_10380"
FT                   /product="RIKEN cDNA 2010315L10, transcript variant
FT                   mCT10990"
FT                   /note="gene_id=mCG10380.2 transcript_id=mCT10990.1 created
FT                   on 02-JUL-2002"
FT   mRNA            join(<15816071..15816216,15816491..15816695,
FT                   15816806..15816958,15817397..15818150,15818374..15818568)
FT                   /gene="2010315L10Rik"
FT                   /locus_tag="mCG_10380"
FT                   /product="RIKEN cDNA 2010315L10, transcript variant
FT                   mCT170449"
FT                   /note="gene_id=mCG10380.2 transcript_id=mCT170449.0 created
FT                   on 02-JUL-2002"
FT   CDS             join(15816082..15816216,15816491..15816540,
FT                   15816617..15816695,15816806..15816958,15817397..15817409,
FT                   15817697..15817724,15817979..15818150,15818374..15818556)
FT                   /codon_start=1
FT                   /gene="2010315L10Rik"
FT                   /locus_tag="mCG_10380"
FT                   /product="RIKEN cDNA 2010315L10, isoform CRA_b"
FT                   /note="gene_id=mCG10380.2 transcript_id=mCT10990.1
FT                   protein_id=mCP11220.2 isoform=CRA_b"
FT                   /protein_id="EDL28904.1"
FT                   /translation="MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEK
FT                   YVGALEDMLQALKVQASKPASEVISEYSRKVDFLKGMLQAEKLTSSSEKALANQFLAPG
FT                   RVPTTAKERVPATKTVHLQSRARYTSEMRSELLGMEPSGECEVDMRKRAAKGSRPADER
FT                   QSASELDLVLQRHQGLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQN
FT                   LEKLKLESERLEQHAQKSVNWLLWAMLIVVCFVFISMILFIRIMPRLK"
FT   mRNA            join(<15816085..15816216,15816491..15816540,
FT                   15816617..15816695,15818029..15818150,15818374..>15818556)
FT                   /gene="2010315L10Rik"
FT                   /locus_tag="mCG_10380"
FT                   /product="RIKEN cDNA 2010315L10, transcript variant
FT                   mCT170450"
FT                   /note="gene_id=mCG10380.2 transcript_id=mCT170450.0 created
FT                   on 02-JUL-2002"
FT   mRNA            join(<15816379..15816540,15816617..15816695,
FT                   15816806..15816958,15817397..15817409,15817697..15817724,
FT                   15817979..15818150,15818374..15818578)
FT                   /gene="2010315L10Rik"
FT                   /locus_tag="mCG_10380"
FT                   /product="RIKEN cDNA 2010315L10, transcript variant
FT                   mCT170451"
FT                   /note="gene_id=mCG10380.2 transcript_id=mCT170451.0 created
FT                   on 02-JUL-2002"
FT   CDS             join(<15816380..15816540,15816617..15816695,
FT                   15816806..15816958,15817397..15817409,15817697..15817724,
FT                   15817979..15818150,15818374..15818556)
FT                   /codon_start=1
FT                   /gene="2010315L10Rik"
FT                   /locus_tag="mCG_10380"
FT                   /product="RIKEN cDNA 2010315L10, isoform CRA_d"
FT                   /note="gene_id=mCG10380.2 transcript_id=mCT170451.0
FT                   protein_id=mCP93367.0 isoform=CRA_d"
FT                   /protein_id="EDL28906.1"
FT                   /translation="LRLCPLPSLTPLRVPPLSLVCSCLGPLAWLTPYLPSQYVGALEDM
FT                   LQALKVQASKPASEVISEYSRKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTAKE
FT                   RVPATKTVHLQSRARYTSEMRSELLGMEPSGECEVDMRKRAAKGSRPADERQSASELDL
FT                   VLQRHQGLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKLES
FT                   ERLEQHAQKSVNWLLWAMLIVVCFVFISMILFIRIMPRLK"
FT   CDS             join(<15816620..15816695,15818029..15818150,
FT                   15818374..15818556)
FT                   /codon_start=1
FT                   /gene="2010315L10Rik"
FT                   /locus_tag="mCG_10380"
FT                   /product="RIKEN cDNA 2010315L10, isoform CRA_a"
FT                   /note="gene_id=mCG10380.2 transcript_id=mCT170450.0
FT                   protein_id=mCP93369.0 isoform=CRA_a"
FT                   /protein_id="EDL28903.1"
FT                   /translation="TGLRSDQRVLPQSGLSEGHAAGREVDLVLQRHQGLQEKLAEEMLG
FT                   LARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKLESERLEQHAQKSVNWLLWAM
FT                   LIVVCFVFISMILFIRIMPRLK"
FT   CDS             join(<15817869..15818150,15818374..15818556)
FT                   /codon_start=1
FT                   /gene="2010315L10Rik"
FT                   /locus_tag="mCG_10380"
FT                   /product="RIKEN cDNA 2010315L10, isoform CRA_c"
FT                   /note="gene_id=mCG10380.2 transcript_id=mCT170449.0
FT                   protein_id=mCP93368.0 isoform=CRA_c"
FT                   /protein_id="EDL28905.1"
FT                   /translation="VPSRTEGGAMGPGILGKGPHGCLYLSLLGTYKCGVSSAKGSRPAD
FT                   ERQSASELDLVLQRHQGLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMAD
FT                   QNLEKLKLESERLEQHAQKSVNWLLWAMLIVVCFVFISMILFIRIMPRLK"
FT   gene            15821754..15823586
FT                   /gene="9430098E02Rik"
FT                   /locus_tag="mCG_10386"
FT                   /note="gene_id=mCG10386.2"
FT   mRNA            join(15821754..15822413,15822896..15823061,
FT                   15823177..15823230,15823374..15823585)
FT                   /gene="9430098E02Rik"
FT                   /locus_tag="mCG_10386"
FT                   /product="RIKEN cDNA 9430098E02, transcript variant
FT                   mCT10996"
FT                   /note="gene_id=mCG10386.2 transcript_id=mCT10996.1 created
FT                   on 02-JUL-2002"
FT   mRNA            join(<15821788..15822413,15823177..15823230,
FT                   15823374..15823586)
FT                   /gene="9430098E02Rik"
FT                   /locus_tag="mCG_10386"
FT                   /product="RIKEN cDNA 9430098E02, transcript variant
FT                   mCT170454"
FT                   /note="gene_id=mCG10386.2 transcript_id=mCT170454.0 created
FT                   on 02-JUL-2002"
FT   CDS             join(<15822028..15822413,15823177..15823230,
FT                   15823374..15823416)
FT                   /codon_start=1
FT                   /gene="9430098E02Rik"
FT                   /locus_tag="mCG_10386"
FT                   /product="RIKEN cDNA 9430098E02, isoform CRA_a"
FT                   /note="gene_id=mCG10386.2 transcript_id=mCT170454.0
FT                   protein_id=mCP93372.0 isoform=CRA_a"
FT                   /protein_id="EDL28907.1"
FT                   /translation="RRGASSVPLSGIRTLGCAASQPRSRMQIHAGPASRRGRRGPLARL
FT                   SGPEATCNSRPAARGRQRAAAPRMPAPERPRSRRPQSQPGPGELCVRPRKIVFADELRP
FT                   REPLHPEKHPRDLGPRLNPVPDYELRRLAWQLMSGESLRRSEGILASWISRLAVTT"
FT   CDS             join(15822103..15822413,15822896..15823061,
FT                   15823177..15823230,15823374..15823502)
FT                   /codon_start=1
FT                   /gene="9430098E02Rik"
FT                   /locus_tag="mCG_10386"
FT                   /product="RIKEN cDNA 9430098E02, isoform CRA_b"
FT                   /note="gene_id=mCG10386.2 transcript_id=mCT10996.1
FT                   protein_id=mCP11221.1 isoform=CRA_b"
FT                   /db_xref="GOA:G5E815"
FT                   /db_xref="InterPro:IPR010844"
FT                   /db_xref="MGI:MGI:1924340"
FT                   /db_xref="UniProtKB/TrEMBL:G5E815"
FT                   /protein_id="EDL28908.1"
FT                   /translation="MQIHAGPASRRGRRGPLARLSGPEATCNSRPAARGRQRAAAPRMP
FT                   APERPRSRRPQSQPGPGELCVRPRKIVFADELRPREPLHPEKHPRDLGPRLNPVPDYEL
FT                   KYPPVTNRRDRSRYAAVFQDQYGEFSELQREVGATQAKLQQLEALLLSLPPPRSQKEAR
FT                   MAAHVRREFEKKRGDPGFLDKQARCNYLKGKLRHLKAQIRKFDDQQDSNSEDSVYF"
FT   mRNA            join(<15822236..15822440,15823177..15823230,
FT                   15823374..15823581)
FT                   /gene="9430098E02Rik"
FT                   /locus_tag="mCG_10386"
FT                   /product="RIKEN cDNA 9430098E02, transcript variant
FT                   mCT170453"
FT                   /note="gene_id=mCG10386.2 transcript_id=mCT170453.0 created
FT                   on 02-JUL-2002"
FT   CDS             join(<15822435..15822440,15823177..15823230,
FT                   15823374..15823502)
FT                   /codon_start=1
FT                   /gene="9430098E02Rik"
FT                   /locus_tag="mCG_10386"
FT                   /product="RIKEN cDNA 9430098E02, isoform CRA_c"
FT                   /note="gene_id=mCG10386.2 transcript_id=mCT170453.0
FT                   protein_id=mCP93371.0 isoform=CRA_c"
FT                   /protein_id="EDL28909.1"
FT                   /translation="DQKEARMAAHVRREFEKKRGDPGFLDKQARCNYLKGKLRHLKAQI
FT                   RKFDDQQDSNSEDSVYF"
FT   gene            complement(15824254..>15832076)
FT                   /gene="Nr2f6"
FT                   /locus_tag="mCG_10362"
FT                   /note="gene_id=mCG10362.2"
FT   mRNA            complement(join(15824254..15825182,15826177..15826701,
FT                   15828817..15828911,15831419..15832020))
FT                   /gene="Nr2f6"
FT                   /locus_tag="mCG_10362"
FT                   /product="nuclear receptor subfamily 2, group F, member 6,
FT                   transcript variant mCT10971"
FT                   /note="gene_id=mCG10362.2 transcript_id=mCT10971.2 created
FT                   on 02-JUL-2002"
FT   CDS             complement(join(15824911..15825182,15826177..15826701,
FT                   15828817..15828911,15831419..15831699))
FT                   /codon_start=1
FT                   /gene="Nr2f6"
FT                   /locus_tag="mCG_10362"
FT                   /product="nuclear receptor subfamily 2, group F, member 6,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG10362.2 transcript_id=mCT10971.2
FT                   protein_id=mCP11207.1 isoform=CRA_b"
FT                   /db_xref="GOA:P43136"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003068"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="MGI:MGI:1352453"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43136"
FT                   /protein_id="EDL28911.1"
FT                   /translation="MAMVTGGWGDPGGDTNGVDKAGGSYPRATEDDSASPPGATSDAEP
FT                   GDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQH
FT                   HRNQCQYCRLKKCFRVGMRKEAVQRGRIPHALPGPAACSPPGATGVEPFTGPPVSELIA
FT                   QLLRAEPYPAAGRFGGGGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPAADQVALL
FT                   RLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGR
FT                   LQVDAAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRL
FT                   LLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSG"
FT   mRNA            complement(join(<15826180..15826701,15828817..15828955,
FT                   15831419..>15831481))
FT                   /gene="Nr2f6"
FT                   /locus_tag="mCG_10362"
FT                   /product="nuclear receptor subfamily 2, group F, member 6,
FT                   transcript variant mCT170444"
FT                   /note="gene_id=mCG10362.2 transcript_id=mCT170444.0 created
FT                   on 02-JUL-2002"
FT   CDS             complement(join(<15826180..15826701,15828817..15828955,
FT                   15831419..>15831481))
FT                   /codon_start=1
FT                   /gene="Nr2f6"
FT                   /locus_tag="mCG_10362"
FT                   /product="nuclear receptor subfamily 2, group F, member 6,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG10362.2 transcript_id=mCT170444.0
FT                   protein_id=mCP93364.0 isoform=CRA_c"
FT                   /protein_id="EDL28912.1"
FT                   /translation="LRGLQEFLQAQHPPQSQLHLPGFAGTSLGTLACVSRSNRDCQIDQ
FT                   HHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHALPGPAACSPPGATGVEPFTGPPVSELI
FT                   AQLLRAEPYPAAGRFGGGGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPAADQVAL
FT                   LRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLG
FT                   RLQVDAAEYGCLKAIALFT"
FT   mRNA            complement(join(<15826246..15826701,15828817..15828984,
FT                   15831419..>15831605))
FT                   /gene="Nr2f6"
FT                   /locus_tag="mCG_10362"
FT                   /product="nuclear receptor subfamily 2, group F, member 6,
FT                   transcript variant mCT170446"
FT                   /note="gene_id=mCG10362.2 transcript_id=mCT170446.0 created
FT                   on 02-JUL-2002"
FT   CDS             complement(join(<15826246..15826701,15828817..15828984,
FT                   15831419..>15831605))
FT                   /codon_start=1
FT                   /gene="Nr2f6"
FT                   /locus_tag="mCG_10362"
FT                   /product="nuclear receptor subfamily 2, group F, member 6,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG10362.2 transcript_id=mCT170446.0
FT                   protein_id=mCP93362.0 isoform=CRA_a"
FT                   /protein_id="EDL28910.1"
FT                   /translation="IRRHLPGRPATRSRATRSVRGCRWTAWCAGTSPVESITACSPARA
FT                   ARVSSSAASAAISATPAGQGSPTGISQGFAGTSLGTLACVSRSNRDCQIDQHHRNQCQY
FT                   CRLKKCFRVGMRKEAVQRGRIPHALPGPAACSPPGATGVEPFTGPPVSELIAQLLRAEP
FT                   YPAAGRFGGGGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPAADQVALLRLSWSEL
FT                   FVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVD"
FT   mRNA            complement(join(<15826623..15826701,15828813..15828911,
FT                   15831419..>15832076))
FT                   /gene="Nr2f6"
FT                   /locus_tag="mCG_10362"
FT                   /product="nuclear receptor subfamily 2, group F, member 6,
FT                   transcript variant mCT170445"
FT                   /note="gene_id=mCG10362.2 transcript_id=mCT170445.0 created
FT                   on 02-JUL-2002"
FT   CDS             complement(join(<15826623..15826701,15828813..15828911,
FT                   15831419..>15831948))
FT                   /codon_start=1
FT                   /gene="Nr2f6"
FT                   /locus_tag="mCG_10362"
FT                   /product="nuclear receptor subfamily 2, group F, member 6,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG10362.2 transcript_id=mCT170445.0
FT                   protein_id=mCP93363.0 isoform=CRA_d"
FT                   /protein_id="EDL28913.1"
FT                   /translation="RAPVDRGHAWESWPGTGPTSSCLARGPAAGSCRKTFFRGVCDRSP
FT                   PRARAACARGSRVPLGSPGVPRGDGLVPGRTGPAVSGAMAMVTGGWGDPGGDTNGVDKA
FT                   GGSYPRATEDDSASPPGATSDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSF
FT                   FKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEGDRAARPHPACAPR
FT                   SSGLQSPGRDGRRT"
FT   gene            complement(15835736..>15846277)
FT                   /gene="Ushbp1"
FT                   /locus_tag="mCG_10374"
FT                   /note="gene_id=mCG10374.1"
FT   mRNA            complement(join(15835736..15836222,15836345..15836467,
FT                   15836616..15836701,15837779..15838006,15839183..15839432,
FT                   15840448..15840612,15841068..15841208,15841348..15841481,
FT                   15842857..15842982,15844842..15845277,15845517..15845638,
FT                   15845807..15845936,15846181..>15846277))
FT                   /gene="Ushbp1"
FT                   /locus_tag="mCG_10374"
FT                   /product="Usher syndrome 1C binding protein 1"
FT                   /note="gene_id=mCG10374.1 transcript_id=mCT10981.2 created
FT                   on 02-JUL-2002"
FT   CDS             complement(join(15836045..15836222,15836345..15836467,
FT                   15836616..15836701,15837779..15838006,15839183..15839432,
FT                   15840448..15840612,15841068..15841208,15841348..15841481,
FT                   15842857..15842982,15844842..15845277,15845517..15845638,
FT                   15845807..>15845884))
FT                   /codon_start=1
FT                   /gene="Ushbp1"
FT                   /locus_tag="mCG_10374"
FT                   /product="Usher syndrome 1C binding protein 1"
FT                   /note="gene_id=mCG10374.1 transcript_id=mCT10981.2
FT                   protein_id=mCP11222.2"
FT                   /protein_id="EDL28914.1"
FT                   /translation="KQTVVTEAMSARATRPRSRRGRHPLPGELDPVAESSEEVDANNGR
FT                   FETKPELHQEYLGPGLQSPRNWIKEGCDVGSHAVLSLSPEEQCEPEVEAHQVLQEAPLD
FT                   SGPAEISVPSVYETLQCRLSSLEAVVAALRHHSLSFPKSVEAEDRDQGAPGPFGDEKED
FT                   AGPGQQEAARLIERNAWLRLALCNREDELACTQASLQDAQAEKETLQRQVQELEDSLMQ
FT                   MEASPPTPILRAGRRNSNSSTSGAERRPWVPQDSPMAHPFLQRLRSDSSTQSFGCLSTQ
FT                   HPAPETYLMEDQMGQLQGSIEKLKCFNRLLLAVLQGYKGRCESLSIKLAKREAEATALR
FT                   LALQYSEDCEEVYEVLLALKMAGLGTGVGTTKGDLQAAEKEASRLLMKKEATMEVETPQ
FT                   PSSEGSGVDKPTPEELASQLHGYVQHLRERWALVKIPEELGPVTAPKATMPHAEATVQA
FT                   ILEIQPGPTLPHLEKSQIQQDLAATRDRLADLVLRLQLTQREKRGLELREAALRAQGPA
FT                   HQLLLQQLRWERAHFAGDGSSGGSSEDPSSEEEAGEDRQQHYQGPLALLDGQMGKVWDS
FT                   ENVSQELSASLARAIDLRAQLQSLRQQLEQVTQKGRTRRVQSAELSRELCKAHSALALA
FT                   FRGAHRKQEEQRLKLEQQVARLQAQQAEELAVLTATARALGKPGAPQPAQTFL"
FT   gene            15847328..15855057
FT                   /gene="5430437P03Rik"
FT                   /locus_tag="mCG_10366"
FT                   /note="gene_id=mCG10366.1"
FT   mRNA            join(15847328..15847487,15848146..15848492,
FT                   15848855..15848913,15849989..15850109,15850192..15850270,
FT                   15852126..15852150,15853185..15853314,15853415..15853501,
FT                   15854634..15855057)
FT                   /gene="5430437P03Rik"
FT                   /locus_tag="mCG_10366"
FT                   /product="RIKEN cDNA 5430437P03, transcript variant
FT                   mCT10975"
FT                   /note="gene_id=mCG10366.1 transcript_id=mCT10975.2 created
FT                   on 02-JUL-2002"
FT   mRNA            join(<15847351..15847487,15848146..15848364,
FT                   15848855..15848913,15849989..15850109,15850192..15850270,
FT                   15852126..15852150,15853185..15853314,15853415..15853773)
FT                   /gene="5430437P03Rik"
FT                   /locus_tag="mCG_10366"
FT                   /product="RIKEN cDNA 5430437P03, transcript variant
FT                   mCT170448"
FT                   /note="gene_id=mCG10366.1 transcript_id=mCT170448.0 created
FT                   on 02-JUL-2002"
FT   CDS             join(<15847482..15847487,15848146..15848364,
FT                   15848855..15848913,15849989..15850109,15850192..15850270,
FT                   15852126..15852150,15853185..15853314,15853415..15853627)
FT                   /codon_start=1
FT                   /gene="5430437P03Rik"
FT                   /locus_tag="mCG_10366"
FT                   /product="RIKEN cDNA 5430437P03, isoform CRA_b"
FT                   /note="gene_id=mCG10366.1 transcript_id=mCT170448.0
FT                   protein_id=mCP93366.0 isoform=CRA_b"
FT                   /protein_id="EDL28916.1"
FT                   /translation="LQAGSWLPLSPLHLTTREPWRWQRRTAPRRRRKRRKKKERSRYQS
FT                   PGLTLDPIQRGLRTGPWELKPMWAAAARARIICLDLSEEMSVPKLESFNGSRTNALNVS
FT                   QKMVEMFVRTKHKIDKSHEFALVVVNDDSAWLSGLTSDPRELCSCLYDLETASCSTFNL
FT                   EGLFSLIQQKTELPVTENVQTIPPPYVVRTILVYSRPPCQPQFSLTEPMKKMFQCPYFF
FT                   FDIVYIHNGTEEKEEDMSWKVRCHHREWRGHLGTSDLGLPLPAIDPVLQSLTIPYISTL
FT                   SW"
FT   CDS             join(15848196..15848492,15848855..15848913,
FT                   15849989..15850109,15850192..15850270,15852126..15852150,
FT                   15853185..15853314,15853415..15853501,15854634..15854837)
FT                   /codon_start=1
FT                   /gene="5430437P03Rik"
FT                   /locus_tag="mCG_10366"
FT                   /product="RIKEN cDNA 5430437P03, isoform CRA_a"
FT                   /note="gene_id=mCG10366.1 transcript_id=mCT10975.2
FT                   protein_id=mCP11202.2 isoform=CRA_a"
FT                   /protein_id="EDL28915.1"
FT                   /translation="MEVAEANSPTEEEEEEEEEGEEPISEPRPHTRSNPEGAEDRALGA
FT                   QANVGSRSEGEGEAATADGGAASVPGAGPKPWQVPASASEVQIRTPRVNCPEKVIICLD
FT                   LSEEMSVPKLESFNGSRTNALNVSQKMVEMFVRTKHKIDKSHEFALVVVNDDSAWLSGL
FT                   TSDPRELCSCLYDLETASCSTFNLEGLFSLIQQKTELPVTENVQTIPPPYVVRTILVYS
FT                   RPPCQPQFSLTEPMKKMFQCPYFFFDIVYIHNGTEEKEEDMSWKDMFAFMGSLDTKGAS
FT                   YKYEVALAGPALELHNCMAKLLAHPLQRPCQTHASYSLLEEDEEAGEEEATV"
FT   gene            15856451..15860981
FT                   /locus_tag="mCG_10381"
FT                   /note="gene_id=mCG10381.3"
FT   mRNA            join(15856451..15856536,15856626..15856778,
FT                   15857118..15857223,15857301..15857412,15857652..15858188,
FT                   15858310..15858481,15859104..15859263,15859361..15859490,
FT                   15859666..15860100,15860907..15860981)
FT                   /locus_tag="mCG_10381"
FT                   /product="mCG10381, transcript variant mCT10991"
FT                   /note="gene_id=mCG10381.3 transcript_id=mCT10991.3 created
FT                   on 03-JAN-2003"
FT   mRNA            join(15856451..15856531,15858095..15858188,
FT                   15858310..15858481,15859104..15859263,15859361..15859490,
FT                   15859666..15860302)
FT                   /locus_tag="mCG_10381"
FT                   /product="mCG10381, transcript variant mCT170452"
FT                   /note="gene_id=mCG10381.3 transcript_id=mCT170452.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(<15856455..15856536,15856626..15856778,
FT                   15857118..15858188,15858310..15858481,15859104..15859263,
FT                   15859361..15859490,15859666..15860307)
FT                   /locus_tag="mCG_10381"
FT                   /product="mCG10381, transcript variant mCT192544"
FT                   /note="gene_id=mCG10381.3 transcript_id=mCT192544.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(15856457..15856536,15856626..15856778,
FT                   15857118..15857223,15857301..15857412,15857712..15858188,
FT                   15858310..15858481,15859104..15859263,15859361..15859490,
FT                   15859666..15859921)
FT                   /locus_tag="mCG_10381"
FT                   /product="mCG10381, transcript variant mCT178298"
FT                   /note="gene_id=mCG10381.3 transcript_id=mCT178298.0 created
FT                   on 03-JAN-2003"
FT   CDS             join(15856475..15856536,15856626..15856778,
FT                   15857118..15857223,15857301..15857412,15857652..15858188,
FT                   15858310..15858481,15859104..15859263,15859361..15859490,
FT                   15859666..15859838)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10381"
FT                   /product="mCG10381, isoform CRA_a"
FT                   /note="gene_id=mCG10381.3 transcript_id=mCT10991.3
FT                   protein_id=mCP11210.3 isoform=CRA_a"
FT                   /db_xref="GOA:A8VU90"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003887"
FT                   /db_xref="InterPro:IPR011015"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1918775"
FT                   /db_xref="UniProtKB/TrEMBL:A8VU90"
FT                   /protein_id="EDL28917.1"
FT                   /translation="MADTACLALRLLAALREEEARAVEELLRLGADPNLVLDDGAAAVH
FT                   LAARASHPRALHCLRMLLRWGADPNARSAEGLTPVHVAAAWGCCGALELLLSRGGDPTL
FT                   RDQDGLRPLDWALQQRHHNCARVLQELDTPTQPDETREPTETFHVAQGSFETETCQGPA
FT                   LAESSGVSQDSELHVHRAELEVEAVEVAVHPQSSEATENSDYSSDASFVTAVEDSLQPG
FT                   RPGGALELVAGLWVTRGAVSAGKGAPNCQPQVLTLTARDTDKPVLPGDGDLGALHPHSS
FT                   VPPMSDLQLLQALRALGYSPGPVTPFTRGHYLRRLQEAQASRADVGHSQELAEALRTGT
FT                   IPDCQVDEEALAQCFQRLDPLKKWREGITKSSFTYLLLDPRLTKDLPARASSLTLAECL
FT                   QCFVRAIFYVGKGTRARPDAHLWEAFGYHDQPRKQVCPKVRRILDIWASGRGIISLHCF
FT                   QHVVAMEAYTREACLLDALGLQTLTNQKQGHYYGVVAHWPPSRRRRLGVHLLQRALLVF
FT                   LAEGERELRPQDIQARG"
FT   CDS             join(15856475..15856536,15856626..15856778,
FT                   15857118..15857223,15857301..15857412,15857712..15858188,
FT                   15858310..15858481,15859104..15859263,15859361..15859490,
FT                   15859666..15859838)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10381"
FT                   /product="mCG10381, isoform CRA_c"
FT                   /note="gene_id=mCG10381.3 transcript_id=mCT178298.0
FT                   protein_id=mCP101220.0 isoform=CRA_c"
FT                   /db_xref="GOA:G5E8T1"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003887"
FT                   /db_xref="InterPro:IPR011015"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1918775"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8T1"
FT                   /protein_id="EDL28919.1"
FT                   /translation="MADTACLALRLLAALREEEARAVEELLRLGADPNLVLDDGAAAVH
FT                   LAARASHPRALHCLRMLLRWGADPNARSAEGLTPVHVAAAWGCCGALELLLSRGGDPTL
FT                   RDQDGLRPLDWALQQRHHNCARVLQELDTPTQPDETREPTAESSGVSQDSELHVHRAEL
FT                   EVEAVEVAVHPQSSEATENSDYSSDASFVTAVEDSLQPGRPGGALELVAGLWVTRGAVS
FT                   AGKGAPNCQPQVLTLTARDTDKPVLPGDGDLGALHPHSSVPPMSDLQLLQALRALGYSP
FT                   GPVTPFTRGHYLRRLQEAQASRADVGHSQELAEALRTGTIPDCQVDEEALAQCFQRLDP
FT                   LKKWREGITKSSFTYLLLDPRLTKDLPARASSLTLAECLQCFVRAIFYVGKGTRARPDA
FT                   HLWEAFGYHDQPRKQVCPKVRRILDIWASGRGIISLHCFQHVVAMEAYTREACLLDALG
FT                   LQTLTNQKQGHYYGVVAHWPPSRRRRLGVHLLQRALLVFLAEGERELRPQDIQARG"
FT   CDS             join(15856475..15856531,15858095..15858188,
FT                   15858310..15858481,15859104..15859263,15859361..15859490,
FT                   15859666..15859838)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10381"
FT                   /product="mCG10381, isoform CRA_b"
FT                   /note="gene_id=mCG10381.3 transcript_id=mCT170452.0
FT                   protein_id=mCP93370.0 isoform=CRA_b"
FT                   /protein_id="EDL28918.1"
FT                   /translation="MADTACLALRLLAALREEEALRALGYSPGPVTPFTRGHYLRRLQE
FT                   AQASRADVGHSQELAEALRTGTIPDCQVDEEALAQCFQRLDPLKKWREGITKSSFTYLL
FT                   LDPRLTKDLPARASSLTLAECLQCFVRAIFYVGKGTRARPDAHLWEAFGYHDQPRKQVC
FT                   PKVRRILDIWASGRGIISLHCFQHVVAMEAYTREACLLDALGLQTLTNQKQGHYYGVVA
FT                   HWPPSRRRRLGVHLLQRALLVFLAEGERELRPQDIQARG"
FT   CDS             join(<15857522..15858188,15858310..15858481,
FT                   15859104..15859263,15859361..15859490,15859666..15859838)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10381"
FT                   /product="mCG10381, isoform CRA_d"
FT                   /note="gene_id=mCG10381.3 transcript_id=mCT192544.0
FT                   protein_id=mCP113499.0 isoform=CRA_d"
FT                   /protein_id="EDL28920.1"
FT                   /translation="LSCQLPTCQSSRTYIIYHVYIIPVYICVISDYLFIHTFIHLYAET
FT                   FHVAQGSFETETCQGPALAESSGVSQDSELHVHRAELEVEAVEVAVHPQSSEATENSDY
FT                   SSDASFVTAVEDSLQPGRPGGALELVAGLWVTRGAVSAGKGAPNCQPQVLTLTARDTDK
FT                   PVLPGDGDLGALHPHSSVPPMSDLQLLQALRALGYSPGPVTPFTRGHYLRRLQEAQASR
FT                   ADVGHSQELAEALRTGTIPDCQVDEEALAQCFQRLDPLKKWREGITKSSFTYLLLDPRL
FT                   TKDLPARASSLTLAECLQCFVRAIFYVGKGTRARPDAHLWEAFGYHDQPRKQVCPKVRR
FT                   ILDIWASGRGIISLHCFQHVVAMEAYTREACLLDALGLQTLTNQKQGHYYGVVAHWPPS
FT                   RRRRLGVHLLQRALLVFLAEGERELRPQDIQARG"
FT   gene            15899909..15900896
FT                   /pseudo
FT                   /locus_tag="mCG_1049018"
FT                   /note="gene_id=mCG1049018.0"
FT   mRNA            15899909..15900896
FT                   /pseudo
FT                   /locus_tag="mCG_1049018"
FT                   /note="gene_id=mCG1049018.0 transcript_id=mCT166722.1
FT                   created on 09-JUL-2002"
FT   gene            complement(15901696..15908639)
FT                   /gene="Abhd8"
FT                   /locus_tag="mCG_10361"
FT                   /note="gene_id=mCG10361.2"
FT   mRNA            complement(join(15901696..15902351,15903012..15903228,
FT                   15903352..15903522,15906220..15906946,15908441..15908639))
FT                   /gene="Abhd8"
FT                   /locus_tag="mCG_10361"
FT                   /product="abhydrolase domain containing 8"
FT                   /note="gene_id=mCG10361.2 transcript_id=mCT10970.2 created
FT                   on 09-JUL-2002"
FT   CDS             complement(join(15902157..15902351,15903012..15903228,
FT                   15903352..15903522,15906220..15906946,15908441..15908450))
FT                   /codon_start=1
FT                   /gene="Abhd8"
FT                   /locus_tag="mCG_10361"
FT                   /product="abhydrolase domain containing 8"
FT                   /note="gene_id=mCG10361.2 transcript_id=mCT10970.2
FT                   protein_id=mCP11204.2"
FT                   /protein_id="EDL28921.1"
FT                   /translation="MTSEHTMLTGVTDGFFCCLLGTPPNAVRPLESVESSDGYTFVEVK
FT                   PGRVLRVKHAGPAPIPTPPPPPPEDDPGVKTGLVRCQRRITVYRNGRLVVENLGRAPRA
FT                   DLQGRSGSGDPPAALEVELAEPAGGDTRANPGSGRRRRPRRPKRTIHIDCEQRITSCKG
FT                   AQADVVLFFIHGVGGSLAIWKEQLDFFVRLGYEVVAPDLAGHGASSAPQVAAAYTFYAL
FT                   AEDMRAIFTRYAKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEPSLCS
FT                   IFNMPTCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWP
FT                   EGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIEEGSHMVMLECPET
FT                   VNTLLHEFLLWEPEPEAEPKLEPKPKPQLLQPEPAPGEEK"
FT   gene            15909930..15910724
FT                   /gene="Mrpl34"
FT                   /locus_tag="mCG_10365"
FT                   /note="gene_id=mCG10365.1"
FT   mRNA            join(15909930..15910042,15910225..15910724)
FT                   /gene="Mrpl34"
FT                   /locus_tag="mCG_10365"
FT                   /product="mitochondrial ribosomal protein L34"
FT                   /note="gene_id=mCG10365.1 transcript_id=mCT10974.2 created
FT                   on 09-JUL-2002"
FT   CDS             join(15909978..15910042,15910225..15910438)
FT                   /codon_start=1
FT                   /gene="Mrpl34"
FT                   /locus_tag="mCG_10365"
FT                   /product="mitochondrial ribosomal protein L34"
FT                   /note="gene_id=mCG10365.1 transcript_id=mCT10974.2
FT                   protein_id=mCP11200.1"
FT                   /protein_id="EDL28922.1"
FT                   /translation="MAFLARCFGCQACRSVALLSGRYLQSRVWMGLPDSWPLLSLQQAR
FT                   GRARGNEYQPSNIKRKHKHGWVRRLSTPAGVQVILRRMLKGRKSLSH"
FT   gene            15914173..15921408
FT                   /locus_tag="mCG_10377"
FT                   /note="gene_id=mCG10377.1"
FT   mRNA            join(15914173..15914300,15917012..15917092,
FT                   15917170..15917221,15918750..15918811,15919463..15921408)
FT                   /locus_tag="mCG_10377"
FT                   /product="mCG10377, transcript variant mCT10987"
FT                   /note="gene_id=mCG10377.1 transcript_id=mCT10987.2 created
FT                   on 09-JUL-2002"
FT   mRNA            join(<15914186..15914300,15917012..15917092,
FT                   15917170..15917221,15919463..>15919718)
FT                   /locus_tag="mCG_10377"
FT                   /product="mCG10377, transcript variant mCT170531"
FT                   /note="gene_id=mCG10377.1 transcript_id=mCT170531.0 created
FT                   on 09-JUL-2002"
FT   CDS             join(<15914186..15914300,15917012..15917092,
FT                   15917170..15917221,15919463..15919718)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10377"
FT                   /product="mCG10377, isoform CRA_b"
FT                   /note="gene_id=mCG10377.1 transcript_id=mCT170531.0
FT                   protein_id=mCP93450.0 isoform=CRA_b"
FT                   /protein_id="EDL28924.1"
FT                   /translation="GVSCAAAGSGCAAATGKEAAAAAAAAAAAVRVAEDADDGRLSERL
FT                   ARLQQEQLQQVPRGLCVQGLEPPSLSIPADPRVPVRTEMLPRRETKSRWRRRARAQRHL
FT                   ARWPGPTAPTCRRTPRSCASPLICQLCPLPPACVSAARLLHPARALQPHRIHVFIFLEF
FT                   LFML"
FT   mRNA            join(15914229..15914300,15917012..15917092,
FT                   15917170..15917221,15918750..15918816,15919463..15919788)
FT                   /locus_tag="mCG_10377"
FT                   /product="mCG10377, transcript variant mCT170532"
FT                   /note="gene_id=mCG10377.1 transcript_id=mCT170532.0 created
FT                   on 09-JUL-2002"
FT   mRNA            join(<15914284..15914300,15917012..15917092,
FT                   15918750..15918811,15919463..15920658)
FT                   /locus_tag="mCG_10377"
FT                   /product="mCG10377, transcript variant mCT170530"
FT                   /note="gene_id=mCG10377.1 transcript_id=mCT170530.0 created
FT                   on 09-JUL-2002"
FT   CDS             join(15914298..15914300,15917012..15917092,
FT                   15917170..15917221,15918750..15918816,15919463..15919718)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10377"
FT                   /product="mCG10377, isoform CRA_e"
FT                   /note="gene_id=mCG10377.1 transcript_id=mCT170532.0
FT                   protein_id=mCP93447.0 isoform=CRA_e"
FT                   /protein_id="EDL28927.1"
FT                   /translation="MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQ
FT                   IIVTEKTNILLRYLHQQWDKKARMLPRRETKSRWRRRARAQRHLARWPGPTAPTCRRTP
FT                   RSCASPLICQLCPLPPACVSAARLLHPARALQPHRIHVFIFLEFLFML"
FT   CDS             join(15914298..15914300,15917012..15917092,
FT                   15917170..15917221,15918750..15918811,15919463..15919573)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10377"
FT                   /product="mCG10377, isoform CRA_c"
FT                   /note="gene_id=mCG10377.1 transcript_id=mCT10987.2
FT                   protein_id=mCP11201.2 isoform=CRA_c"
FT                   /protein_id="EDL28925.1"
FT                   /translation="MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQ
FT                   IIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVEAEGESSAPPRKVARTDSPDMPEDT"
FT   mRNA            join(<15915384..15915535,15917012..15917092,
FT                   15917170..15917221,15918750..15918811,15919463..15919683)
FT                   /locus_tag="mCG_10377"
FT                   /product="mCG10377, transcript variant mCT170529"
FT                   /note="gene_id=mCG10377.1 transcript_id=mCT170529.0 created
FT                   on 09-JUL-2002"
FT   CDS             join(<15915385..15915535,15917012..15917092,
FT                   15917170..15917221,15918750..15918807)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10377"
FT                   /product="mCG10377, isoform CRA_a"
FT                   /note="gene_id=mCG10377.1 transcript_id=mCT170529.0
FT                   protein_id=mCP93449.0 isoform=CRA_a"
FT                   /protein_id="EDL28923.1"
FT                   /translation="SLLSQDLCISCTSACVASLDLKGPWGSLHLCLEALLAHRRRFCLP
FT                   LEMQTGRLSERLARLQQEQLQQVPRGLCVQGLEPPSLSIPADPRVPVRTDHCDRKDEHT
FT                   SAVPAPAMG"
FT   CDS             join(<15918759..15918811,15919463..15919718)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10377"
FT                   /product="mCG10377, isoform CRA_d"
FT                   /note="gene_id=mCG10377.1 transcript_id=mCT170530.0
FT                   protein_id=mCP93448.0 isoform=CRA_d"
FT                   /protein_id="EDL28926.1"
FT                   /translation="QKRRTYFCGTCTSNGIKRMLPRRETKSRWRRRARAQRHLARWPGP
FT                   TAPTCRRTPRSCASPLICQLCPLPPACVSAARLLHPARALQPHRIHVFIFLEFLFML"
FT   gene            complement(15920281..>15925956)
FT                   /locus_tag="mCG_127590"
FT                   /note="gene_id=mCG127590.1"
FT   mRNA            complement(join(15920281..15921897,15923697..15923807,
FT                   15923903..15924034,15924127..15924318,15925412..>15925956))
FT                   /locus_tag="mCG_127590"
FT                   /product="mCG127590"
FT                   /note="gene_id=mCG127590.1 transcript_id=mCT128876.1
FT                   created on 09-JUL-2002"
FT   CDS             complement(join(15921745..15921897,15923697..15923807,
FT                   15923903..15924034,15924127..15924318,15925412..>15925954))
FT                   /codon_start=1
FT                   /locus_tag="mCG_127590"
FT                   /product="mCG127590"
FT                   /note="gene_id=mCG127590.1 transcript_id=mCT128876.1
FT                   protein_id=mCP54007.1"
FT                   /protein_id="EDL28928.1"
FT                   /translation="EEAAVERRPAGEGGEVPEGPRGGKEEDEEEDDDEDEDEEYEGEEG
FT                   SLLDCGLRLKKVSFAERGAGRRRPGPSPDGLLEEGSPTMVEKGLEPGVFTLAEEDDEPE
FT                   GPPGSPGPEPQTVLLRRARGEGRDQGPDGDRDTETGSGDAAGRQKRHNRSSWIDPPEEE
FT                   HSPQLTQAELESCMKKYEDTFQDYQEMFVQFGYVVLFSSAFPLAALCALVNNLIEIRSD
FT                   AFKLCTGLQRPFGRRVESIGQWQKVMEAMGVLAIVVNCYLIGQCGQLQRLFPWLSPEAA
FT                   IVSVVVLEHLALLVKYLIHVAIPDIPGWVAEEMAKLEYQRREAFKRHERQAQQRFQQQQ
FT                   RRRREEEERQRHAEQQARRERDTGGPRGGARGGAGS"
FT   gene            complement(15933810..15947856)
FT                   /gene="Plvap"
FT                   /locus_tag="mCG_10378"
FT                   /note="gene_id=mCG10378.1"
FT   mRNA            complement(join(15933810..15934448,15942962..15943043,
FT                   15943145..15943202,15943726..15944432,15944589..15944685,
FT                   15947476..15947856))
FT                   /gene="Plvap"
FT                   /locus_tag="mCG_10378"
FT                   /product="plasmalemma vesicle associated protein"
FT                   /note="gene_id=mCG10378.1 transcript_id=mCT10988.1 created
FT                   on 09-JUL-2002"
FT   CDS             complement(join(15934442..15934448,15942962..15943043,
FT                   15943145..15943202,15943726..15944432,15944589..15944685,
FT                   15947476..15947841))
FT                   /codon_start=1
FT                   /gene="Plvap"
FT                   /locus_tag="mCG_10378"
FT                   /product="plasmalemma vesicle associated protein"
FT                   /note="gene_id=mCG10378.1 transcript_id=mCT10988.1
FT                   protein_id=mCP11214.2"
FT                   /db_xref="GOA:G3X924"
FT                   /db_xref="InterPro:IPR009538"
FT                   /db_xref="MGI:MGI:1890497"
FT                   /db_xref="UniProtKB/TrEMBL:G3X924"
FT                   /protein_id="EDL28929.1"
FT                   /translation="MGLSMDRSPYARTGDQQRGCWYYLRYFFLFVSLIQFLIILGLVLF
FT                   MIYGNVHATTESSLRATEIRADSLYSQVVGLSASQANLSKQLNISLLVKETVMQQLLTT
FT                   RREMERINASFRQCQGDLITYINYNRFIAAIILSEKQCQEQLKEVNKTCEALLFKLGEK
FT                   VKTLEMEVAKEKAVCSKDKESLLAGKRQAEEQLEACGKARERQQQEQQVTEENLRKVQS
FT                   LCIPLDQEKFQADVLSAWRDSLIYRTLETLPYHYQLMPEYASLRRTCESLPGIMTTKIE
FT                   ELARGLRAGIERVTRENAELRRQKLELERAAQAAQEARARAGTEAQARETQLRAECARQ
FT                   TQLALEEKAALRAQRDNLERELEARKRELEQLRTEVDVRISALDTCVKAKSLPAVPPRV
FT                   SGPPPNPPPIDPASLEEFKKRILESQRLPVVNPAAQPSG"
FT   gene            complement(<15957862..>15961732)
FT                   /locus_tag="mCG_1048926"
FT                   /note="gene_id=mCG1048926.1"
FT   mRNA            complement(join(<15957862..15957998,15958487..15958583,
FT                   15961406..>15961732))
FT                   /locus_tag="mCG_1048926"
FT                   /product="mCG1048926"
FT                   /note="gene_id=mCG1048926.1 transcript_id=mCT166630.1
FT                   created on 10-JUL-2002"
FT   CDS             complement(join(15957862..15957998,15958487..15958583,
FT                   15961406..15961732))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048926"
FT                   /product="mCG1048926"
FT                   /note="gene_id=mCG1048926.1 transcript_id=mCT166630.1
FT                   protein_id=mCP54005.1"
FT                   /protein_id="EDL28930.1"
FT                   /translation="MAEPGPEPGRAWRLLALCGAAVFLAAAAAGGALVAWNLAASTARS
FT                   PRCPEPEQMNATVRPPDSAPEVEELRRRLAEAEQAQENLVWQLQRAEGDKRELEAALKA
FT                   CKDSQSRLQTQLKALKIEMDQAKVRGTQMGLENGMLTEALVRWEATATESKQQLEEALQ
FT                   RAGAAEAAGEACVSREVALREHM"
FT   gene            15959600..15960347
FT                   /pseudo
FT                   /locus_tag="mCG_49004"
FT                   /note="gene_id=mCG49004.2"
FT   mRNA            15959600..15960347
FT                   /pseudo
FT                   /locus_tag="mCG_49004"
FT                   /note="gene_id=mCG49004.2 transcript_id=mCT49187.2 created
FT                   on 10-JUL-2002"
FT   gene            complement(15970290..>15973469)
FT                   /gene="Bst2"
FT                   /locus_tag="mCG_10370"
FT                   /note="gene_id=mCG10370.1"
FT   mRNA            complement(join(15970290..15970513,15970705..15970825,
FT                   15971819..15971858,15972392..15972467,15973161..>15973469))
FT                   /gene="Bst2"
FT                   /locus_tag="mCG_10370"
FT                   /product="bone marrow stromal cell antigen 2, transcript
FT                   variant mCT10978"
FT                   /note="gene_id=mCG10370.1 transcript_id=mCT10978.1 created
FT                   on 10-JUL-2002"
FT   mRNA            complement(join(15970350..15970513,15970705..15970825,
FT                   15973161..>15973448))
FT                   /gene="Bst2"
FT                   /locus_tag="mCG_10370"
FT                   /product="bone marrow stromal cell antigen 2, transcript
FT                   variant mCT170526"
FT                   /note="gene_id=mCG10370.1 transcript_id=mCT170526.0 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(15970723..15970825,15971819..15971858,
FT                   15972392..15972467,15973161..>15973469))
FT                   /codon_start=1
FT                   /gene="Bst2"
FT                   /locus_tag="mCG_10370"
FT                   /product="bone marrow stromal cell antigen 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG10370.1 transcript_id=mCT10978.1
FT                   protein_id=mCP11216.0 isoform=CRA_b"
FT                   /protein_id="EDL28932.1"
FT                   /translation="TDHMAPSFYHYLPVPMDEMGGKQGWGSHRQWLGAAILVVLFGVTL
FT                   VILTIYFAVTANSVACRDGLRAQAECRNTTHLLQRQLTRTQDSLLQAETQANSCNLTVV
FT                   TLQESLEKKVSQALEQQARIKELENEVTKLNQELENLRIQKETSSTVQVNSGSSMVVSS
FT                   LLVLKVSLFLLF"
FT   CDS             complement(join(15970805..15970825,15973161..>15973448))
FT                   /codon_start=1
FT                   /gene="Bst2"
FT                   /locus_tag="mCG_10370"
FT                   /product="bone marrow stromal cell antigen 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG10370.1 transcript_id=mCT170526.0
FT                   protein_id=mCP93444.0 isoform=CRA_a"
FT                   /protein_id="EDL28931.1"
FT                   /translation="FYHYLPVPMDEMGGKQGWGSHRQWLGAAILVVLFGVTLVILTIYF
FT                   AVTANSVACRDGLRAQAECRNTTHLLQRQLTRTQDSLLQAETQANSCNLTVDPKGDF"
FT   gene            15979599..15984888
FT                   /gene="1110012M11Rik"
FT                   /locus_tag="mCG_10379"
FT                   /note="gene_id=mCG10379.2"
FT   mRNA            join(15979599..15979721,15979797..15979895,
FT                   15980051..15980147,15981888..15982014,15982211..15982330,
FT                   15982414..15982520,15983436..15983497,15984041..15984097,
FT                   15984225..15984888)
FT                   /gene="1110012M11Rik"
FT                   /locus_tag="mCG_10379"
FT                   /product="RIKEN cDNA 1110012M11, transcript variant
FT                   mCT10989"
FT                   /note="gene_id=mCG10379.2 transcript_id=mCT10989.2 created
FT                   on 23-SEP-2002"
FT   mRNA            join(<15979631..15979721,15979797..15979895,
FT                   15980051..15980125,15983483..15983497,15984041..15984097,
FT                   15984225..>15984258)
FT                   /gene="1110012M11Rik"
FT                   /locus_tag="mCG_10379"
FT                   /product="RIKEN cDNA 1110012M11, transcript variant
FT                   mCT170533"
FT                   /note="gene_id=mCG10379.2 transcript_id=mCT170533.1 created
FT                   on 23-SEP-2002"
FT   CDS             join(<15979632..15979721,15979797..15979895,
FT                   15980051..15980125,15983483..15983497,15984041..15984097,
FT                   15984225..>15984258)
FT                   /codon_start=1
FT                   /gene="1110012M11Rik"
FT                   /locus_tag="mCG_10379"
FT                   /product="RIKEN cDNA 1110012M11, isoform CRA_a"
FT                   /note="gene_id=mCG10379.2 transcript_id=mCT170533.1
FT                   protein_id=mCP93451.1 isoform=CRA_a"
FT                   /protein_id="EDL28933.1"
FT                   /translation="GRMDPGTDSAPLAGLVWSSASAPPPPGFSAITCTVEGGTASFGRG
FT                   FAQKAGYFLCLSTLGIPENPQDNVVVDMQIVMDKGPLPSGFSASCGPLNLSAFGDLTIK
FT                   SLADIEKEYNYGFVVEKTA"
FT   CDS             join(15979638..15979721,15979797..15979895,
FT                   15980051..15980147,15981888..15982014,15982211..15982330,
FT                   15982414..15982520,15983436..15983497,15984041..15984097,
FT                   15984225..15984287)
FT                   /codon_start=1
FT                   /gene="1110012M11Rik"
FT                   /locus_tag="mCG_10379"
FT                   /product="RIKEN cDNA 1110012M11, isoform CRA_b"
FT                   /note="gene_id=mCG10379.2 transcript_id=mCT10989.2
FT                   protein_id=mCP11206.1 isoform=CRA_b"
FT                   /protein_id="EDL28934.1"
FT                   /translation="MDPGTDSAPLAGLVWSSASAPPPPGFSAITCTVEGGTASFGRGFA
FT                   QKAGYFLCLSTLGIPENPQDNVVVDMQIVMDKGPLPSGFSAVNDPQDIKASVSKKKRMC
FT                   VKLMPLGTADVVVSDVKLSGKTKTVPGYLRVGDIGGFAIWCKKSKAPRPVPKPRTLSQD
FT                   MRGLSLDPPKEPSKGSHPERTLSRLGSRASTLRRTDSIYEASSLYGISAMDGVPFTLHP
FT                   RFEGKSCGPLNLSAFGDLTIKSLADIEKEYNYGFVVEKTAAARLPPSVS"
FT   gene            complement(15990755..15995433)
FT                   /locus_tag="mCG_10376"
FT                   /note="gene_id=mCG10376.2"
FT   mRNA            complement(join(15990755..15991597,15992213..15992443,
FT                   15994275..15994360,15994945..15995433))
FT                   /locus_tag="mCG_10376"
FT                   /product="mCG10376"
FT                   /note="gene_id=mCG10376.2 transcript_id=mCT10986.2 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(15991542..15991597,15992213..15992443,
FT                   15994275..15994360,15994945..15995264))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10376"
FT                   /product="mCG10376"
FT                   /note="gene_id=mCG10376.2 transcript_id=mCT10986.2
FT                   protein_id=mCP11213.2"
FT                   /protein_id="EDL28935.1"
FT                   /translation="MGRSYGGRVLAAMTLLGIPAAVLVALAAQLLFQLQAGRAELRRVR
FT                   TDGLHPELDPDAGLPEAAAGALLPLATALAALAQVLGLSCLLLAALCGHLGAELARGPG
FT                   PGRSDWFLYDCRLLRHSALGLFCCGVSVYLAALAIYALLLFEIEAGAAAASILGSGALI
FT                   LVAIMTHTLFRAVQATRRGLRELSPPSFEDEPARPSEDSKSGCRAQPPQDEETETPVGA
FT                   VTHQGSHF"
FT   gene            complement(15997023..>15998578)
FT                   /locus_tag="mCG_140651"
FT                   /note="gene_id=mCG140651.0"
FT   mRNA            complement(join(15997023..15997615,15998269..>15998578))
FT                   /locus_tag="mCG_140651"
FT                   /product="mCG140651"
FT                   /note="gene_id=mCG140651.0 transcript_id=mCT170536.0
FT                   created on 10-JUL-2002"
FT   CDS             complement(15997141..>15997368)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140651"
FT                   /product="mCG140651"
FT                   /note="gene_id=mCG140651.0 transcript_id=mCT170536.0
FT                   protein_id=mCP93454.0"
FT                   /protein_id="EDL28936.1"
FT                   /translation="THPKCPSIDQWINTCGMSRVDYCSATNRNEALTQATIPEIEWQQP
FT                   DTKHFTWQEVSPTGTATNGAARALRTVEHD"
FT   gene            <16000001..16001265
FT                   /locus_tag="mCG_1049020"
FT                   /note="gene_id=mCG1049020.0"
FT   mRNA            join(<16000001..16000306,16000944..16001265)
FT                   /locus_tag="mCG_1049020"
FT                   /product="mCG1049020"
FT                   /note="gene_id=mCG1049020.0 transcript_id=mCT166724.0
FT                   created on 10-JUL-2002"
FT   CDS             <16000033..16000254
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049020"
FT                   /product="mCG1049020"
FT                   /note="gene_id=mCG1049020.0 transcript_id=mCT166724.0
FT                   protein_id=mCP54156.0"
FT                   /protein_id="EDL28937.1"
FT                   /translation="SIDLLMDIWDVSTFQPGSATKPGTHISKPGSPAASSEVLSHNAGS
FT                   QANSISRLWNYKADSHATVHILFPKRGE"
FT   gene            complement(16001393..16006736)
FT                   /gene="Txnl6"
FT                   /locus_tag="mCG_10382"
FT                   /note="gene_id=mCG10382.3"
FT   mRNA            complement(join(16001393..16002078,16006367..16006736))
FT                   /gene="Txnl6"
FT                   /locus_tag="mCG_10382"
FT                   /product="thioredoxin-like 6, transcript variant mCT10992"
FT                   /note="gene_id=mCG10382.3 transcript_id=mCT10992.3 created
FT                   on 16-JUN-2003"
FT   CDS             complement(join(16001751..16002078,16006367..16006692))
FT                   /codon_start=1
FT                   /gene="Txnl6"
FT                   /locus_tag="mCG_10382"
FT                   /product="thioredoxin-like 6, isoform CRA_a"
FT                   /note="gene_id=mCG10382.3 transcript_id=mCT10992.3
FT                   protein_id=mCP11197.2 isoform=CRA_a"
FT                   /protein_id="EDL28938.1"
FT                   /translation="MASLFSGRILIRNNSDQDEVETEAELSRRLENRLVLLFFGAGACP
FT                   QCQAFAPVLKDFFVRLTDEFYVLRAAQLALVYVSQDPTEEQQDLFLRDMPEKWLFLPFH
FT                   DELRRDLGRQFSVRQLPAVVVLKPGGDVLTSDATEEIQRLGPACFANWQEAAELLDRSF
FT                   LQPEDLDEPARRSITEPLRRRKYRVDRDVGRERGRNGRDSGDPQGDAGTRAELW"
FT   mRNA            complement(16005568..16006736)
FT                   /gene="Txnl6"
FT                   /locus_tag="mCG_10382"
FT                   /product="thioredoxin-like 6, transcript variant mCT185766"
FT                   /note="gene_id=mCG10382.3 transcript_id=mCT185766.0 created
FT                   on 16-JUN-2003"
FT   CDS             complement(16006363..16006692)
FT                   /codon_start=1
FT                   /gene="Txnl6"
FT                   /locus_tag="mCG_10382"
FT                   /product="thioredoxin-like 6, isoform CRA_b"
FT                   /note="gene_id=mCG10382.3 transcript_id=mCT185766.0
FT                   protein_id=mCP107024.0 isoform=CRA_b"
FT                   /protein_id="EDL28939.1"
FT                   /translation="MASLFSGRILIRNNSDQDEVETEAELSRRLENRLVLLFFGAGACP
FT                   QCQAFAPVLKDFFVRLTDEFYVLRAAQLALVYVSQDPTEEQQDLFLRDMPEKWLFLPFH
FT                   DELRR"
FT   gene            <16008995..16026773
FT                   /gene="Slc27a1"
FT                   /locus_tag="mCG_10371"
FT                   /note="gene_id=mCG10371.4"
FT   mRNA            join(<16008995..16009138,16010836..16011003,
FT                   16019469..16019863,16019972..16020133,16020210..16020279,
FT                   16020675..16020766,16020832..16020941,16024183..16024392,
FT                   16024485..16024611,16024698..16024835,16024907..16025071,
FT                   16025411..16025557,16025967..16026770)
FT                   /gene="Slc27a1"
FT                   /locus_tag="mCG_10371"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 1, transcript variant mCT192541"
FT                   /note="gene_id=mCG10371.4 transcript_id=mCT192541.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(16009023..16009138,16009457..16009547,
FT                   16010836..16011003,16019469..16019863,16019972..16020133,
FT                   16020210..16020279,16020675..16020766,16020832..16020941,
FT                   16024183..16024392,16024485..16024611,16024698..16024835,
FT                   16024907..16025071,16025411..16025557,16025967..16026585)
FT                   /gene="Slc27a1"
FT                   /locus_tag="mCG_10371"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 1, transcript variant mCT10982"
FT                   /note="gene_id=mCG10371.4 transcript_id=mCT10982.1 created
FT                   on 23-SEP-2002"
FT   mRNA            join(16009042..16009138,16009457..16009563,
FT                   16010836..16011003,16019469..16019863,16019972..16020133,
FT                   16020210..16020279,16020675..16020766,16020832..16020941,
FT                   16024183..16024392,16024485..16024611,16024698..16024835,
FT                   16024907..16025071,16025411..16025557,16025967..16026773)
FT                   /gene="Slc27a1"
FT                   /locus_tag="mCG_10371"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 1, transcript variant mCT173571"
FT                   /note="gene_id=mCG10371.4 transcript_id=mCT173571.0 created
FT                   on 23-SEP-2002"
FT   CDS             join(<16009074..16009138,16010836..16011003,
FT                   16019469..16019863,16019972..16020133,16020210..16020279,
FT                   16020675..16020766,16020832..16020941,16024183..16024392,
FT                   16024485..16024611,16024698..16024835,16024907..16025071,
FT                   16025411..16025557,16025967..16026124)
FT                   /codon_start=1
FT                   /gene="Slc27a1"
FT                   /locus_tag="mCG_10371"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 1, isoform CRA_b"
FT                   /note="gene_id=mCG10371.4 transcript_id=mCT192541.0
FT                   protein_id=mCP113498.0 isoform=CRA_b"
FT                   /protein_id="EDL28942.1"
FT                   /translation="AQNFPVQTSVRTCEGAARARDLMRAPGAGTASVASLALLWFLGLP
FT                   WTWSAAAAFCVYVGGGGWRFLRIVCKTARRDLFGLSVLIRVRLELRRHRRAGDTIPCIF
FT                   QAVARRQPERLALVDASSGICWTFAQLDTYSNAVANLFRQLGFAPGDVVAVFLEGRPEF
FT                   VGLWLGLAKAGVVAALLNVNLRREPLAFCLGTSAAKALIYGGEMAAAVAEVSEQLGKSL
FT                   LKFCSGDLGPESILPDTQLLDPMLAEAPTTPLAQAPGKGMDDRLFYIYTSGTTGLPKAA
FT                   IVVHSRYYRIAAFGHHSYSMRAADVLYDCLPLYHSAGNIMGVGQCVIYGLTVVLRKKFS
FT                   ASRFWDDCVKYNCTVVQYIGEICRYLLRQPVRDVEQRHRVRLAVGNGLRPAIWEEFTQR
FT                   FGVPQIGEFYGATECNCSIANMDGKVGSCGFNSRILTHVYPIRLVKVNEDTMEPLRDSE
FT                   GLCIPCQPGEPGLLVGQINQQDPLRRFDGYVSDSATNKKIAHSVFRKGDSAYLSGDVLV
FT                   MDELGYMYFRDRSGDTFRWRGENVSTTEVEAVLSRLLGQTDVAVYGVAVPGVEGKAGMA
FT                   AIADPHSQLDPNSMYQELQKVLASYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQ
FT                   TSDRLFFLDLKQGRYVPLDERVHARICAGDFSL"
FT   mRNA            join(16009121..16009152,16010836..16011003,
FT                   16019469..16019863,16019972..16020133,16020210..16020279,
FT                   16020675..16020766,16020832..16020941,16024183..16024392,
FT                   16024485..16024611,16024698..16024835,16024907..16025071,
FT                   16025411..16025557,16025967..16026770)
FT                   /gene="Slc27a1"
FT                   /locus_tag="mCG_10371"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 1, transcript variant mCT170527"
FT                   /note="gene_id=mCG10371.4 transcript_id=mCT170527.0 created
FT                   on 23-SEP-2002"
FT   CDS             join(16010837..16011003,16019469..16019863,
FT                   16019972..16020133,16020210..16020279,16020675..16020766,
FT                   16020832..16020941,16024183..16024392,16024485..16024611,
FT                   16024698..16024835,16024907..16025071,16025411..16025557,
FT                   16025967..16026124)
FT                   /codon_start=1
FT                   /gene="Slc27a1"
FT                   /locus_tag="mCG_10371"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 1, isoform CRA_a"
FT                   /note="gene_id=mCG10371.4 transcript_id=mCT170527.0
FT                   protein_id=mCP93445.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544D7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="MGI:MGI:1347098"
FT                   /db_xref="UniProtKB/TrEMBL:Q544D7"
FT                   /protein_id="EDL28940.1"
FT                   /translation="MRAPGAGTASVASLALLWFLGLPWTWSAAAAFCVYVGGGGWRFLR
FT                   IVCKTARRDLFGLSVLIRVRLELRRHRRAGDTIPCIFQAVARRQPERLALVDASSGICW
FT                   TFAQLDTYSNAVANLFRQLGFAPGDVVAVFLEGRPEFVGLWLGLAKAGVVAALLNVNLR
FT                   REPLAFCLGTSAAKALIYGGEMAAAVAEVSEQLGKSLLKFCSGDLGPESILPDTQLLDP
FT                   MLAEAPTTPLAQAPGKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGHHSYSMRA
FT                   ADVLYDCLPLYHSAGNIMGVGQCVIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEI
FT                   CRYLLRQPVRDVEQRHRVRLAVGNGLRPAIWEEFTQRFGVPQIGEFYGATECNCSIANM
FT                   DGKVGSCGFNSRILTHVYPIRLVKVNEDTMEPLRDSEGLCIPCQPGEPGLLVGQINQQD
FT                   PLRRFDGYVSDSATNKKIAHSVFRKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGE
FT                   NVSTTEVEAVLSRLLGQTDVAVYGVAVPGVEGKAGMAAIADPHSQLDPNSMYQELQKVL
FT                   ASYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGRYVPLDERV
FT                   HARICAGDFSL"
FT   CDS             join(16010837..16011003,16019469..16019863,
FT                   16019972..16020133,16020210..16020279,16020675..16020766,
FT                   16020832..16020941,16024183..16024392,16024485..16024611,
FT                   16024698..16024835,16024907..16025071,16025411..16025557,
FT                   16025967..16026124)
FT                   /codon_start=1
FT                   /gene="Slc27a1"
FT                   /locus_tag="mCG_10371"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 1, isoform CRA_a"
FT                   /note="gene_id=mCG10371.4 transcript_id=mCT173571.0
FT                   protein_id=mCP96490.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544D7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="MGI:MGI:1347098"
FT                   /db_xref="UniProtKB/TrEMBL:Q544D7"
FT                   /protein_id="EDL28941.1"
FT                   /translation="MRAPGAGTASVASLALLWFLGLPWTWSAAAAFCVYVGGGGWRFLR
FT                   IVCKTARRDLFGLSVLIRVRLELRRHRRAGDTIPCIFQAVARRQPERLALVDASSGICW
FT                   TFAQLDTYSNAVANLFRQLGFAPGDVVAVFLEGRPEFVGLWLGLAKAGVVAALLNVNLR
FT                   REPLAFCLGTSAAKALIYGGEMAAAVAEVSEQLGKSLLKFCSGDLGPESILPDTQLLDP
FT                   MLAEAPTTPLAQAPGKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGHHSYSMRA
FT                   ADVLYDCLPLYHSAGNIMGVGQCVIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEI
FT                   CRYLLRQPVRDVEQRHRVRLAVGNGLRPAIWEEFTQRFGVPQIGEFYGATECNCSIANM
FT                   DGKVGSCGFNSRILTHVYPIRLVKVNEDTMEPLRDSEGLCIPCQPGEPGLLVGQINQQD
FT                   PLRRFDGYVSDSATNKKIAHSVFRKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGE
FT                   NVSTTEVEAVLSRLLGQTDVAVYGVAVPGVEGKAGMAAIADPHSQLDPNSMYQELQKVL
FT                   ASYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGRYVPLDERV
FT                   HARICAGDFSL"
FT   CDS             join(16010837..16011003,16019469..16019863,
FT                   16019972..16020133,16020210..16020279,16020675..16020766,
FT                   16020832..16020941,16024183..16024392,16024485..16024611,
FT                   16024698..16024835,16024907..16025071,16025411..16025557,
FT                   16025967..16026124)
FT                   /codon_start=1
FT                   /gene="Slc27a1"
FT                   /locus_tag="mCG_10371"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 1, isoform CRA_a"
FT                   /note="gene_id=mCG10371.4 transcript_id=mCT10982.1
FT                   protein_id=mCP11199.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q544D7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="MGI:MGI:1347098"
FT                   /db_xref="UniProtKB/TrEMBL:Q544D7"
FT                   /protein_id="EDL28943.1"
FT                   /translation="MRAPGAGTASVASLALLWFLGLPWTWSAAAAFCVYVGGGGWRFLR
FT                   IVCKTARRDLFGLSVLIRVRLELRRHRRAGDTIPCIFQAVARRQPERLALVDASSGICW
FT                   TFAQLDTYSNAVANLFRQLGFAPGDVVAVFLEGRPEFVGLWLGLAKAGVVAALLNVNLR
FT                   REPLAFCLGTSAAKALIYGGEMAAAVAEVSEQLGKSLLKFCSGDLGPESILPDTQLLDP
FT                   MLAEAPTTPLAQAPGKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGHHSYSMRA
FT                   ADVLYDCLPLYHSAGNIMGVGQCVIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEI
FT                   CRYLLRQPVRDVEQRHRVRLAVGNGLRPAIWEEFTQRFGVPQIGEFYGATECNCSIANM
FT                   DGKVGSCGFNSRILTHVYPIRLVKVNEDTMEPLRDSEGLCIPCQPGEPGLLVGQINQQD
FT                   PLRRFDGYVSDSATNKKIAHSVFRKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGE
FT                   NVSTTEVEAVLSRLLGQTDVAVYGVAVPGVEGKAGMAAIADPHSQLDPNSMYQELQKVL
FT                   ASYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGRYVPLDERV
FT                   HARICAGDFSL"
FT   gene            16030975..16036334
FT                   /gene="Pgls"
FT                   /locus_tag="mCG_10369"
FT                   /note="gene_id=mCG10369.2"
FT   mRNA            join(16030975..16032568,16034148..16034255,
FT                   16034733..16034834,16035125..16035265,16036124..16036334)
FT                   /gene="Pgls"
FT                   /locus_tag="mCG_10369"
FT                   /product="6-phosphogluconolactonase, transcript variant
FT                   mCT10977"
FT                   /note="gene_id=mCG10369.2 transcript_id=mCT10977.2 created
FT                   on 10-JUL-2002"
FT   CDS             join(16032281..16032568,16034148..16034255,
FT                   16034733..16034834,16035125..16035265,16036124..16036258)
FT                   /codon_start=1
FT                   /gene="Pgls"
FT                   /locus_tag="mCG_10369"
FT                   /product="6-phosphogluconolactonase, isoform CRA_a"
FT                   /note="gene_id=mCG10369.2 transcript_id=mCT10977.2
FT                   protein_id=mCP11196.2 isoform=CRA_a"
FT                   /protein_id="EDL28944.1"
FT                   /translation="MAAPAPSLISVFSSPQELGASLAQLVAQRAASCLEGDRGRFALGL
FT                   SGGSLVSMLARDLPAAAAPAGPASFARWTLGFCDERLVPFDHAESTYGLYRTHLLSKLP
FT                   IPDSQVLTINPALPVEDAAEDYARKLRQALQGDAVPVFDLLILGVGPDGHTCSLFPDHP
FT                   LLQEREKIVAPISDSPKPPPQRVTLTLPVLNAAQSIIFVATGEGKAAVLKRILEDKEGT
FT                   LPAALVQPRTGALCWFLDEAAARLLSVPFEKHSTL"
FT   mRNA            join(16032399..16032852,16034148..16034255,
FT                   16034733..16034834,16035125..16035265,16036124..16036333)
FT                   /gene="Pgls"
FT                   /locus_tag="mCG_10369"
FT                   /product="6-phosphogluconolactonase, transcript variant
FT                   mCT170525"
FT                   /note="gene_id=mCG10369.2 transcript_id=mCT170525.0 created
FT                   on 10-JUL-2002"
FT   CDS             join(16032814..16032852,16034148..16034255,
FT                   16034733..16034834,16035125..16035265,16036124..16036258)
FT                   /codon_start=1
FT                   /gene="Pgls"
FT                   /locus_tag="mCG_10369"
FT                   /product="6-phosphogluconolactonase, isoform CRA_b"
FT                   /note="gene_id=mCG10369.2 transcript_id=mCT170525.0
FT                   protein_id=mCP93443.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z4X1"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="MGI:MGI:1913421"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z4X1"
FT                   /protein_id="EDL28945.1"
FT                   /translation="MSIQVQPDGPPSPTHLLSKLPIPDSQVLTINPALPVEDAAEDYAR
FT                   KLRQALQGDAVPVFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPKPPPQRVT
FT                   LTLPVLNAAQSIIFVATGEGKAAVLKRILEDKEGTLPAALVQPRTGALCWFLDEAAARL
FT                   LSVPFEKHSTL"
FT   gene            16037833..16048214
FT                   /locus_tag="mCG_145696"
FT                   /note="gene_id=mCG145696.0"
FT   mRNA            join(16037833..16037890,16039144..16039274,
FT                   16040136..16040223,16040452..16040595,16042165..16042332,
FT                   16042439..16042554,16042627..16042731,16042830..16042992,
FT                   16043703..16043893,16043987..16044145,16044804..16044920,
FT                   16044994..16045101,16045673..16045784,16046727..16046810,
FT                   16047575..16048214)
FT                   /locus_tag="mCG_145696"
FT                   /product="mCG145696, transcript variant mCT185234"
FT                   /note="gene_id=mCG145696.0 transcript_id=mCT185234.0
FT                   created on 13-JUN-2003"
FT   CDS             join(16037836..16037890,16039144..16039274,
FT                   16040136..16040223,16040452..16040595,16042165..16042332,
FT                   16042439..16042554,16042627..16042731,16042830..16042992,
FT                   16043703..16043893,16043987..16044145,16044804..16044920,
FT                   16044994..16045101,16045673..16045784,16046727..16046810,
FT                   16047575..16047768)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145696"
FT                   /product="mCG145696, isoform CRA_a"
FT                   /note="gene_id=mCG145696.0 transcript_id=mCT185234.0
FT                   protein_id=mCP106494.0 isoform=CRA_a"
FT                   /protein_id="EDL28946.1"
FT                   /translation="MGAQPSCPLGRRQRQQLQGQVNGMLRTFLPCYRRQLAAAVLRHIS
FT                   QELGPQDPAGCQLSHTKKLPRVREHQGPLTLLQGHPPQWQPTFCVLPSFVSCLWSQNYE
FT                   SGGCPLGFAALTGYTLLTSQREYLCLLDDLCPSSSGDLALEEPLRVLEEPVSFALFLVH
FT                   PFRAHLCFCARSRKAHRAWRLGLQGAIRLRATVLQRSRAPAACAFLDAVLLYRRRRGYA
FT                   GGDDGILGSDAEVLSAELMRELLPGLRAQTLRSLRGAGRARARACAEFLDAVHTAVLAW
FT                   ASSGLRAFQPEKDALLAALERMVRADLEQILQQRALGARRIEAEIQGAVEACLCQKVDP
FT                   QLPQLTLALLSPVEATLRAVRTLLIQGMDRLCHYLRKNPSGTRLCREVYEFGEIPWDPE
FT                   LMQACYREAERNHSHLVQLAKPFDFLGMRSLVFGAQDLAQQLMAAAVTTFLQLADQCLT
FT                   SALDRSQAAEQLGKVRGLVLKKFTSDSETTRWRFTRDCLLRIFWPFVWSQLRLRCNLEL
FT                   PEVDGDILAMGWQVLTTEGVYRDVIQGLLLQRIDRELKKILGASDRACSLADCSVAQWV
FT                   QEGAGNIQMTAVISQRRKLTLSSKREKERERERDLLCRPNAATPYNMASKNSREQSLDP
FT                   PTPILEDSG"
FT   mRNA            join(<16039242..16039274,16040136..16040261,
FT                   16040481..>16040595)
FT                   /locus_tag="mCG_145696"
FT                   /product="mCG145696, transcript variant mCT185236"
FT                   /note="gene_id=mCG145696.0 transcript_id=mCT185236.0
FT                   created on 13-JUN-2003"
FT   CDS             join(<16039242..16039274,16040136..16040261,
FT                   16040481..>16040595)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145696"
FT                   /product="mCG145696, isoform CRA_c"
FT                   /note="gene_id=mCG145696.0 transcript_id=mCT185236.0
FT                   protein_id=mCP106492.0 isoform=CRA_c"
FT                   /protein_id="EDL28948.1"
FT                   /translation="DPAGCQLSHTKKLPRVREHQGPLTLLQGHPPQWQPTFCVLRGDGR
FT                   LEWFSHKENYESGGCPLGFAALTGYTLLTSQREYLCLLDDLCPSSS"
FT   mRNA            join(<16044810..16044920,16044994..16045101,
FT                   16046727..16046810,16047593..16047625)
FT                   /locus_tag="mCG_145696"
FT                   /product="mCG145696, transcript variant mCT185235"
FT                   /note="gene_id=mCG145696.0 transcript_id=mCT185235.0
FT                   created on 13-JUN-2003"
FT   CDS             join(<16044810..16044920,16044994..16045101,
FT                   16046727..16046732)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145696"
FT                   /product="mCG145696, isoform CRA_b"
FT                   /note="gene_id=mCG145696.0 transcript_id=mCT185235.0
FT                   protein_id=mCP106493.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8W2"
FT                   /db_xref="InterPro:IPR026088"
FT                   /db_xref="MGI:MGI:3686743"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8W2"
FT                   /protein_id="EDL28947.1"
FT                   /translation="AAAVTTFLQLADQCLTSALDRSQAAEQLGKVRGLVLKKFTSDSET
FT                   TRWRFTRDCLLRIFWPFVWSQLRLRCNLN"
FT   gene            16051057..16065209
FT                   /gene="Glt25d1"
FT                   /locus_tag="mCG_10387"
FT                   /note="gene_id=mCG10387.2"
FT   mRNA            join(16051057..16051508,16052148..16052258,
FT                   16052974..16053091,16057609..16057743,16058134..16058338,
FT                   16059711..16059830,16060660..16060736,16060807..16060913,
FT                   16061803..16061935,16062742..16062869,16063129..16063335,
FT                   16063532..16065209)
FT                   /gene="Glt25d1"
FT                   /locus_tag="mCG_10387"
FT                   /product="glycosyltransferase 25 domain containing 1,
FT                   transcript variant mCT10997"
FT                   /note="gene_id=mCG10387.2 transcript_id=mCT10997.2 created
FT                   on 23-SEP-2002"
FT   mRNA            join(<16051233..16051508,16052148..16052258,
FT                   16052974..16053091,16057609..16057743,16058134..16058338,
FT                   16059711..16059830,16060660..16060736,16060807..16060913,
FT                   16061803..16061935,16062742..16062869,16063077..16063562)
FT                   /gene="Glt25d1"
FT                   /locus_tag="mCG_10387"
FT                   /product="glycosyltransferase 25 domain containing 1,
FT                   transcript variant mCT192554"
FT                   /note="gene_id=mCG10387.2 transcript_id=mCT192554.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<16051234..16051508,16052148..16052258,
FT                   16052974..16053091,16057609..16057743,16058134..16058338,
FT                   16059711..16059830,16060660..16060736,16060807..16060913,
FT                   16061803..16061935,16062742..16062869,16063077..16063104)
FT                   /codon_start=1
FT                   /gene="Glt25d1"
FT                   /locus_tag="mCG_10387"
FT                   /product="glycosyltransferase 25 domain containing 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG10387.2 transcript_id=mCT192554.0
FT                   protein_id=mCP113500.0 isoform=CRA_b"
FT                   /protein_id="EDL28950.1"
FT                   /translation="KSCLKATRGAMAALPRGSRGLPLLPLLLLLPPLGGPRGADGYFPE
FT                   ERWSPESPLQAPRVLIALLARNAAPALPATLGALEQLRHPRERTALWVATDHNTDNTSA
FT                   ILREWLVAVKGLYHSVEWRPAEEPSSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMW
FT                   ADYILFMDIDNLITNPDTLSLLIAENKTVVAPMLDSRAAYSNFWCGMTSQGYYKRTPAY
FT                   IPIRKRDRRGCFAVPMVHSTFLIDLRKAASRNLAFYPTHPDYTWSFDDIIVFAFSCKQA
FT                   EVQMYVCNKEVYGFLPVPLRAHSSLQDEAESFMHVQLEVMVKHPPVQLSRFISAPRKTS
FT                   DKMGFDEVFMINLKRRRDRRERMLRALHEQEIDCQLVEAVDGKAMNTSQVEAMGIQMLP
FT                   GYRDPYHGRPLTKGELGCFLSHYNIWKEVVDRGLQKSLVFEDDLRFEIFFKRRLMNLMR
FT                   DVEREGLDWDLIILWQVGDM"
FT   CDS             join(16051264..16051508,16052148..16052258,
FT                   16052974..16053091,16057609..16057743,16058134..16058338,
FT                   16059711..16059830,16060660..16060736,16060807..16060913,
FT                   16061803..16061935,16062742..16062869,16063129..16063335,
FT                   16063532..16063799)
FT                   /codon_start=1
FT                   /gene="Glt25d1"
FT                   /locus_tag="mCG_10387"
FT                   /product="glycosyltransferase 25 domain containing 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG10387.2 transcript_id=mCT10997.2
FT                   protein_id=mCP11205.3 isoform=CRA_a"
FT                   /protein_id="EDL28949.1"
FT                   /translation="MAALPRGSRGLPLLPLLLLLPPLGGPRGADGYFPEERWSPESPLQ
FT                   APRVLIALLARNAAPALPATLGALEQLRHPRERTALWVATDHNTDNTSAILREWLVAVK
FT                   GLYHSVEWRPAEEPSSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWADYILFMDID
FT                   NLITNPDTLSLLIAENKTVVAPMLDSRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRRG
FT                   CFAVPMVHSTFLIDLRKAASRNLAFYPTHPDYTWSFDDIIVFAFSCKQAEVQMYVCNKE
FT                   VYGFLPVPLRAHSSLQDEAESFMHVQLEVMVKHPPVQLSRFISAPRKTSDKMGFDEVFM
FT                   INLKRRRDRRERMLRALHEQEIDCQLVEAVDGKAMNTSQVEAMGIQMLPGYRDPYHGRP
FT                   LTKGELGCFLSHYNIWKEVVDRGLQKSLVFEDDLRFEIFFKRRLMNLMRDVEREGLDWD
FT                   LIYVGRKRMQVEHPEKAVPHVRNLVEADYSYWTLAYVISLQGAQKLLAAKPLAKMLPVD
FT                   EFLPVMFDKHPMSEYKSHFSPRNLRAFSVEPLLIYPTHYTGDDGYVSDTETSVVWNNEQ
FT                   VKTDWDRAKSQKMREQQALSREAKNSDVLQSPLDSTARDEL"
FT   gene            complement(16066254..16111961)
FT                   /gene="Unc13a"
FT                   /locus_tag="mCG_10375"
FT                   /note="gene_id=mCG10375.2"
FT   mRNA            complement(join(16066254..16069762,16070555..16070714,
FT                   16070993..16071085,16074556..16074703,16074928..16075008,
FT                   16075209..16075265,16076577..16076606,16077811..16077849,
FT                   16079739..16079862,16081596..16081748,16082093..16082181,
FT                   16082369..16082446,16083332..16083415,16084793..16084936,
FT                   16085113..16085209,16085925..16086051,16086138..16086223,
FT                   16088141..16088274,16089138..16089272,16089788..16089877,
FT                   16090094..16090162,16090767..16090917,16091364..16091527,
FT                   16092193..16092308,16092474..16092643,16092758..16092899,
FT                   16093628..16093855,16095044..16095263,16095373..16095444,
FT                   16095903..16095981,16096495..16096541,16098237..16098339,
FT                   16098490..16098692,16098882..16099035,16100676..16100883,
FT                   16102053..16102085,16102721..16102775,16103080..16103168,
FT                   16103403..16103526,16104399..16104516,16106218..16106317,
FT                   16111864..16111961))
FT                   /gene="Unc13a"
FT                   /locus_tag="mCG_10375"
FT                   /product="unc-13 homolog A (C. elegans)"
FT                   /note="gene_id=mCG10375.2 transcript_id=mCT10985.2 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(16069462..16069762,16070555..16070714,
FT                   16070993..16071085,16074556..16074703,16074928..16075008,
FT                   16075209..16075265,16076577..16076606,16077811..16077849,
FT                   16079739..16079862,16081596..16081748,16082093..16082181,
FT                   16082369..16082446,16083332..16083415,16084793..16084936,
FT                   16085113..16085209,16085925..16086051,16086138..16086223,
FT                   16088141..16088274,16089138..16089272,16089788..16089877,
FT                   16090094..16090162,16090767..16090917,16091364..16091527,
FT                   16092193..16092308,16092474..16092643,16092758..16092899,
FT                   16093628..16093855,16095044..16095263,16095373..16095444,
FT                   16095903..16095981,16096495..16096541,16098237..16098339,
FT                   16098490..16098692,16098882..16099035,16100676..16100883,
FT                   16102053..16102085,16102721..16102775,16103080..16103168,
FT                   16103403..16103526,16104399..16104516,16106218..16106317,
FT                   16111864..16111885))
FT                   /codon_start=1
FT                   /gene="Unc13a"
FT                   /locus_tag="mCG_10375"
FT                   /product="unc-13 homolog A (C. elegans)"
FT                   /note="gene_id=mCG10375.2 transcript_id=mCT10985.2
FT                   protein_id=mCP11212.2"
FT                   /protein_id="EDL28951.1"
FT                   /translation="MSLLCVGEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINR
FT                   LDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQAIMADSEICGTK
FT                   DPTFHRILLDAHFELPLDIPEEEARYWAKKLEQLNAMRDQDEVSHLQYSFQDQQDKPLP
FT                   VPSSQCCNWNYFGWGEQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSV
FT                   RPPPLGSRESYSDSMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEHSL
FT                   QGSELDDERDRDSYHSCHSSQEDTTVAEPKEFKRISFPTAAPQKDDKVSAVPTEAPEVA
FT                   KGIPKAATPEEKAAAERAQEAEPPKSEERSREEEEGQEGQDAMSRAKANWLRAFNKVRM
FT                   QLQEARGEGDMSKSLWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLSLVQSRKAGITSA
FT                   LASSTLNNEELKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQ
FT                   GMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKP
FT                   EIFELIQEIFAVTKSAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSD
FT                   PYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRF
FT                   KRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYH
FT                   VQYTCLHENLFHFVTDVQNNGVVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIY
FT                   QAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFV
FT                   KLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRAS
FT                   QVVKDCVKACLNSTYEYIFNNCHELYGREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLI
FT                   TLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWSLFAQDMKYAMEEHDKHRLCKSA
FT                   DYMNLHFKVKWLYNEYVAELPTFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALER
FT                   DKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVL
FT                   LQYADIVSKDFASYCSKEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKE
FT                   LQVKLNNVLDELSHVFATSFQPHIEECVRQMGDILSQVKGTGNVPASACSSVAQDADNV
FT                   LQPIMDLLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPPLTDQTGTLLRKH
FT                   GKGLEKGRVKLPSHSDGTQMIFNAAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALD
FT                   TIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDLLIKTFVQTQSAQGSGVEDP
FT                   VGEVSVHVELFTHPGTGEQKVTVKVVAANDLKWQTSGIFRPFIEVNIVGPQLSDKKRKF
FT                   ATKSKNNSWAPKYNESFQFSLSADAGPECYELQVCVKDYCFAREDRTVGLAVLQLRELA
FT                   QRGSAACWLPLGRRIHMDDTGLTVLRILSQRSNDEVAKEFVKLKSDTRSAEEGGAAPAP
FT                   "
FT   gene            complement(16115271..16117000)
FT                   /locus_tag="mCG_147971"
FT                   /note="gene_id=mCG147971.0"
FT   mRNA            complement(16115271..16117000)
FT                   /locus_tag="mCG_147971"
FT                   /product="mCG147971"
FT                   /note="gene_id=mCG147971.0 transcript_id=mCT188234.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(16116616..16116984)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147971"
FT                   /product="mCG147971"
FT                   /note="gene_id=mCG147971.0 transcript_id=mCT188234.0
FT                   protein_id=mCP108238.0"
FT                   /db_xref="GOA:Q8C321"
FT                   /db_xref="MGI:MGI:3641937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C321"
FT                   /protein_id="EDL28952.1"
FT                   /translation="MRCLGSAPLPLPRPHTRALNLCPALLPAAVPRQRTAEAATGKSLL
FT                   LPVRPLSFLAAVIYGKSGRPGGGAGREARGRLETCAAGHPSGVGAVQRQKGWGAAGDLS
FT                   LQSTPRLGLLSLHVLGTT"
FT   gene            16116843..16130878
FT                   /locus_tag="mCG_10367"
FT                   /note="gene_id=mCG10367.3"
FT   mRNA            join(16116843..16116905,16118648..16118843,
FT                   16118999..16119122,16119300..16119411,16119524..16119669,
FT                   16119882..16120167,16120758..16120880,16120963..16121120,
FT                   16121206..16121317,16121825..16122011,16122387..16122511,
FT                   16122606..16122737,16123204..16123288,16123636..16123763,
FT                   16124257..16124389,16124521..16124672,16124788..16124938,
FT                   16125470..16125609,16125689..16125878,16126053..16126177,
FT                   16126257..16126429,16127159..16127276,16127543..16127653,
FT                   16128344..16128466,16130476..16130861)
FT                   /locus_tag="mCG_10367"
FT                   /product="mCG10367, transcript variant mCT10979"
FT                   /note="gene_id=mCG10367.3 transcript_id=mCT10979.2 created
FT                   on 25-SEP-2002"
FT   mRNA            join(<16116850..16116905,16118651..16118843,
FT                   16118999..16119122,16119300..16119411,16119524..16119669,
FT                   16119882..16120167,16120758..16120880,16120963..16121120,
FT                   16121206..16121317,16121825..16122011,16122387..16122511,
FT                   16122606..16122737,16123204..16123288,16123636..16123763,
FT                   16124257..16124389,16124521..16124672,16124788..16124938,
FT                   16125470..16125609,16125689..16125878,16126053..16126177,
FT                   16126257..16126429,16127159..16127276,16127543..16127653,
FT                   16128344..16128605)
FT                   /locus_tag="mCG_10367"
FT                   /product="mCG10367, transcript variant mCT192548"
FT                   /note="gene_id=mCG10367.3 transcript_id=mCT192548.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<16116852..16116905,16118651..16118843,
FT                   16118999..16119122,16119300..16119411,16119524..16119669,
FT                   16119882..16120167,16120758..16120880,16120963..16121120,
FT                   16121206..16121317,16121825..16122011,16122387..16122511,
FT                   16122606..16122737,16123204..16123288,16123636..16123763,
FT                   16124257..16124389,16124521..16124672,16124788..16124938,
FT                   16125470..16125609,16125689..16125878,16126053..16126177,
FT                   16126257..16126429,16127159..16127276,16127543..16127653,
FT                   16128344..16128466,16130476..16130878)
FT                   /locus_tag="mCG_10367"
FT                   /product="mCG10367, transcript variant mCT192549"
FT                   /note="gene_id=mCG10367.3 transcript_id=mCT192549.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<16116852..16116905,16118651..16118843,
FT                   16118999..16119122,16119300..16119411,16119524..16119669,
FT                   16119882..16120167,16120758..16120880,16120963..16121120,
FT                   16121206..16121317,16121825..16122011,16122387..16122511,
FT                   16122606..16122737,16123204..16123288,16123636..16123763,
FT                   16124257..16124389,16124521..16124672,16124788..16124938,
FT                   16125470..16125609,16125689..16125878,16126053..16126177,
FT                   16126257..16126429,16127159..16127276,16127543..16127653,
FT                   16128344..16128451)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10367"
FT                   /product="mCG10367, isoform CRA_c"
FT                   /note="gene_id=mCG10367.3 transcript_id=mCT192548.0
FT                   protein_id=mCP113496.0 isoform=CRA_c"
FT                   /protein_id="EDL28955.1"
FT                   /translation="AGTFLSQPRLSFASAQLQVILMAPPSEETPLIPQRSCSLSSSEAG
FT                   ALHVLLPPRGPGPPQRLSFSFGDYLAEDLCVRAAKACGILPVYHSLFALATEDFSCWFP
FT                   PSHIFCIEDVDTQVLVYRLRFYFPDWFGLETCHRFGLRKDLTSAILDLHVLEHLFAQHR
FT                   SDLVSGRLPVGLSMKEQGEFLSLAVLDLAQMAREQAQRPGELLKTVSYKACLPPSLRDV
FT                   IQGQNFVTRRRIRRTVVLALRRVVACQADRYALMAKYILDLERLHPAATTETFRVGLPG
FT                   AQEEPGLLRVAGDNGISWSSGDQELFQTFCDFPEIVDVSIKQAPRVGPAGEHRLVTVTR
FT                   MDGHILEAEFPGLPEALSFVALVDGYFRLICDSRHYFCKEVAPPRLLEEEAELCHGPIT
FT                   LDFAIHKLKAAGSLPGTYILRRSPQDYDSFLLTACVQTPLGPDYKGCLIRQDPSGAFSL
FT                   VGLSQPHRSLRELLAACWNSGLRVDGAALNLTSCCAPRPKEKSNLIVVRRGCTPAPAPG
FT                   CSPSCCALTQLSFHTIPTDSLEWHENLGHGSFTKIFRGRRREVVDGETHDSEVLLKVMD
FT                   SRHRNCMESFLEAASLMSQVSYPHLVLLHGVCMAGDSIMVQEFVYLGAIDMYLRKRGHL
FT                   VSASWKLQVTKQLAYALNYLEDKGLPHGNVSARKVLLAREGGDGNPPFIKLSDPGVSPT
FT                   VLSLEMLTDRIPWVAPECLQEAQTLCLEADKWGFGATTWEVFSGGPAHITSLEPAKKLK
FT                   FYEDQGQLPALKWTELAGLITQCMAYDPGRRPSFRAILRDLNGLITSDYELLSDPTPGI
FT                   PSPRDELCGGAQLYACQDPAIFEERHLKYISLLGKGNFGSVELCRYDPLGDNTGPLVAV
FT                   KQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDF
FT                   LQRHRARLHTDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVKIADFGLAK
FT                   LLPLGKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPS
FT                   AEFLSMMGPEREGPPLCRLLELLAEGRRLPPPPTCPTEVQELMQLCWAPSPHDRPAFGT
FT                   LSPQLDALWRGRPG"
FT   CDS             join(<16116852..16116905,16118651..16118843,
FT                   16118999..16119122,16119300..16119411,16119524..16119669,
FT                   16119882..16120167,16120758..16120880,16120963..16121120,
FT                   16121206..16121317,16121825..16122011,16122387..16122511,
FT                   16122606..16122737,16123204..16123288,16123636..16123763,
FT                   16124257..16124389,16124521..16124672,16124788..16124938,
FT                   16125470..16125609,16125689..16125878,16126053..16126177,
FT                   16126257..16126429,16127159..16127276,16127543..16127653,
FT                   16128344..16128451)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10367"
FT                   /product="mCG10367, isoform CRA_c"
FT                   /note="gene_id=mCG10367.3 transcript_id=mCT192549.0
FT                   protein_id=mCP113497.0 isoform=CRA_c"
FT                   /protein_id="EDL28956.1"
FT                   /translation="AGTFLSQPRLSFASAQLQVILMAPPSEETPLIPQRSCSLSSSEAG
FT                   ALHVLLPPRGPGPPQRLSFSFGDYLAEDLCVRAAKACGILPVYHSLFALATEDFSCWFP
FT                   PSHIFCIEDVDTQVLVYRLRFYFPDWFGLETCHRFGLRKDLTSAILDLHVLEHLFAQHR
FT                   SDLVSGRLPVGLSMKEQGEFLSLAVLDLAQMAREQAQRPGELLKTVSYKACLPPSLRDV
FT                   IQGQNFVTRRRIRRTVVLALRRVVACQADRYALMAKYILDLERLHPAATTETFRVGLPG
FT                   AQEEPGLLRVAGDNGISWSSGDQELFQTFCDFPEIVDVSIKQAPRVGPAGEHRLVTVTR
FT                   MDGHILEAEFPGLPEALSFVALVDGYFRLICDSRHYFCKEVAPPRLLEEEAELCHGPIT
FT                   LDFAIHKLKAAGSLPGTYILRRSPQDYDSFLLTACVQTPLGPDYKGCLIRQDPSGAFSL
FT                   VGLSQPHRSLRELLAACWNSGLRVDGAALNLTSCCAPRPKEKSNLIVVRRGCTPAPAPG
FT                   CSPSCCALTQLSFHTIPTDSLEWHENLGHGSFTKIFRGRRREVVDGETHDSEVLLKVMD
FT                   SRHRNCMESFLEAASLMSQVSYPHLVLLHGVCMAGDSIMVQEFVYLGAIDMYLRKRGHL
FT                   VSASWKLQVTKQLAYALNYLEDKGLPHGNVSARKVLLAREGGDGNPPFIKLSDPGVSPT
FT                   VLSLEMLTDRIPWVAPECLQEAQTLCLEADKWGFGATTWEVFSGGPAHITSLEPAKKLK
FT                   FYEDQGQLPALKWTELAGLITQCMAYDPGRRPSFRAILRDLNGLITSDYELLSDPTPGI
FT                   PSPRDELCGGAQLYACQDPAIFEERHLKYISLLGKGNFGSVELCRYDPLGDNTGPLVAV
FT                   KQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDF
FT                   LQRHRARLHTDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVKIADFGLAK
FT                   LLPLGKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPS
FT                   AEFLSMMGPEREGPPLCRLLELLAEGRRLPPPPTCPTEVQELMQLCWAPSPHDRPAFGT
FT                   LSPQLDALWRGRPG"
FT   mRNA            join(<16118648..16118843,16118999..16119122,
FT                   16119300..16119411,16119524..16119669,16119882..16120167,
FT                   16120758..16120880,16120963..16121120,16121206..16121317,
FT                   16121825..16122011,16122387..16122507,16122606..16122737,
FT                   16123204..16123288,16123636..16123763,16124257..16124389,
FT                   16124521..16124672,16124788..16124938,16125470..16125609,
FT                   16125689..16125878,16126053..16126177,16126257..16126429,
FT                   16127159..16127276,16127543..16127653,16128344..16128466,
FT                   16130476..16130861)
FT                   /locus_tag="mCG_10367"
FT                   /product="mCG10367, transcript variant mCT173570"
FT                   /note="gene_id=mCG10367.3 transcript_id=mCT173570.0 created
FT                   on 25-SEP-2002"
FT   CDS             join(16118660..16118843,16118999..16119122,
FT                   16119300..16119411,16119524..16119669,16119882..16120167,
FT                   16120758..16120880,16120963..16121120,16121206..16121317,
FT                   16121825..16122011,16122387..16122511,16122606..16122737,
FT                   16123204..16123288,16123636..16123763,16124257..16124389,
FT                   16124521..16124672,16124788..16124938,16125470..16125609,
FT                   16125689..16125878,16126053..16126177,16126257..16126429,
FT                   16127159..16127276,16127543..16127653,16128344..16128451)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10367"
FT                   /product="mCG10367, isoform CRA_b"
FT                   /note="gene_id=mCG10367.3 transcript_id=mCT10979.2
FT                   protein_id=mCP11215.2 isoform=CRA_b"
FT                   /protein_id="EDL28954.1"
FT                   /translation="MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSF
FT                   GDYLAEDLCVRAAKACGILPVYHSLFALATEDFSCWFPPSHIFCIEDVDTQVLVYRLRF
FT                   YFPDWFGLETCHRFGLRKDLTSAILDLHVLEHLFAQHRSDLVSGRLPVGLSMKEQGEFL
FT                   SLAVLDLAQMAREQAQRPGELLKTVSYKACLPPSLRDVIQGQNFVTRRRIRRTVVLALR
FT                   RVVACQADRYALMAKYILDLERLHPAATTETFRVGLPGAQEEPGLLRVAGDNGISWSSG
FT                   DQELFQTFCDFPEIVDVSIKQAPRVGPAGEHRLVTVTRMDGHILEAEFPGLPEALSFVA
FT                   LVDGYFRLICDSRHYFCKEVAPPRLLEEEAELCHGPITLDFAIHKLKAAGSLPGTYILR
FT                   RSPQDYDSFLLTACVQTPLGPDYKGCLIRQDPSGAFSLVGLSQPHRSLRELLAACWNSG
FT                   LRVDGAALNLTSCCAPRPKEKSNLIVVRRGCTPAPAPGCSPSCCALTQLSFHTIPTDSL
FT                   EWHENLGHGSFTKIFRGRRREVVDGETHDSEVLLKVMDSRHRNCMESFLEAASLMSQVS
FT                   YPHLVLLHGVCMAGDSIMVQEFVYLGAIDMYLRKRGHLVSASWKLQVTKQLAYALNYLE
FT                   DKGLPHGNVSARKVLLAREGGDGNPPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQE
FT                   AQTLCLEADKWGFGATTWEVFSGGPAHITSLEPAKKLKFYEDQGQLPALKWTELAGLIT
FT                   QCMAYDPGRRPSFRAILRDLNGLITSDYELLSDPTPGIPSPRDELCGGAQLYACQDPAI
FT                   FEERHLKYISLLGKGNFGSVELCRYDPLGDNTGPLVAVKQLQHSGPDQQRDFQREIQIL
FT                   KALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLHTDRLLLFAWQIC
FT                   KGMEYLGARRCVHRDLAARNILVESEAHVKIADFGLAKLLPLGKDYYVVREPGQSPIFW
FT                   YAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLSMMGPEREGPPLCRLLE
FT                   LLAEGRRLPPPPTCPTEVQELMQLCWAPSPHDRPAFGTLSPQLDALWRGRPG"
FT   CDS             join(<16121290..16121317,16121825..16122011,
FT                   16122387..16122507,16122606..16122737,16123204..16123288,
FT                   16123636..16123763,16124257..16124389,16124521..16124672,
FT                   16124788..16124938,16125470..16125609,16125689..16125878,
FT                   16126053..16126177,16126257..16126429,16127159..16127276,
FT                   16127543..16127653,16128344..16128451)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10367"
FT                   /product="mCG10367, isoform CRA_d"
FT                   /note="gene_id=mCG10367.3 transcript_id=mCT173570.0
FT                   protein_id=mCP96489.0 isoform=CRA_d"
FT                   /protein_id="EDL28957.1"
FT                   /translation="QLSSYRLRPDSSWPRLQGLPHPPGPQRGFLPGWPQPAPQKPAGAA
FT                   CSLLEFWAASRRCCPEPNILLRSQTQGKVQFDRGAKGLHPRACPWLLPVLLCADTAELP
FT                   HNSNGQPGHENLGHGSFTKIFRGRRREVVDGETHDSEVLLKVMDSRHRNCMESFLEAAS
FT                   LMSQVSYPHLVLLHGVCMAGDSIMVQEFVYLGAIDMYLRKRGHLVSASWKLQVTKQLAY
FT                   ALNYLEDKGLPHGNVSARKVLLAREGGDGNPPFIKLSDPGVSPTVLSLEMLTDRIPWVA
FT                   PECLQEAQTLCLEADKWGFGATTWEVFSGGPAHITSLEPAKKLKFYEDQGQLPALKWTE
FT                   LAGLITQCMAYDPGRRPSFRAILRDLNGLITSDYELLSDPTPGIPSPRDELCGGAQLYA
FT                   CQDPAIFEERHLKYISLLGKGNFGSVELCRYDPLGDNTGPLVAVKQLQHSGPDQQRDFQ
FT                   REIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLHTDRLLL
FT                   FAWQICKGMEYLGARRCVHRDLAARNILVESEAHVKIADFGLAKLLPLGKDYYVVREPG
FT                   QSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLSMMGPEREGPP
FT                   LCRLLELLAEGRRLPPPPTCPTEVQELMQLCWAPSPHDRPAFGTLSPQLDALWRGRPG"
FT   mRNA            join(<16129562..16129736,16130476..>16130669)
FT                   /locus_tag="mCG_10367"
FT                   /product="mCG10367, transcript variant mCT10976"
FT                   /note="gene_id=mCG10367.3 transcript_id=mCT10976.1 created
FT                   on 25-SEP-2002"
FT   CDS             join(16129562..16129736,16130476..16130669)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10367"
FT                   /product="mCG10367, isoform CRA_a"
FT                   /note="gene_id=mCG10367.3 transcript_id=mCT10976.1
FT                   protein_id=mCP11194.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q5RL10"
FT                   /db_xref="InterPro:IPR016179"
FT                   /db_xref="InterPro:IPR022352"
FT                   /db_xref="InterPro:IPR022353"
FT                   /db_xref="MGI:MGI:108427"
FT                   /db_xref="UniProtKB/TrEMBL:Q5RL10"
FT                   /protein_id="EDL28953.1"
FT                   /translation="MRAPLLLMLLALGSALRSPQPPEARAKLCGHHLVRTLVRVCGGPR
FT                   WSPEATQPVETRDRELLQWLEQRHLLHALVADVDPALDPQLPLQASQRQRRSAATNAVH
FT                   RCCLTGCTQQDLLGLCPH"
FT   gene            complement(16131952..16143718)
FT                   /gene="B3gnt3"
FT                   /locus_tag="mCG_10372"
FT                   /note="gene_id=mCG10372.1"
FT   mRNA            complement(join(16131952..16133459,16133621..16134203,
FT                   16143597..16143718))
FT                   /gene="B3gnt3"
FT                   /locus_tag="mCG_10372"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 3, transcript
FT                   variant mCT10983"
FT                   /note="gene_id=mCG10372.1 transcript_id=mCT10983.1 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(16131953..16133459,16133621..16134203,
FT                   16141914..16141948))
FT                   /gene="B3gnt3"
FT                   /locus_tag="mCG_10372"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 3, transcript
FT                   variant mCT170528"
FT                   /note="gene_id=mCG10372.1 transcript_id=mCT170528.0 created
FT                   on 11-JUL-2002"
FT   CDS             complement(join(16132908..16133459,16133621..16134187))
FT                   /codon_start=1
FT                   /gene="B3gnt3"
FT                   /locus_tag="mCG_10372"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 3, isoform CRA_a"
FT                   /note="gene_id=mCG10372.1 transcript_id=mCT10983.1
FT                   protein_id=mCP11218.2 isoform=CRA_a"
FT                   /protein_id="EDL28958.1"
FT                   /translation="MRLPRQSPYEILLLVLVALLVLLLLLTSKSPPSCSAPERSKEPED
FT                   NPGWATGHPRTHPARCRANLSVSSHPDFAGLPLHVRDFLFYRHCRDFPVLREPRVTKCA
FT                   EPVFLLLAIKSSPANYGRRQMLRTTWARERRVRGAPLRRLFLVGSDRDPQQARKYNRLL
FT                   ELEAQKYGDILQWDFHDSFFNLTLKQVLFLEWQLTYCTNASFVLNGDDDVFAHTDNMVT
FT                   YLQDHDPDQHLFVGHLIQNVGPIRVPWSKYFIPALVMAEDRYPPYCGGGGFLLSRFTVA
FT                   ALRRAARVLPMFPIDDVFLGMCLQQQGLAPGTHSGVRTAGVFPPSPRVSSFDPCFYRDL
FT                   LLVHRFLPFEMLLMWDALNQPQLLCGRQSPAY"
FT   CDS             complement(join(16132908..16133459,16133621..16134187))
FT                   /codon_start=1
FT                   /gene="B3gnt3"
FT                   /locus_tag="mCG_10372"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 3, isoform CRA_a"
FT                   /note="gene_id=mCG10372.1 transcript_id=mCT170528.0
FT                   protein_id=mCP93446.0 isoform=CRA_a"
FT                   /protein_id="EDL28959.1"
FT                   /translation="MRLPRQSPYEILLLVLVALLVLLLLLTSKSPPSCSAPERSKEPED
FT                   NPGWATGHPRTHPARCRANLSVSSHPDFAGLPLHVRDFLFYRHCRDFPVLREPRVTKCA
FT                   EPVFLLLAIKSSPANYGRRQMLRTTWARERRVRGAPLRRLFLVGSDRDPQQARKYNRLL
FT                   ELEAQKYGDILQWDFHDSFFNLTLKQVLFLEWQLTYCTNASFVLNGDDDVFAHTDNMVT
FT                   YLQDHDPDQHLFVGHLIQNVGPIRVPWSKYFIPALVMAEDRYPPYCGGGGFLLSRFTVA
FT                   ALRRAARVLPMFPIDDVFLGMCLQQQGLAPGTHSGVRTAGVFPPSPRVSSFDPCFYRDL
FT                   LLVHRFLPFEMLLMWDALNQPQLLCGRQSPAY"
FT   gene            16135831..16136661
FT                   /pseudo
FT                   /locus_tag="mCG_115433"
FT                   /note="gene_id=mCG115433.0"
FT   mRNA            16135831..16136661
FT                   /pseudo
FT                   /locus_tag="mCG_115433"
FT                   /note="gene_id=mCG115433.0 transcript_id=mCT116537.0
FT                   created on 11-JUL-2002"
FT   gene            complement(16144132..16145151)
FT                   /pseudo
FT                   /locus_tag="mCG_115431"
FT                   /note="gene_id=mCG115431.0"
FT   mRNA            complement(16144132..16145151)
FT                   /pseudo
FT                   /locus_tag="mCG_115431"
FT                   /note="gene_id=mCG115431.0 transcript_id=mCT116535.0
FT                   created on 11-JUL-2002"
FT   gene            complement(16148572..16165834)
FT                   /gene="Fcho1"
FT                   /locus_tag="mCG_10368"
FT                   /note="gene_id=mCG10368.1"
FT   mRNA            complement(join(16148572..16149015,16149110..16149274,
FT                   16149514..16149569,16149759..16149958,16150178..16150310,
FT                   16150523..16150678,16151182..16151290,16151389..16151476,
FT                   16151577..16151683,16152235..16152477,16152654..16152748,
FT                   16153084..16153135,16153485..16153509,16153599..16153785,
FT                   16154139..16154218,16154454..16154478,16154882..16154974,
FT                   16155061..16155109,16155659..16155755,16155867..16155965,
FT                   16156725..16156829,16156940..16157092,16157310..16157451,
FT                   16157604..16157678,16158455..16158546,16161420..16161472,
FT                   16161987..16162027,16165801..16165834))
FT                   /gene="Fcho1"
FT                   /locus_tag="mCG_10368"
FT                   /product="FCH domain only 1"
FT                   /note="gene_id=mCG10368.1 transcript_id=mCT10980.2 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(16148993..16149015,16149110..16149274,
FT                   16149514..16149569,16149759..16149958,16150178..16150310,
FT                   16150523..16150678,16151182..16151290,16151389..16151476,
FT                   16151577..16151683,16152235..16152477,16152654..16152748,
FT                   16153084..16153135,16153485..16153509,16153599..16153785,
FT                   16154139..16154218,16154454..16154478,16154882..16154974,
FT                   16155061..16155109,16155659..16155755,16155867..16155965,
FT                   16156725..16156829,16156940..16157092,16157310..16157451,
FT                   16157604..16157678,16158455..16158546,16161420..16161446))
FT                   /codon_start=1
FT                   /gene="Fcho1"
FT                   /locus_tag="mCG_10368"
FT                   /product="FCH domain only 1"
FT                   /note="gene_id=mCG10368.1 transcript_id=mCT10980.2
FT                   protein_id=mCP11203.2"
FT                   /protein_id="EDL28960.1"
FT                   /translation="MSYFGEHFWGDKNHGFEVLYHCVKQGPVATKELADFIRERANIEE
FT                   TYSKAMAKLSKLASNGTPMGTFAPLWEVFRVSSDKLALCHLELTRKLHDLLKDVLRYGE
FT                   EQLKTHKKCKEEVLGTVDAVQMLSGVGQLLPKSRENYLSRCMDLERLRRENTSQKEMDK
FT                   AETKSKKAADSLRRSVDKYNSARADFEIKMLDSALRFQAMEEAHLQHMKALLGSYAHSV
FT                   EDTHVQIGQVHEEFKQNVENVTVDMLLRKFAESKGTGREKPGPLDFDAYSSAALQEGNY
FT                   PLLSIAMKRLRGAKAFRLPGLSRREPRASVDFLESDSGVPPEVDDEGFTVRPDISQNNI
FT                   LFGDSVNPHGAEPPRFSSSDSDFDDEEPRKFYVHIKPAPTRAVACSSEAAAAQLRATAG
FT                   SLILPPGPGGTMKRHSSRDTSGKPQRPRSAPRTGSCAEKPLASEEPLSKSLFGPPLESA
FT                   FDHDDFTGSSSLGFTSSPSPFSSSSPENVEDSGLDSPSHAAPGPSPESWVPRPGTPQSP
FT                   PTCRAQHPEPRGLMPRAPSPGPWGPEGGADSLTPADPTREGLAATLRRPRSRKVSCPLT
FT                   RSNGDLCRSLSPSPLGSSAPTIPPDRPSFSTQMGHGISRGPSPVVLGSQDALPVATAFT
FT                   EYVHAYFRGHSPSCLARVTGELTMTFPAGIVRVFSGTPPPPVLSFRLVNTAPVEHFQPN
FT                   ADLIFSDPSQSDPETKDFWLNMAALTEALQHQAEQNPTASYYNLVLLRYQFSRPGPESV
FT                   PLQMSAHWQCGPTLTRVSVEYSYRAGATAVSTPLTNVQILLPVGEPVTSVRLQPAATWN
FT                   TEEKRFTWKLPDVCEAGGSGHLSASWQPQSGPSTPSPVAAQFTSEGATLSGLDLELLGG
FT                   GYRMSLVKRRFATGMYLVSC"
FT   gene            <16201726..16202339
FT                   /locus_tag="mCG_1048876"
FT                   /note="gene_id=mCG1048876.1"
FT   mRNA            <16201726..16202339
FT                   /locus_tag="mCG_1048876"
FT                   /product="mCG1048876"
FT                   /note="gene_id=mCG1048876.1 transcript_id=mCT166580.1
FT                   created on 11-JUL-2002"
FT   CDS             <16201728..16202195
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048876"
FT                   /product="mCG1048876"
FT                   /note="gene_id=mCG1048876.1 transcript_id=mCT166580.1
FT                   protein_id=mCP54090.1"
FT                   /protein_id="EDL28961.1"
FT                   /translation="DGLPLTEKISHWRPAFTCLAVLGCFVSLLAMGPCYGATLCALVAN
FT                   GQRYSHALRLTALVLFSAVASFTPSNVLLVLHYSNPSPEAWGNLYGAYVPSLALSTLNS
FT                   CVDPFIYYYVSREFREKVRAMLCRQPEASSSSQASREAGSRGTTICSSTLL"
FT   gene            complement(16212161..16212563)
FT                   /locus_tag="mCG_1049022"
FT                   /note="gene_id=mCG1049022.0"
FT   mRNA            complement(join(16212161..16212304,16212341..16212563))
FT                   /locus_tag="mCG_1049022"
FT                   /product="mCG1049022"
FT                   /note="gene_id=mCG1049022.0 transcript_id=mCT166726.0
FT                   created on 11-JUL-2002"
FT   CDS             complement(join(16212201..16212304,16212341..16212512))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049022"
FT                   /product="mCG1049022"
FT                   /note="gene_id=mCG1049022.0 transcript_id=mCT166726.0
FT                   protein_id=mCP53975.1"
FT                   /protein_id="EDL28962.1"
FT                   /translation="MSILKKWVWEGYKERVWCRCSNSGLAGLWLLGRFSVSFSATNITN
FT                   TWQWASSVGTHMGSRSGQSIVHLYFSKSVKLVLLTVKSILPISGLL"
FT   assembly_gap    2019..2038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3329..3348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5635..5807
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    10687..10820
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    75218..75313
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    96188..102445
FT                   /estimated_length=6258
FT                   /gap_type="unknown"
FT   assembly_gap    103557..106275
FT                   /estimated_length=2719
FT                   /gap_type="unknown"
FT   assembly_gap    112206..112225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    113097..113542
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    119480..119499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    136962..136981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    150226..153213
FT                   /estimated_length=2988
FT                   /gap_type="unknown"
FT   assembly_gap    156891..163914
FT                   /estimated_length=7024
FT                   /gap_type="unknown"
FT   assembly_gap    167168..167187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    175060..175473
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    182931..183078
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    268360..268663
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    322928..322947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    325489..326298
FT                   /estimated_length=810
FT                   /gap_type="unknown"
FT   assembly_gap    327776..332797
FT                   /estimated_length=5022
FT                   /gap_type="unknown"
FT   assembly_gap    333969..334000
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    371940..371980
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    390917..392600
FT                   /estimated_length=1684
FT                   /gap_type="unknown"
FT   assembly_gap    394884..394974
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    423369..427894
FT                   /estimated_length=4526
FT                   /gap_type="unknown"
FT   assembly_gap    429627..431152
FT                   /estimated_length=1526
FT                   /gap_type="unknown"
FT   assembly_gap    456243..456262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    476872..479747
FT                   /estimated_length=2876
FT                   /gap_type="unknown"
FT   assembly_gap    496792..496811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    506533..506552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    597943..597962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    607699..607718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    622093..622112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    631291..631310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    652275..652491
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    685541..685798
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    713341..713360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    717850..718119
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    731086..731489
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    735228..735664
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    757689..763588
FT                   /estimated_length=5900
FT                   /gap_type="unknown"
FT   assembly_gap    772145..772932
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    802399..802622
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    833198..833324
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    846470..846513
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    850901..850920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    853741..853760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    860282..860433
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    897215..897234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    931285..931374
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    932542..932561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    933913..933932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    940061..940097
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    948490..952803
FT                   /estimated_length=4314
FT                   /gap_type="unknown"
FT   assembly_gap    960869..960939
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    986525..986544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1015011..1015030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1016495..1016514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1033350..1033369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1035036..1035055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1036390..1036409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1046025..1046069
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    1062873..1063034
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    1120353..1120400
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    1123574..1124015
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    1199476..1199495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1223793..1223812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1252840..1252979
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    1258791..1259090
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    1262495..1262700
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    1278241..1278837
FT                   /estimated_length=597
FT                   /gap_type="unknown"
FT   assembly_gap    1326525..1342137
FT                   /estimated_length=15613
FT                   /gap_type="unknown"
FT   assembly_gap    1343253..1343272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1407559..1407578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1413297..1413316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1446246..1446265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1492549..1493173
FT                   /estimated_length=625
FT                   /gap_type="unknown"
FT   assembly_gap    1502185..1502262
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    1524854..1525932
FT                   /estimated_length=1079
FT                   /gap_type="unknown"
FT   assembly_gap    1540041..1540063
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    1545245..1545264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1572661..1572798
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    1575646..1575668
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    1595809..1596741
FT                   /estimated_length=933
FT                   /gap_type="unknown"
FT   assembly_gap    1598401..1602167
FT                   /estimated_length=3767
FT                   /gap_type="unknown"
FT   assembly_gap    1604133..1604152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1605335..1605354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1607467..1607486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1608675..1608694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1610879..1615872
FT                   /estimated_length=4994
FT                   /gap_type="unknown"
FT   assembly_gap    1627795..1627934
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    1638600..1638619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1660452..1660648
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    1673332..1673351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1675362..1679895
FT                   /estimated_length=4534
FT                   /gap_type="unknown"
FT   assembly_gap    1699110..1699200
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    1728582..1728701
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    1745593..1745612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1752094..1752116
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    1773237..1773445
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    1780199..1784697
FT                   /estimated_length=4499
FT                   /gap_type="unknown"
FT   assembly_gap    1786808..1786936
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    1792496..1792515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1797636..1797655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1798731..1798750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1807903..1807989
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    1809359..1811347
FT                   /estimated_length=1989
FT                   /gap_type="unknown"
FT   assembly_gap    1828598..1830152
FT                   /estimated_length=1555
FT                   /gap_type="unknown"
FT   assembly_gap    1837509..1837528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1838866..1838885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1840334..1840558
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    1850438..1850457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1885136..1885638
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    1905935..1905954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1921387..1921449
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    1934519..1934538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1940499..1940518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1957399..1961866
FT                   /estimated_length=4468
FT                   /gap_type="unknown"
FT   assembly_gap    1971660..1971684
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    1973184..1974074
FT                   /estimated_length=891
FT                   /gap_type="unknown"
FT   assembly_gap    1980905..1981627
FT                   /estimated_length=723
FT                   /gap_type="unknown"
FT   assembly_gap    2008007..2008142
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    2017402..2017421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2020136..2020451
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    2026589..2026755
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    2067748..2067817
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    2076514..2077576
FT                   /estimated_length=1063
FT                   /gap_type="unknown"
FT   assembly_gap    2100676..2100695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2122820..2122839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2129997..2130043
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    2166040..2166162
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    2195329..2195348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2217842..2218434
FT                   /estimated_length=593
FT                   /gap_type="unknown"
FT   assembly_gap    2220270..2220396
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    2225563..2225662
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    2237060..2237079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2240362..2240381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2249348..2249367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2251569..2251588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2266895..2266926
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    2297823..2297842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2299286..2299660
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    2327004..2327368
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    2376058..2376077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2379279..2379298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2380633..2380652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2386116..2386135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2393891..2393910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2399270..2399289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2424533..2425886
FT                   /estimated_length=1354
FT                   /gap_type="unknown"
FT   assembly_gap    2430466..2430485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2431646..2431665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2433159..2433178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2434334..2434353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2435567..2435586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2444341..2444360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2457259..2457374
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    2493286..2493305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2505231..2505283
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    2514620..2514639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2518723..2519002
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    2522117..2522136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2549055..2550362
FT                   /estimated_length=1308
FT                   /gap_type="unknown"
FT   assembly_gap    2560108..2560378
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    2567982..2568465
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   assembly_gap    2581375..2581460
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    2596362..2596479
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    2609558..2609577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2628910..2628929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2644538..2644557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2657754..2657773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2669225..2669433
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    2674403..2680390
FT                   /estimated_length=5988
FT                   /gap_type="unknown"
FT   assembly_gap    2683327..2683409
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    2685088..2685517
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    2689263..2689282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2699433..2699756
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    2704349..2704368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2707638..2707657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2708796..2708815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2711440..2711459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2712825..2712844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2714086..2714105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2717425..2717444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2719202..2721978
FT                   /estimated_length=2777
FT                   /gap_type="unknown"
FT   assembly_gap    2730370..2730487
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    2731390..2731409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2786307..2786326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2798651..2798700
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    2800552..2800571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2823324..2823343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2841353..2846362
FT                   /estimated_length=5010
FT                   /gap_type="unknown"
FT   assembly_gap    2868577..2868861
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    2871265..2871531
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    2876732..2876846
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    2905711..2905730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2932875..2932894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2944618..2946304
FT                   /estimated_length=1687
FT                   /gap_type="unknown"
FT   assembly_gap    2950535..2950554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3005427..3005446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3008986..3009005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3010742..3010761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3022560..3022614
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    3058827..3058976
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    3065905..3065924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3136694..3137339
FT                   /estimated_length=646
FT                   /gap_type="unknown"
FT   assembly_gap    3163672..3164158
FT                   /estimated_length=487
FT                   /gap_type="unknown"
FT   assembly_gap    3168490..3168509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3193722..3193741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3194967..3194986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3196036..3196055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3197179..3197198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3199359..3199378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3201029..3201048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3246516..3246659
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    3269064..3269083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3304933..3304952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3308536..3308664
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    3321268..3321683
FT                   /estimated_length=416
FT                   /gap_type="unknown"
FT   assembly_gap    3336429..3336448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3336605..3336624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3375407..3375426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3378220..3378239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3396239..3396902
FT                   /estimated_length=664
FT                   /gap_type="unknown"
FT   assembly_gap    3406720..3406739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3446969..3447034
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    3474249..3475517
FT                   /estimated_length=1269
FT                   /gap_type="unknown"
FT   assembly_gap    3477164..3477183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3480948..3481026
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    3509244..3509321
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    3512943..3512962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3519919..3519938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3522038..3522631
FT                   /estimated_length=594
FT                   /gap_type="unknown"
FT   assembly_gap    3525586..3525605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3538261..3538295
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    3591687..3591706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3631821..3632267
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   assembly_gap    3655953..3656024
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    3659117..3659168
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    3674263..3680065
FT                   /estimated_length=5803
FT                   /gap_type="unknown"
FT   assembly_gap    3684995..3688526
FT                   /estimated_length=3532
FT                   /gap_type="unknown"
FT   assembly_gap    3698276..3698295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3711739..3712332
FT                   /estimated_length=594
FT                   /gap_type="unknown"
FT   assembly_gap    3727484..3727503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3785573..3785694
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    3838853..3838872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3839578..3839921
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    3878077..3878096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3884828..3884847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3885678..3886014
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    3888509..3888832
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    3907148..3907259
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    3934238..3934257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3966057..3966213
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    3993215..3993234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3995844..3998880
FT                   /estimated_length=3037
FT                   /gap_type="unknown"
FT   assembly_gap    4000084..4000103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4001807..4001826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4003987..4004006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4005440..4005459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4009779..4009957
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    4011117..4011136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4012423..4012442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4032583..4032635
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    4050597..4050663
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    4054241..4054260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4084652..4085001
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    4086585..4086901
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    4088328..4088893
FT                   /estimated_length=566
FT                   /gap_type="unknown"
FT   assembly_gap    4091754..4091773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4093885..4093932
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    4116302..4116321
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4127441..4127460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4131503..4133956
FT                   /estimated_length=2454
FT                   /gap_type="unknown"
FT   assembly_gap    4159674..4162445
FT                   /estimated_length=2772
FT                   /gap_type="unknown"
FT   assembly_gap    4166764..4166928
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    4168720..4168739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4199096..4199307
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    4207312..4207331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4209614..4216609
FT                   /estimated_length=6996
FT                   /gap_type="unknown"
FT   assembly_gap    4218518..4224890
FT                   /estimated_length=6373
FT                   /gap_type="unknown"
FT   assembly_gap    4240616..4240635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4249726..4253672
FT                   /estimated_length=3947
FT                   /gap_type="unknown"
FT   assembly_gap    4282278..4282297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4290757..4290797
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    4302044..4302489
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    4318713..4318732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4341475..4341494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4343320..4343358
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    4360120..4361823
FT                   /estimated_length=1704
FT                   /gap_type="unknown"
FT   assembly_gap    4364295..4364985
FT                   /estimated_length=691
FT                   /gap_type="unknown"
FT   assembly_gap    4367339..4367358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4371273..4371461
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    4372756..4372775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4382720..4383441
FT                   /estimated_length=722
FT                   /gap_type="unknown"
FT   assembly_gap    4384451..4384470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4388776..4388795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4392142..4394132
FT                   /estimated_length=1991
FT                   /gap_type="unknown"
FT   assembly_gap    4395473..4395492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4409741..4409760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4412191..4412210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4413524..4413543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4417480..4420574
FT                   /estimated_length=3095
FT                   /gap_type="unknown"
FT   assembly_gap    4427577..4427596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4434171..4434190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4459402..4462545
FT                   /estimated_length=3144
FT                   /gap_type="unknown"
FT   assembly_gap    4463631..4463650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4465306..4465325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4466756..4466775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4472092..4472111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4473719..4473738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4494869..4494888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4504577..4504596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4506233..4506252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4507263..4507282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4508393..4508412
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4513390..4520353
FT                   /estimated_length=6964
FT                   /gap_type="unknown"
FT   assembly_gap    4524498..4524620
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    4565877..4566042
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    4575785..4576721
FT                   /estimated_length=937
FT                   /gap_type="unknown"
FT   assembly_gap    4577385..4578071
FT                   /estimated_length=687
FT                   /gap_type="unknown"
FT   assembly_gap    4591038..4591132
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    4600952..4600971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4602039..4602058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4604233..4604252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4606084..4611702
FT                   /estimated_length=5619
FT                   /gap_type="unknown"
FT   assembly_gap    4623923..4623942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4625276..4625295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4631403..4631422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4634557..4640144
FT                   /estimated_length=5588
FT                   /gap_type="unknown"
FT   assembly_gap    4649777..4649796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4678655..4679162
FT                   /estimated_length=508
FT                   /gap_type="unknown"
FT   assembly_gap    4690629..4691035
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    4691780..4692113
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    4719701..4719720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4734790..4735154
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    4754014..4754192
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    4773778..4773797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4788431..4788450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4805744..4805763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4807282..4807301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4825498..4825517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4856855..4856874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4858693..4858968
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    4862837..4862856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4869694..4870579
FT                   /estimated_length=886
FT                   /gap_type="unknown"
FT   assembly_gap    4876621..4877066
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    4881033..4881052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4882337..4882356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4892542..4892782
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    4916871..4919599
FT                   /estimated_length=2729
FT                   /gap_type="unknown"
FT   assembly_gap    4924086..4926295
FT                   /estimated_length=2210
FT                   /gap_type="unknown"
FT   assembly_gap    4934355..4934824
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    4970278..4970595
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    4993042..4993527
FT                   /estimated_length=486
FT                   /gap_type="unknown"
FT   assembly_gap    4995971..4996007
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    5026698..5026848
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    5056943..5057024
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    5098121..5098244
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    5132101..5132120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5133523..5133542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5137279..5137339
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    5146359..5146535
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    5168015..5168034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5169752..5169771
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5214298..5215225
FT                   /estimated_length=928
FT                   /gap_type="unknown"
FT   assembly_gap    5220235..5220412
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    5239655..5239994
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    5241167..5241186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5242325..5242344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5252552..5252571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5253984..5254003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5258199..5258218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5259821..5259840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5266366..5266385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5272127..5272146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5276648..5276667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5306303..5306805
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    5345578..5345597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5346561..5346580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5378904..5379035
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    5402591..5402673
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    5408173..5408192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5497111..5497130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5519169..5519188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5529962..5529981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5548888..5548907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5572238..5572257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5582638..5587402
FT                   /estimated_length=4765
FT                   /gap_type="unknown"
FT   assembly_gap    5592814..5592833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5642892..5643154
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    5645917..5645936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5670343..5670460
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    5706016..5706226
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    5714051..5714070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5724134..5724660
FT                   /estimated_length=527
FT                   /gap_type="unknown"
FT   assembly_gap    5731846..5732018
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    5733866..5733931
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    5755059..5755742
FT                   /estimated_length=684
FT                   /gap_type="unknown"
FT   assembly_gap    5759498..5759517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5768140..5768326
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    5783203..5783500
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    5801383..5801741
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    5803681..5803870
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    5806085..5806153
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    5808716..5808735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5821723..5822094
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    5825492..5825511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5831141..5831160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5891838..5891876
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    5897636..5897953
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    5908310..5908329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5922098..5922117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5941289..5941578
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    5942581..5942709
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    5960344..5960363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5961739..5962310
FT                   /estimated_length=572
FT                   /gap_type="unknown"
FT   assembly_gap    5969093..5969221
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    5980517..5980536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6005298..6005317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6010045..6010064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6013304..6013323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6016024..6016043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6086169..6086376
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    6102608..6102627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6110282..6110494
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    6116248..6116382
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    6149773..6149792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6156727..6157871
FT                   /estimated_length=1145
FT                   /gap_type="unknown"
FT   assembly_gap    6161431..6161670
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    6190630..6190653
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    6228657..6228676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6242206..6242250
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    6246719..6246738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6267343..6267362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6276487..6276506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6292618..6292637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6333946..6333965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6352349..6352368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6384131..6384200
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    6429448..6429467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6432109..6432128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6446018..6446037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6450323..6450746
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    6465412..6465728
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    6496265..6496284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6507870..6507960
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    6525120..6525232
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    6553154..6553464
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    6600612..6606320
FT                   /estimated_length=5709
FT                   /gap_type="unknown"
FT   assembly_gap    6630402..6630501
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    6647927..6647946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6654742..6658113
FT                   /estimated_length=3372
FT                   /gap_type="unknown"
FT   assembly_gap    6714288..6715051
FT                   /estimated_length=764
FT                   /gap_type="unknown"
FT   assembly_gap    6742332..6745607
FT                   /estimated_length=3276
FT                   /gap_type="unknown"
FT   assembly_gap    6759593..6759653
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    6814320..6814339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6832971..6833154
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    6849147..6849166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6913163..6913289
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    6948443..6948574
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    6953188..6953243
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    6956096..6956221
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    6958818..6958979
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    6961480..6961499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7005639..7005860
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    7103706..7103725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7148249..7150367
FT                   /estimated_length=2119
FT                   /gap_type="unknown"
FT   assembly_gap    7156953..7157230
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    7192365..7194530
FT                   /estimated_length=2166
FT                   /gap_type="unknown"
FT   assembly_gap    7201935..7201954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7216529..7217102
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   assembly_gap    7232470..7232489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7237011..7237059
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    7247054..7247073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7248467..7252576
FT                   /estimated_length=4110
FT                   /gap_type="unknown"
FT   assembly_gap    7260651..7261089
FT                   /estimated_length=439
FT                   /gap_type="unknown"
FT   assembly_gap    7267153..7267172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7272575..7272594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7305067..7306732
FT                   /estimated_length=1666
FT                   /gap_type="unknown"
FT   assembly_gap    7320244..7320458
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    7340690..7340763
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    7354474..7354540
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    7360715..7360734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7365343..7365362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7371492..7371511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7381274..7381472
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    7387657..7387676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7404860..7404879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7479261..7479628
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    7483094..7486038
FT                   /estimated_length=2945
FT                   /gap_type="unknown"
FT   assembly_gap    7496636..7496709
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    7498376..7498675
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    7502813..7523332
FT                   /estimated_length=20520
FT                   /gap_type="unknown"
FT   assembly_gap    7540331..7540350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7545652..7545671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7587349..7587368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7605886..7605905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7608966..7608985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7620648..7620667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7622650..7622669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7628046..7628065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7647489..7647539
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    7678195..7678214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7717353..7717403
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    7724851..7724981
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    7732713..7734871
FT                   /estimated_length=2159
FT                   /gap_type="unknown"
FT   assembly_gap    7738811..7738830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7741260..7741279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7752115..7752527
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   assembly_gap    7754020..7754039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7760681..7760700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7761857..7761876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7786160..7790734
FT                   /estimated_length=4575
FT                   /gap_type="unknown"
FT   assembly_gap    7814642..7814663
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    7857779..7857798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7861954..7862430
FT                   /estimated_length=477
FT                   /gap_type="unknown"
FT   assembly_gap    7869846..7869865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7872498..7878667
FT                   /estimated_length=6170
FT                   /gap_type="unknown"
FT   assembly_gap    7880531..7887056
FT                   /estimated_length=6526
FT                   /gap_type="unknown"
FT   assembly_gap    7894121..7894140
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7901482..7901998
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    7923857..7923876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7925542..7925561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7930933..7930952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7934525..7934544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7936096..7936115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7939034..7939071
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    7956476..7957619
FT                   /estimated_length=1144
FT                   /gap_type="unknown"
FT   assembly_gap    7987093..7987112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7993247..7993462
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    7997285..7997350
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    8050089..8050108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8080470..8083590
FT                   /estimated_length=3121
FT                   /gap_type="unknown"
FT   assembly_gap    8095426..8095975
FT                   /estimated_length=550
FT                   /gap_type="unknown"
FT   assembly_gap    8131099..8131459
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    8158925..8159377
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   assembly_gap    8160159..8162912
FT                   /estimated_length=2754
FT                   /gap_type="unknown"
FT   assembly_gap    8169151..8174969
FT                   /estimated_length=5819
FT                   /gap_type="unknown"
FT   assembly_gap    8226803..8227004
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    8237133..8237219
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    8244679..8244698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8264297..8264316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8281653..8289218
FT                   /estimated_length=7566
FT                   /gap_type="unknown"
FT   assembly_gap    8300812..8304669
FT                   /estimated_length=3858
FT                   /gap_type="unknown"
FT   assembly_gap    8306360..8306379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8319188..8319207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8331666..8331685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8340961..8341104
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    8344714..8345058
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    8382822..8382939
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    8442662..8443406
FT                   /estimated_length=745
FT                   /gap_type="unknown"
FT   assembly_gap    8450595..8450617
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    8483720..8483739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8519010..8519044
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    8532586..8532714
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    8541376..8541577
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    8544195..8544214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8546708..8546727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8566748..8566966
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    8625517..8625548
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    8666146..8666648
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    8682408..8682464
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    8709140..8709159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8727742..8728154
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   assembly_gap    8729354..8729373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8763051..8763094
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    8781202..8784924
FT                   /estimated_length=3723
FT                   /gap_type="unknown"
FT   assembly_gap    8809916..8809935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8828994..8829013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8850894..8851132
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    8864350..8864369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8871713..8871946
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    8873573..8874997
FT                   /estimated_length=1425
FT                   /gap_type="unknown"
FT   assembly_gap    8877510..8877529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8884389..8884408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8895423..8895442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8904894..8904963
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    8909235..8909365
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    8918988..8919130
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    8931089..8931277
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    8931869..8932015
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    8947154..8947712
FT                   /estimated_length=559
FT                   /gap_type="unknown"
FT   assembly_gap    8950770..8953149
FT                   /estimated_length=2380
FT                   /gap_type="unknown"
FT   assembly_gap    8956827..8958011
FT                   /estimated_length=1185
FT                   /gap_type="unknown"
FT   assembly_gap    8995045..8995084
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    9018958..9019077
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    9025162..9025181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9043791..9043810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9048983..9049002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9053303..9053322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9054437..9054456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9055545..9056162
FT                   /estimated_length=618
FT                   /gap_type="unknown"
FT   assembly_gap    9058804..9059103
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    9059731..9060664
FT                   /estimated_length=934
FT                   /gap_type="unknown"
FT   assembly_gap    9065193..9065268
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    9082347..9085614
FT                   /estimated_length=3268
FT                   /gap_type="unknown"
FT   assembly_gap    9087011..9087030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9088676..9090552
FT                   /estimated_length=1877
FT                   /gap_type="unknown"
FT   assembly_gap    9119484..9119531
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    9148703..9148722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9154755..9154774
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9159997..9160201
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    9173003..9173022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9199305..9199324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9219166..9219208
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    9252987..9253021
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    9262583..9262882
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    9282837..9282971
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    9288743..9288762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9290206..9290225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9291944..9291963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9293732..9293751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9322102..9322121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9324248..9331564
FT                   /estimated_length=7317
FT                   /gap_type="unknown"
FT   assembly_gap    9333248..9333267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9335427..9335543
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    9337154..9337173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9342306..9342481
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    9342837..9343390
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    9372974..9373379
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   assembly_gap    9374384..9374901
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   assembly_gap    9381773..9382142
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    9387706..9387789
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    9432851..9433076
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    9455290..9455309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9464485..9465122
FT                   /estimated_length=638
FT                   /gap_type="unknown"
FT   assembly_gap    9496687..9496706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9504061..9504080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9505873..9505892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9509883..9509902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9521003..9521749
FT                   /estimated_length=747
FT                   /gap_type="unknown"
FT   assembly_gap    9525030..9525049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9535756..9535775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9546096..9546297
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    9552154..9552173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9560219..9560268
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    9579923..9580215
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    9589061..9589143
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    9602206..9606884
FT                   /estimated_length=4679
FT                   /gap_type="unknown"
FT   assembly_gap    9609835..9610934
FT                   /estimated_length=1100
FT                   /gap_type="unknown"
FT   assembly_gap    9612950..9612973
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    9627893..9627912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9655619..9656040
FT                   /estimated_length=422
FT                   /gap_type="unknown"
FT   assembly_gap    9668003..9668022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9681184..9682468
FT                   /estimated_length=1285
FT                   /gap_type="unknown"
FT   assembly_gap    9717221..9717240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9737477..9737540
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    9738373..9738392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9762818..9762965
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    9781320..9781339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9789780..9796294
FT                   /estimated_length=6515
FT                   /gap_type="unknown"
FT   assembly_gap    9797629..9797648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9799223..9802170
FT                   /estimated_length=2948
FT                   /gap_type="unknown"
FT   assembly_gap    9805597..9805616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9811365..9811384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9819879..9821334
FT                   /estimated_length=1456
FT                   /gap_type="unknown"
FT   assembly_gap    9857105..9857758
FT                   /estimated_length=654
FT                   /gap_type="unknown"
FT   assembly_gap    9858977..9858996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9863833..9864097
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    9866886..9866905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9868209..9868228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9883574..9883593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9884661..9884680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9890335..9890354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9891372..9891391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9892286..9892305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9894666..9894685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9902412..9902431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9925800..9926131
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    9932330..9936873
FT                   /estimated_length=4544
FT                   /gap_type="unknown"
FT   assembly_gap    9942593..9942612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9951084..9952069
FT                   /estimated_length=986
FT                   /gap_type="unknown"
FT   assembly_gap    9953464..9955138
FT                   /estimated_length=1675
FT                   /gap_type="unknown"
FT   assembly_gap    9992112..9992699
FT                   /estimated_length=588
FT                   /gap_type="unknown"
FT   assembly_gap    9994433..9997506
FT                   /estimated_length=3074
FT                   /gap_type="unknown"
FT   assembly_gap    10004225..10004372
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    10010699..10010718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10029072..10029773
FT                   /estimated_length=702
FT                   /gap_type="unknown"
FT   assembly_gap    10032746..10034554
FT                   /estimated_length=1809
FT                   /gap_type="unknown"
FT   assembly_gap    10035756..10037232
FT                   /estimated_length=1477
FT                   /gap_type="unknown"
FT   assembly_gap    10038740..10040883
FT                   /estimated_length=2144
FT                   /gap_type="unknown"
FT   assembly_gap    10044394..10045394
FT                   /estimated_length=1001
FT                   /gap_type="unknown"
FT   assembly_gap    10048630..10048649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10061209..10061942
FT                   /estimated_length=734
FT                   /gap_type="unknown"
FT   assembly_gap    10063699..10063718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10064889..10064908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10067624..10067643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10069810..10070064
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    10071184..10071203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10073839..10073858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10107042..10107061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10108165..10108184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10111123..10111291
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    10113852..10113871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10117763..10117782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10125181..10125200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10129296..10129315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10185844..10186231
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   assembly_gap    10188910..10189169
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    10190167..10190302
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    10202940..10202959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10209820..10210027
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    10211795..10212212
FT                   /estimated_length=418
FT                   /gap_type="unknown"
FT   assembly_gap    10231520..10231539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10270442..10270512
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    10274990..10275440
FT                   /estimated_length=451
FT                   /gap_type="unknown"
FT   assembly_gap    10289898..10289917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10296361..10296678
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    10309613..10312983
FT                   /estimated_length=3371
FT                   /gap_type="unknown"
FT   assembly_gap    10331244..10331707
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   assembly_gap    10389643..10389662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10392310..10392329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10394244..10394263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10398139..10398158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10404302..10404321
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10406157..10406576
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    10410136..10410155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10470218..10470237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10479843..10480002
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    10492506..10492525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10527598..10527617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10528675..10528694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10530841..10530860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10532368..10532387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10534299..10534318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10535410..10535429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10536556..10536890
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    10538108..10542317
FT                   /estimated_length=4210
FT                   /gap_type="unknown"
FT   assembly_gap    10583439..10583458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10613797..10614501
FT                   /estimated_length=705
FT                   /gap_type="unknown"
FT   assembly_gap    10708550..10708569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10710698..10710717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10736888..10737506
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   assembly_gap    10743790..10743965
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    10781077..10781708
FT                   /estimated_length=632
FT                   /gap_type="unknown"
FT   assembly_gap    10785364..10785383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10827933..10827977
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    10854728..10854747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10856756..10856775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10860996..10861015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10881542..10883020
FT                   /estimated_length=1479
FT                   /gap_type="unknown"
FT   assembly_gap    10885248..10885267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10897305..10897324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10922453..10922472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10923932..10923951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10975588..10975895
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    10988745..10988764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11009255..11009274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11031585..11031940
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    11038281..11038300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11056939..11056958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11075000..11075031
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    11082526..11084605
FT                   /estimated_length=2080
FT                   /gap_type="unknown"
FT   assembly_gap    11133390..11134824
FT                   /estimated_length=1435
FT                   /gap_type="unknown"
FT   assembly_gap    11136198..11137592
FT                   /estimated_length=1395
FT                   /gap_type="unknown"
FT   assembly_gap    11178399..11178418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11256568..11256883
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    11277628..11277647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11285036..11288336
FT                   /estimated_length=3301
FT                   /gap_type="unknown"
FT   assembly_gap    11303987..11304178
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    11331189..11331262
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    11374704..11374723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11391893..11391984
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    11393750..11393788
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    11425107..11425332
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    11427743..11427764
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    11438431..11439413
FT                   /estimated_length=983
FT                   /gap_type="unknown"
FT   assembly_gap    11445955..11446019
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    11487354..11487398
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    11498720..11498786
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    11522716..11522735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11531971..11531990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11532210..11532433
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    11545393..11545542
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    11565932..11587356
FT                   /estimated_length=21425
FT                   /gap_type="unknown"
FT   assembly_gap    11611621..11611897
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    11613244..11618403
FT                   /estimated_length=5160
FT                   /gap_type="unknown"
FT   assembly_gap    11634998..11635017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11665912..11666374
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   assembly_gap    11670143..11670906
FT                   /estimated_length=764
FT                   /gap_type="unknown"
FT   assembly_gap    11711473..11711511
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    11742358..11742535
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    11790279..11790298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11809700..11809719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11819047..11819301
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    11834700..11834976
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    11861551..11861597
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    11862118..11862137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11962937..11962971
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    11964088..11964230
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    12000852..12000942
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    12016946..12017061
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    12062946..12063235
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    12089962..12089992
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    12100137..12100156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12102864..12102883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12125612..12125631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12127556..12127575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12141641..12141660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12191109..12191128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12195627..12195667
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    12198215..12198234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12227157..12227318
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    12237344..12237363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12245968..12251265
FT                   /estimated_length=5298
FT                   /gap_type="unknown"
FT   assembly_gap    12255231..12255485
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    12263888..12263907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12296247..12296487
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    12340344..12340363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12368187..12368326
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    12398284..12398639
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    12401757..12401776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12410428..12410450
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    12428103..12428281
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    12510025..12510208
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    12569662..12569681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12570778..12574270
FT                   /estimated_length=3493
FT                   /gap_type="unknown"
FT   assembly_gap    12575575..12575594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12585032..12588035
FT                   /estimated_length=3004
FT                   /gap_type="unknown"
FT   assembly_gap    12619536..12619555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12632445..12632696
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    12638839..12639119
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    12647176..12647294
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    12687355..12687374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12695001..12713234
FT                   /estimated_length=18234
FT                   /gap_type="unknown"
FT   assembly_gap    12714433..12714691
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    12734844..12734873
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    12738203..12738222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12749613..12749833
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    12769883..12769902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12771500..12772682
FT                   /estimated_length=1183
FT                   /gap_type="unknown"
FT   assembly_gap    12798429..12798448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12800626..12800645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12805387..12806324
FT                   /estimated_length=938
FT                   /gap_type="unknown"
FT   assembly_gap    12823417..12823436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12840515..12840641
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    12845296..12845477
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    12856810..12856829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12864210..12864409
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    12875951..12877120
FT                   /estimated_length=1170
FT                   /gap_type="unknown"
FT   assembly_gap    12890720..12890739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12903328..12903424
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    12964152..12964171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12974261..12974280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12990901..12995483
FT                   /estimated_length=4583
FT                   /gap_type="unknown"
FT   assembly_gap    13006184..13006203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13037477..13037551
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    13042514..13042533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13043888..13043907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13061459..13061478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13066817..13067100
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    13071142..13071356
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    13112946..13113174
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    13118602..13118621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13124872..13124891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13136271..13136471
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    13142450..13142469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13147011..13147922
FT                   /estimated_length=912
FT                   /gap_type="unknown"
FT   assembly_gap    13180909..13180941
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    13211906..13212611
FT                   /estimated_length=706
FT                   /gap_type="unknown"
FT   assembly_gap    13217314..13217690
FT                   /estimated_length=377
FT                   /gap_type="unknown"
FT   assembly_gap    13228361..13232435
FT                   /estimated_length=4075
FT                   /gap_type="unknown"
FT   assembly_gap    13234442..13234461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13238692..13238711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13240035..13240054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13241157..13242990
FT                   /estimated_length=1834
FT                   /gap_type="unknown"
FT   assembly_gap    13244561..13244580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13261567..13265936
FT                   /estimated_length=4370
FT                   /gap_type="unknown"
FT   assembly_gap    13279644..13279663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13314979..13315002
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    13374459..13374624
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    13389383..13389402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13418476..13419019
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    13420909..13421681
FT                   /estimated_length=773
FT                   /gap_type="unknown"
FT   assembly_gap    13432145..13433045
FT                   /estimated_length=901
FT                   /gap_type="unknown"
FT   assembly_gap    13439931..13439950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13477306..13477325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13479082..13479101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13487106..13489266
FT                   /estimated_length=2161
FT                   /gap_type="unknown"
FT   assembly_gap    13524234..13524253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13553381..13553400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13580321..13580340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13604130..13604149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13608239..13608485
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    13617989..13618008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13619419..13619438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13620699..13623216
FT                   /estimated_length=2518
FT                   /gap_type="unknown"
FT   assembly_gap    13676053..13676072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13685607..13685626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13714753..13715217
FT                   /estimated_length=465
FT                   /gap_type="unknown"
FT   assembly_gap    13720791..13720810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13722166..13724492
FT                   /estimated_length=2327
FT                   /gap_type="unknown"
FT   assembly_gap    13732887..13733458
FT                   /estimated_length=572
FT                   /gap_type="unknown"
FT   assembly_gap    13761792..13762081
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    13762961..13763230
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    13766238..13766423
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    13767855..13767874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13770098..13770117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13787451..13787470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13803802..13803821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13813362..13813381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13824153..13824251
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    13842035..13842054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13858802..13858967
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    13861105..13861124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13862674..13862693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13865073..13867047
FT                   /estimated_length=1975
FT                   /gap_type="unknown"
FT   assembly_gap    13870145..13870330
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    13873352..13873371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13875571..13875590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13876598..13880176
FT                   /estimated_length=3579
FT                   /gap_type="unknown"
FT   assembly_gap    13882525..13882631
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    13887599..13889674
FT                   /estimated_length=2076
FT                   /gap_type="unknown"
FT   assembly_gap    13902878..13902897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13904692..13905753
FT                   /estimated_length=1062
FT                   /gap_type="unknown"
FT   assembly_gap    13906832..13908301
FT                   /estimated_length=1470
FT                   /gap_type="unknown"
FT   assembly_gap    13912801..13998115
FT                   /estimated_length=85315
FT                   /gap_type="unknown"
FT   assembly_gap    14022469..14044700
FT                   /estimated_length=22232
FT                   /gap_type="unknown"
FT   assembly_gap    14062738..14062826
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    14064451..14065371
FT                   /estimated_length=921
FT                   /gap_type="unknown"
FT   assembly_gap    14072160..14072341
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    14077969..14077988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14146857..14147097
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    14260170..14260437
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    14262905..14263487
FT                   /estimated_length=583
FT                   /gap_type="unknown"
FT   assembly_gap    14312881..14312900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14317142..14317161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14318290..14318309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14321504..14326550
FT                   /estimated_length=5047
FT                   /gap_type="unknown"
FT   assembly_gap    14339560..14339579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14383466..14383485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14415782..14415801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14491314..14491333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14494228..14494247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14540164..14540449
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    14578070..14582292
FT                   /estimated_length=4223
FT                   /gap_type="unknown"
FT   assembly_gap    14659942..14659961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14697966..14699480
FT                   /estimated_length=1515
FT                   /gap_type="unknown"
FT   assembly_gap    14931385..14931404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15107873..15107892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15219342..15219361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15225171..15225190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15426389..15426408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15444259..15444581
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    15445688..15448345
FT                   /estimated_length=2658
FT                   /gap_type="unknown"
FT   assembly_gap    15450971..15451130
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    15452708..15452727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15458841..15458860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15461328..15462844
FT                   /estimated_length=1517
FT                   /gap_type="unknown"
FT   assembly_gap    15464508..15464527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15467291..15467862
FT                   /estimated_length=572
FT                   /gap_type="unknown"
FT   assembly_gap    15470096..15486175
FT                   /estimated_length=16080
FT                   /gap_type="unknown"
FT   assembly_gap    15499885..15499904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15516406..15516425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15526496..15529641
FT                   /estimated_length=3146
FT                   /gap_type="unknown"
FT   assembly_gap    15550377..15551914
FT                   /estimated_length=1538
FT                   /gap_type="unknown"
FT   assembly_gap    15554710..15554771
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    15557250..15558401
FT                   /estimated_length=1152
FT                   /gap_type="unknown"
FT   assembly_gap    15559868..15561325
FT                   /estimated_length=1458
FT                   /gap_type="unknown"
FT   assembly_gap    15563580..15564276
FT                   /estimated_length=697
FT                   /gap_type="unknown"
FT   assembly_gap    15565856..15565875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15592256..15664453
FT                   /estimated_length=72198
FT                   /gap_type="unknown"
FT   assembly_gap    15667107..15667126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15668578..15668597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15670048..15671282
FT                   /estimated_length=1235
FT                   /gap_type="unknown"
FT   assembly_gap    15677783..15677929
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    15707886..15707905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15820232..15820251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15876798..15879225
FT                   /estimated_length=2428
FT                   /gap_type="unknown"
FT   assembly_gap    15880179..15881415
FT                   /estimated_length=1237
FT                   /gap_type="unknown"
FT   assembly_gap    15883238..15884004
FT                   /estimated_length=767
FT                   /gap_type="unknown"
FT   assembly_gap    15926300..15929173
FT                   /estimated_length=2874
FT                   /gap_type="unknown"
FT   assembly_gap    15998998..15999017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16004818..16004837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16080673..16081382
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   assembly_gap    16190718..16190737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16196582..16197246
FT                   /estimated_length=665
FT                   /gap_type="unknown"
FT   assembly_gap    16199445..16200209
FT                   /estimated_length=765
FT                   /gap_type="unknown"
XX
CO   join(AAHY01070936.1:1..2018,gap(20),complement(AAHY01070937.1:1..1290),
CO   gap(20),AAHY01070938.1:1..2286,gap(173),AAHY01070939.1:1..4879,gap(134),
CO   AAHY01070940.1:1..64397,gap(96),AAHY01070941.1:1..20874,gap(6258),
CO   AAHY01070942.1:1..1111,gap(2719),AAHY01070943.1:1..5930,gap(20),
CO   AAHY01070944.1:1..871,gap(446),AAHY01070945.1:1..5937,gap(20),
CO   AAHY01070946.1:1..17462,gap(20),AAHY01070947.1:1..13244,gap(2988),
CO   complement(AAHY01070948.1:1..3677),gap(7024),AAHY01070949.1:1..3253,
CO   gap(20),AAHY01070950.1:1..7872,gap(414),complement(AAHY01070951.1:1..7457),
CO   gap(148),AAHY01070952.1:1..85281,gap(304),AAHY01070953.1:1..54264,gap(20),
CO   complement(AAHY01070954.1:1..2541),gap(810),AAHY01070955.1:1..1477,
CO   gap(5022),complement(AAHY01070956.1:1..1171),gap(32),
CO   complement(AAHY01070957.1:1..37939),gap(41),AAHY01070958.1:1..18936,
CO   gap(1684),AAHY01070959.1:1..2283,gap(91),AAHY01070960.1:1..28394,gap(4526),
CO   AAHY01070961.1:1..1732,gap(1526),complement(AAHY01070962.1:1..25090),
CO   gap(20),AAHY01070963.1:1..20609,gap(2876),AAHY01070964.1:1..17044,gap(20),
CO   AAHY01070965.1:1..9721,gap(20),AAHY01070966.1:1..91390,gap(20),
CO   AAHY01070967.1:1..9736,gap(20),AAHY01070968.1:1..14374,gap(20),
CO   AAHY01070969.1:1..9178,gap(20),complement(AAHY01070970.1:1..20964),
CO   gap(217),AAHY01070971.1:1..33049,gap(258),AAHY01070972.1:1..27542,gap(20),
CO   AAHY01070973.1:1..4489,gap(270),AAHY01070974.1:1..12966,gap(404),
CO   AAHY01070975.1:1..3738,gap(437),complement(AAHY01070976.1:1..22024),
CO   gap(5900),AAHY01070977.1:1..8556,gap(788),AAHY01070978.1:1..29466,gap(224),
CO   AAHY01070979.1:1..30575,gap(127),AAHY01070980.1:1..13145,gap(44),
CO   AAHY01070981.1:1..4387,gap(20),complement(AAHY01070982.1:1..2820),gap(20),
CO   AAHY01070983.1:1..6521,gap(152),AAHY01070984.1:1..36781,gap(20),
CO   AAHY01070985.1:1..34050,gap(90),AAHY01070986.1:1..1167,gap(20),
CO   complement(AAHY01070987.1:1..1351),gap(20),AAHY01070988.1:1..6128,gap(37),
CO   AAHY01070989.1:1..8392,gap(4314),AAHY01070990.1:1..8065,gap(71),
CO   AAHY01070991.1:1..25585,gap(20),AAHY01070992.1:1..28466,gap(20),
CO   complement(AAHY01070993.1:1..1464),gap(20),AAHY01070994.1:1..16835,gap(20),
CO   AAHY01070995.1:1..1666,gap(20),AAHY01070996.1:1..1334,gap(20),
CO   AAHY01070997.1:1..9615,gap(45),AAHY01070998.1:1..16803,gap(162),
CO   AAHY01070999.1:1..57318,gap(48),AAHY01071000.1:1..3173,gap(442),
CO   AAHY01071001.1:1..75460,gap(20),AAHY01071002.1:1..24297,gap(20),
CO   AAHY01071003.1:1..29027,gap(140),AAHY01071004.1:1..5811,gap(300),
CO   AAHY01071005.1:1..3404,gap(206),AAHY01071006.1:1..15540,gap(597),
CO   AAHY01071007.1:1..47687,gap(15613),complement(AAHY01071008.1:1..1115),
CO   gap(20),AAHY01071009.1:1..64286,gap(20),complement(AAHY01071010.1:1..5718),
CO   gap(20),AAHY01071011.1:1..32929,gap(20),AAHY01071012.1:1..46283,gap(625),
CO   complement(AAHY01071013.1:1..9011),gap(78),AAHY01071014.1:1..22591,
CO   gap(1079),AAHY01071015.1:1..14108,gap(23),AAHY01071016.1:1..5181,gap(20),
CO   AAHY01071017.1:1..27396,gap(138),complement(AAHY01071018.1:1..2847),
CO   gap(23),AAHY01071019.1:1..20140,gap(933),AAHY01071020.1:1..1659,gap(3767),
CO   complement(AAHY01071021.1:1..1965),gap(20),
CO   complement(AAHY01071022.1:1..1182),gap(20),
CO   complement(AAHY01071023.1:1..2112),gap(20),
CO   complement(AAHY01071024.1:1..1188),gap(20),AAHY01071025.1:1..2184,
CO   gap(4994),AAHY01071026.1:1..11922,gap(140),AAHY01071027.1:1..10665,gap(20),
CO   AAHY01071028.1:1..21832,gap(197),AAHY01071029.1:1..12683,gap(20),
CO   complement(AAHY01071030.1:1..2010),gap(4534),AAHY01071031.1:1..19214,
CO   gap(91),AAHY01071032.1:1..29381,gap(120),AAHY01071033.1:1..16891,gap(20),
CO   AAHY01071034.1:1..6481,gap(23),AAHY01071035.1:1..21120,gap(209),
CO   AAHY01071036.1:1..6753,gap(4499),AAHY01071037.1:1..2110,gap(129),
CO   AAHY01071038.1:1..5559,gap(20),AAHY01071039.1:1..5120,gap(20),
CO   AAHY01071040.1:1..1075,gap(20),AAHY01071041.1:1..9152,gap(87),
CO   complement(AAHY01071042.1:1..1369),gap(1989),AAHY01071043.1:1..17250,
CO   gap(1555),AAHY01071044.1:1..7356,gap(20),AAHY01071045.1:1..1337,gap(20),
CO   AAHY01071046.1:1..1448,gap(225),AAHY01071047.1:1..9879,gap(20),
CO   AAHY01071048.1:1..34678,gap(503),complement(AAHY01071049.1:1..20296),
CO   gap(20),complement(AAHY01071050.1:1..15432),gap(63),
CO   complement(AAHY01071051.1:1..13069),gap(20),
CO   complement(AAHY01071052.1:1..5960),gap(20),AAHY01071053.1:1..16880,
CO   gap(4468),AAHY01071054.1:1..9793,gap(25),AAHY01071055.1:1..1499,gap(891),
CO   complement(AAHY01071056.1:1..6830),gap(723),
CO   complement(AAHY01071057.1:1..26379),gap(136),AAHY01071058.1:1..9259,
CO   gap(20),AAHY01071059.1:1..2714,gap(316),AAHY01071060.1:1..6137,gap(167),
CO   AAHY01071061.1:1..40992,gap(70),complement(AAHY01071062.1:1..8696),
CO   gap(1063),AAHY01071063.1:1..23099,gap(20),AAHY01071064.1:1..22124,gap(20),
CO   complement(AAHY01071065.1:1..7157),gap(47),AAHY01071066.1:1..35996,
CO   gap(123),AAHY01071067.1:1..29166,gap(20),
CO   complement(AAHY01071068.1:1..22493),gap(593),
CO   complement(AAHY01071069.1:1..1835),gap(127),
CO   complement(AAHY01071070.1:1..5166),gap(100),
CO   complement(AAHY01071071.1:1..11397),gap(20),AAHY01071072.1:1..3282,gap(20),
CO   AAHY01071073.1:1..8966,gap(20),complement(AAHY01071074.1:1..2201),gap(20),
CO   complement(AAHY01071075.1:1..15306),gap(32),
CO   complement(AAHY01071076.1:1..30896),gap(20),AAHY01071077.1:1..1443,
CO   gap(375),AAHY01071078.1:1..27343,gap(365),AAHY01071079.1:1..48689,gap(20),
CO   AAHY01071080.1:1..3201,gap(20),complement(AAHY01071081.1:1..1334),gap(20),
CO   AAHY01071082.1:1..5463,gap(20),complement(AAHY01071083.1:1..7755),gap(20),
CO   complement(AAHY01071084.1:1..5359),gap(20),AAHY01071085.1:1..25243,
CO   gap(1354),AAHY01071086.1:1..4579,gap(20),AAHY01071087.1:1..1160,gap(20),
CO   AAHY01071088.1:1..1493,gap(20),AAHY01071089.1:1..1155,gap(20),
CO   complement(AAHY01071090.1:1..1213),gap(20),AAHY01071091.1:1..8754,gap(20),
CO   complement(AAHY01071092.1:1..12898),gap(116),AAHY01071093.1:1..35911,
CO   gap(20),AAHY01071094.1:1..11925,gap(53),AAHY01071095.1:1..9336,gap(20),
CO   AAHY01071096.1:1..4083,gap(280),complement(AAHY01071097.1:1..3114),gap(20),
CO   AAHY01071098.1:1..26918,gap(1308),AAHY01071099.1:1..9745,gap(271),
CO   AAHY01071100.1:1..7603,gap(484),AAHY01071101.1:1..12909,gap(86),
CO   AAHY01071102.1:1..14901,gap(118),AAHY01071103.1:1..13078,gap(20),
CO   AAHY01071104.1:1..19332,gap(20),AAHY01071105.1:1..15608,gap(20),
CO   AAHY01071106.1:1..13196,gap(20),AAHY01071107.1:1..11451,gap(209),
CO   AAHY01071108.1:1..4969,gap(5988),AAHY01071109.1:1..2936,gap(83),
CO   complement(AAHY01071110.1:1..1678),gap(430),AAHY01071111.1:1..3745,gap(20),
CO   AAHY01071112.1:1..10150,gap(324),AAHY01071113.1:1..4592,gap(20),
CO   AAHY01071114.1:1..3269,gap(20),AAHY01071115.1:1..1138,gap(20),
CO   AAHY01071116.1:1..2624,gap(20),complement(AAHY01071117.1:1..1365),gap(20),
CO   AAHY01071118.1:1..1241,gap(20),AAHY01071119.1:1..3319,gap(20),
CO   complement(AAHY01071120.1:1..1757),gap(2777),AAHY01071121.1:1..8391,
CO   gap(118),complement(AAHY01071122.1:1..902),gap(20),AAHY01071123.1:1..54897,
CO   gap(20),AAHY01071124.1:1..12324,gap(50),AAHY01071125.1:1..1851,gap(20),
CO   complement(AAHY01071126.1:1..22752),gap(20),
CO   complement(AAHY01071127.1:1..18009),gap(5010),AAHY01071128.1:1..22214,
CO   gap(285),complement(AAHY01071129.1:1..2403),gap(267),
CO   AAHY01071130.1:1..5200,gap(115),AAHY01071131.1:1..28864,gap(20),
CO   AAHY01071132.1:1..27144,gap(20),AAHY01071133.1:1..11723,gap(1687),
CO   AAHY01071134.1:1..4230,gap(20),AAHY01071135.1:1..54872,gap(20),
CO   AAHY01071136.1:1..3539,gap(20),complement(AAHY01071137.1:1..1736),gap(20),
CO   AAHY01071138.1:1..11798,gap(55),AAHY01071139.1:1..36212,gap(150),
CO   complement(AAHY01071140.1:1..6928),gap(20),AAHY01071141.1:1..70769,
CO   gap(646),AAHY01071142.1:1..26332,gap(487),AAHY01071143.1:1..4331,gap(20),
CO   AAHY01071144.1:1..25212,gap(20),complement(AAHY01071145.1:1..1225),gap(20),
CO   AAHY01071146.1:1..1049,gap(20),complement(AAHY01071147.1:1..1123),gap(20),
CO   AAHY01071148.1:1..2160,gap(20),AAHY01071149.1:1..1650,gap(20),
CO   AAHY01071150.1:1..45467,gap(144),AAHY01071151.1:1..22404,gap(20),
CO   AAHY01071152.1:1..35849,gap(20),AAHY01071153.1:1..3583,gap(129),
CO   AAHY01071154.1:1..12603,gap(416),AAHY01071155.1:1..14745,gap(20),
CO   complement(AAHY01071156.1:1..156),gap(20),AAHY01071157.1:1..38782,gap(20),
CO   AAHY01071158.1:1..2793,gap(20),AAHY01071159.1:1..17999,gap(664),
CO   AAHY01071160.1:1..9817,gap(20),AAHY01071161.1:1..40229,gap(66),
CO   AAHY01071162.1:1..27214,gap(1269),AAHY01071163.1:1..1646,gap(20),
CO   AAHY01071164.1:1..3764,gap(79),AAHY01071165.1:1..28217,gap(78),
CO   AAHY01071166.1:1..3621,gap(20),AAHY01071167.1:1..6956,gap(20),
CO   AAHY01071168.1:1..2099,gap(594),AAHY01071169.1:1..2954,gap(20),
CO   complement(AAHY01071170.1:1..12655),gap(35),AAHY01071171.1:1..53391,
CO   gap(20),AAHY01071172.1:1..40114,gap(447),
CO   complement(AAHY01071173.1:1..23685),gap(72),
CO   complement(AAHY01071174.1:1..3092),gap(52),AAHY01071175.1:1..15094,
CO   gap(5803),AAHY01071176.1:1..4929,gap(3532),
CO   complement(AAHY01071177.1:1..9749),gap(20),
CO   complement(AAHY01071178.1:1..13443),gap(594),
CO   complement(AAHY01071179.1:1..15151),gap(20),AAHY01071180.1:1..58069,
CO   gap(122),AAHY01071181.1:1..53158,gap(20),AAHY01071182.1:1..705,gap(344),
CO   complement(AAHY01071183.1:1..38155),gap(20),AAHY01071184.1:1..6731,gap(20),
CO   complement(AAHY01071185.1:1..830),gap(337),AAHY01071186.1:1..2494,gap(324),
CO   AAHY01071187.1:1..18315,gap(112),complement(AAHY01071188.1:1..26978),
CO   gap(20),AAHY01071189.1:1..31799,gap(157),AAHY01071190.1:1..27001,gap(20),
CO   AAHY01071191.1:1..2609,gap(3037),complement(AAHY01071192.1:1..1203),
CO   gap(20),AAHY01071193.1:1..1703,gap(20),AAHY01071194.1:1..2160,gap(20),
CO   complement(AAHY01071195.1:1..1433),gap(20),AAHY01071196.1:1..4319,gap(179),
CO   AAHY01071197.1:1..1159,gap(20),complement(AAHY01071198.1:1..1286),gap(20),
CO   AAHY01071199.1:1..20140,gap(53),AAHY01071200.1:1..17961,gap(67),
CO   AAHY01071201.1:1..3577,gap(20),AAHY01071202.1:1..30391,gap(350),
CO   AAHY01071203.1:1..1583,gap(317),AAHY01071204.1:1..1426,gap(566),
CO   AAHY01071205.1:1..2860,gap(20),AAHY01071206.1:1..2111,gap(48),
CO   AAHY01071207.1:1..22369,gap(20),AAHY01071208.1:1..11119,gap(20),
CO   AAHY01071209.1:1..4042,gap(2454),AAHY01071210.1:1..25717,gap(2772),
CO   AAHY01071211.1:1..4318,gap(165),AAHY01071212.1:1..1791,gap(20),
CO   AAHY01071213.1:1..30356,gap(212),AAHY01071214.1:1..8004,gap(20),
CO   AAHY01071215.1:1..2282,gap(6996),complement(AAHY01071216.1:1..1908),
CO   gap(6373),AAHY01071217.1:1..15725,gap(20),AAHY01071218.1:1..9090,gap(3947),
CO   AAHY01071219.1:1..28605,gap(20),AAHY01071220.1:1..8459,gap(41),
CO   AAHY01071221.1:1..11246,gap(446),AAHY01071222.1:1..16223,gap(20),
CO   AAHY01071223.1:1..22742,gap(20),AAHY01071224.1:1..1825,gap(39),
CO   AAHY01071225.1:1..16761,gap(1704),AAHY01071226.1:1..2471,gap(691),
CO   complement(AAHY01071227.1:1..2353),gap(20),AAHY01071228.1:1..3914,gap(189),
CO   AAHY01071229.1:1..1294,gap(20),AAHY01071230.1:1..9944,gap(722),
CO   AAHY01071231.1:1..1009,gap(20),AAHY01071232.1:1..4305,gap(20),
CO   AAHY01071233.1:1..3346,gap(1991),AAHY01071234.1:1..1340,gap(20),
CO   AAHY01071235.1:1..14248,gap(20),complement(AAHY01071236.1:1..2430),gap(20),
CO   AAHY01071237.1:1..1313,gap(20),AAHY01071238.1:1..3936,gap(3095),
CO   AAHY01071239.1:1..7002,gap(20),AAHY01071240.1:1..6574,gap(20),
CO   complement(AAHY01071241.1:1..25211),gap(3144),AAHY01071242.1:1..1085,
CO   gap(20),AAHY01071243.1:1..1655,gap(20),AAHY01071244.1:1..1430,gap(20),
CO   complement(AAHY01071245.1:1..5316),gap(20),AAHY01071246.1:1..1607,gap(20),
CO   AAHY01071247.1:1..21130,gap(20),AAHY01071248.1:1..9688,gap(20),
CO   AAHY01071249.1:1..1636,gap(20),complement(AAHY01071250.1:1..1010),gap(20),
CO   AAHY01071251.1:1..1110,gap(20),AAHY01071252.1:1..4977,gap(6964),
CO   AAHY01071253.1:1..4144,gap(123),AAHY01071254.1:1..41256,gap(166),
CO   AAHY01071255.1:1..9742,gap(937),complement(AAHY01071256.1:1..663),gap(687),
CO   AAHY01071257.1:1..12966,gap(95),AAHY01071258.1:1..9819,gap(20),
CO   complement(AAHY01071259.1:1..1067),gap(20),AAHY01071260.1:1..2174,gap(20),
CO   complement(AAHY01071261.1:1..1831),gap(5619),AAHY01071262.1:1..12220,
CO   gap(20),AAHY01071263.1:1..1333,gap(20),AAHY01071264.1:1..6107,gap(20),
CO   complement(AAHY01071265.1:1..3134),gap(5588),AAHY01071266.1:1..9632,
CO   gap(20),AAHY01071267.1:1..28858,gap(508),AAHY01071268.1:1..11466,gap(407),
CO   AAHY01071269.1:1..744,gap(334),complement(AAHY01071270.1:1..27587),gap(20),
CO   AAHY01071271.1:1..15069,gap(365),AAHY01071272.1:1..18859,gap(179),
CO   AAHY01071273.1:1..19585,gap(20),complement(AAHY01071274.1:1..14633),
CO   gap(20),AAHY01071275.1:1..17293,gap(20),AAHY01071276.1:1..1518,gap(20),
CO   AAHY01071277.1:1..18196,gap(20),AAHY01071278.1:1..31337,gap(20),
CO   AAHY01071279.1:1..1818,gap(276),AAHY01071280.1:1..3868,gap(20),
CO   AAHY01071281.1:1..6837,gap(886),AAHY01071282.1:1..6041,gap(446),
CO   AAHY01071283.1:1..3966,gap(20),complement(AAHY01071284.1:1..1284),gap(20),
CO   AAHY01071285.1:1..10185,gap(241),AAHY01071286.1:1..24088,gap(2729),
CO   AAHY01071287.1:1..4486,gap(2210),AAHY01071288.1:1..8059,gap(470),
CO   AAHY01071289.1:1..35453,gap(318),AAHY01071290.1:1..22446,gap(486),
CO   AAHY01071291.1:1..2443,gap(37),AAHY01071292.1:1..30690,gap(151),
CO   AAHY01071293.1:1..30094,gap(82),AAHY01071294.1:1..41096,gap(124),
CO   AAHY01071295.1:1..33856,gap(20),AAHY01071296.1:1..1402,gap(20),
CO   complement(AAHY01071297.1:1..3736),gap(61),
CO   complement(AAHY01071298.1:1..9019),gap(177),
CO   complement(AAHY01071299.1:1..21479),gap(20),AAHY01071300.1:1..1717,gap(20),
CO   AAHY01071301.1:1..44526,gap(928),AAHY01071302.1:1..5009,gap(178),
CO   AAHY01071303.1:1..19242,gap(340),AAHY01071304.1:1..1172,gap(20),
CO   complement(AAHY01071305.1:1..1138),gap(20),AAHY01071306.1:1..10207,gap(20),
CO   complement(AAHY01071307.1:1..1412),gap(20),AAHY01071308.1:1..4195,gap(20),
CO   AAHY01071309.1:1..1602,gap(20),AAHY01071310.1:1..6525,gap(20),
CO   AAHY01071311.1:1..5741,gap(20),AAHY01071312.1:1..4501,gap(20),
CO   AAHY01071313.1:1..29635,gap(503),AAHY01071314.1:1..38772,gap(20),
CO   AAHY01071315.1:1..963,gap(20),AAHY01071316.1:1..32323,gap(132),
CO   AAHY01071317.1:1..23555,gap(83),AAHY01071318.1:1..5499,gap(20),
CO   AAHY01071319.1:1..88918,gap(20),AAHY01071320.1:1..22038,gap(20),
CO   AAHY01071321.1:1..10773,gap(20),AAHY01071322.1:1..18906,gap(20),
CO   AAHY01071323.1:1..23330,gap(20),AAHY01071324.1:1..10380,gap(4765),
CO   complement(AAHY01071325.1:1..5411),gap(20),AAHY01071326.1:1..50058,
CO   gap(263),AAHY01071327.1:1..2762,gap(20),AAHY01071328.1:1..24406,gap(118),
CO   AAHY01071329.1:1..35555,gap(211),AAHY01071330.1:1..7824,gap(20),
CO   AAHY01071331.1:1..10063,gap(527),AAHY01071332.1:1..7185,gap(173),
CO   AAHY01071333.1:1..1847,gap(66),AAHY01071334.1:1..21127,gap(684),
CO   AAHY01071335.1:1..3755,gap(20),AAHY01071336.1:1..8622,gap(187),
CO   complement(AAHY01071337.1:1..14876),gap(298),AAHY01071338.1:1..17882,
CO   gap(359),complement(AAHY01071339.1:1..1939),gap(190),
CO   complement(AAHY01071340.1:1..2214),gap(69),
CO   complement(AAHY01071341.1:1..2562),gap(20),
CO   complement(AAHY01071342.1:1..12987),gap(372),
CO   complement(AAHY01071343.1:1..3397),gap(20),AAHY01071344.1:1..5629,gap(20),
CO   AAHY01071345.1:1..60677,gap(39),AAHY01071346.1:1..5759,gap(318),
CO   complement(AAHY01071347.1:1..10356),gap(20),AAHY01071348.1:1..13768,
CO   gap(20),AAHY01071349.1:1..19171,gap(290),
CO   complement(AAHY01071350.1:1..1002),gap(129),
CO   complement(AAHY01071351.1:1..17634),gap(20),
CO   complement(AAHY01071352.1:1..1375),gap(572),
CO   complement(AAHY01071353.1:1..6782),gap(129),
CO   complement(AAHY01071354.1:1..11295),gap(20),
CO   complement(AAHY01071355.1:1..24761),gap(20),AAHY01071356.1:1..4727,gap(20),
CO   AAHY01071357.1:1..3239,gap(20),AAHY01071358.1:1..2700,gap(20),
CO   AAHY01071359.1:1..70125,gap(208),AAHY01071360.1:1..16231,gap(20),
CO   AAHY01071361.1:1..7654,gap(213),AAHY01071362.1:1..5753,gap(135),
CO   AAHY01071363.1:1..33390,gap(20),AAHY01071364.1:1..6934,gap(1145),
CO   complement(AAHY01071365.1:1..3559),gap(240),
CO   complement(AAHY01071366.1:1..28959),gap(24),AAHY01071367.1:1..38003,
CO   gap(20),AAHY01071368.1:1..13529,gap(45),complement(AAHY01071369.1:1..4468),
CO   gap(20),AAHY01071370.1:1..20604,gap(20),AAHY01071371.1:1..9124,gap(20),
CO   AAHY01071372.1:1..16111,gap(20),complement(AAHY01071373.1:1..41308),
CO   gap(20),complement(AAHY01071374.1:1..18383),gap(20),
CO   complement(AAHY01071375.1:1..31762),gap(70),
CO   complement(AAHY01071376.1:1..45247),gap(20),
CO   complement(AAHY01071377.1:1..2641),gap(20),AAHY01071378.1:1..13889,gap(20),
CO   AAHY01071379.1:1..4285,gap(424),complement(AAHY01071380.1:1..14665),
CO   gap(317),complement(AAHY01071381.1:1..30536),gap(20),
CO   complement(AAHY01071382.1:1..11585),gap(91),
CO   complement(AAHY01071383.1:1..17159),gap(113),AAHY01071384.1:1..27921,
CO   gap(311),complement(AAHY01071385.1:1..47147),gap(5709),
CO   AAHY01071386.1:1..24081,gap(100),complement(AAHY01071387.1:1..17425),
CO   gap(20),AAHY01071388.1:1..6795,gap(3372),AAHY01071389.1:1..56174,gap(764),
CO   complement(AAHY01071390.1:1..27280),gap(3276),AAHY01071391.1:1..13985,
CO   gap(61),complement(AAHY01071392.1:1..54666),gap(20),
CO   AAHY01071393.1:1..18631,gap(184),complement(AAHY01071394.1:1..15992),
CO   gap(20),AAHY01071395.1:1..63996,gap(127),AAHY01071396.1:1..35153,gap(132),
CO   complement(AAHY01071397.1:1..4613),gap(56),
CO   complement(AAHY01071398.1:1..2852),gap(126),AAHY01071399.1:1..2596,
CO   gap(162),complement(AAHY01071400.1:1..2500),gap(20),
CO   AAHY01071401.1:1..44139,gap(222),AAHY01071402.1:1..97845,gap(20),
CO   AAHY01071403.1:1..44523,gap(2119),AAHY01071404.1:1..6585,gap(278),
CO   AAHY01071405.1:1..35134,gap(2166),AAHY01071406.1:1..7404,gap(20),
CO   AAHY01071407.1:1..14574,gap(574),AAHY01071408.1:1..15367,gap(20),
CO   AAHY01071409.1:1..4521,gap(49),AAHY01071410.1:1..9994,gap(20),
CO   AAHY01071411.1:1..1393,gap(4110),complement(AAHY01071412.1:1..8074),
CO   gap(439),complement(AAHY01071413.1:1..6063),gap(20),AAHY01071414.1:1..5402,
CO   gap(20),AAHY01071415.1:1..32472,gap(1666),AAHY01071416.1:1..13511,gap(215),
CO   complement(AAHY01071417.1:1..20231),gap(74),AAHY01071418.1:1..13710,
CO   gap(67),AAHY01071419.1:1..6174,gap(20),AAHY01071420.1:1..4608,gap(20),
CO   AAHY01071421.1:1..6129,gap(20),AAHY01071422.1:1..9762,gap(199),
CO   AAHY01071423.1:1..6184,gap(20),AAHY01071424.1:1..17183,gap(20),
CO   AAHY01071425.1:1..74381,gap(368),AAHY01071426.1:1..3465,gap(2945),
CO   AAHY01071427.1:1..10597,gap(74),AAHY01071428.1:1..1666,gap(300),
CO   AAHY01071429.1:1..4137,gap(20520),AAHY01071430.1:1..16998,gap(20),
CO   AAHY01071431.1:1..5301,gap(20),AAHY01071432.1:1..41677,gap(20),
CO   AAHY01071433.1:1..18517,gap(20),AAHY01071434.1:1..3060,gap(20),
CO   AAHY01071435.1:1..11662,gap(20),AAHY01071436.1:1..1982,gap(20),
CO   AAHY01071437.1:1..5376,gap(20),AAHY01071438.1:1..19423,gap(51),
CO   AAHY01071439.1:1..30655,gap(20),AAHY01071440.1:1..39138,gap(51),
CO   AAHY01071441.1:1..7447,gap(131),AAHY01071442.1:1..7731,gap(2159),
CO   AAHY01071443.1:1..3939,gap(20),AAHY01071444.1:1..2429,gap(20),
CO   complement(AAHY01071445.1:1..10835),gap(413),
CO   complement(AAHY01071446.1:1..1492),gap(20),AAHY01071447.1:1..6641,gap(20),
CO   AAHY01071448.1:1..1156,gap(20),AAHY01071449.1:1..24283,gap(4575),
CO   AAHY01071450.1:1..23907,gap(22),AAHY01071451.1:1..43115,gap(20),
CO   AAHY01071452.1:1..4155,gap(477),complement(AAHY01071453.1:1..7415),gap(20),
CO   complement(AAHY01071454.1:1..2632),gap(6170),AAHY01071455.1:1..1863,
CO   gap(6526),AAHY01071456.1:1..7064,gap(20),AAHY01071457.1:1..7341,gap(517),
CO   AAHY01071458.1:1..21858,gap(20),complement(AAHY01071459.1:1..1665),gap(20),
CO   AAHY01071460.1:1..5371,gap(20),complement(AAHY01071461.1:1..3572),gap(20),
CO   AAHY01071462.1:1..1551,gap(20),AAHY01071463.1:1..2918,gap(38),
CO   AAHY01071464.1:1..17404,gap(1144),AAHY01071465.1:1..29473,gap(20),
CO   complement(AAHY01071466.1:1..6134),gap(216),AAHY01071467.1:1..3822,gap(66),
CO   AAHY01071468.1:1..52738,gap(20),AAHY01071469.1:1..30361,gap(3121),
CO   complement(AAHY01071470.1:1..11835),gap(550),
CO   complement(AAHY01071471.1:1..35123),gap(361),
CO   complement(AAHY01071472.1:1..27465),gap(453),AAHY01071473.1:1..781,
CO   gap(2754),AAHY01071474.1:1..6238,gap(5819),AAHY01071475.1:1..51833,
CO   gap(202),AAHY01071476.1:1..10128,gap(87),
CO   complement(AAHY01071477.1:1..7459),gap(20),AAHY01071478.1:1..19598,gap(20),
CO   AAHY01071479.1:1..17336,gap(7566),AAHY01071480.1:1..11593,gap(3858),
CO   complement(AAHY01071481.1:1..1690),gap(20),
CO   complement(AAHY01071482.1:1..12808),gap(20),
CO   complement(AAHY01071483.1:1..12458),gap(20),AAHY01071484.1:1..9275,
CO   gap(144),AAHY01071485.1:1..3609,gap(345),AAHY01071486.1:1..37763,gap(118),
CO   AAHY01071487.1:1..59722,gap(745),AAHY01071488.1:1..7188,gap(23),
CO   AAHY01071489.1:1..33102,gap(20),AAHY01071490.1:1..35270,gap(35),
CO   AAHY01071491.1:1..13541,gap(129),AAHY01071492.1:1..8661,gap(202),
CO   complement(AAHY01071493.1:1..2617),gap(20),AAHY01071494.1:1..2493,gap(20),
CO   AAHY01071495.1:1..20020,gap(219),AAHY01071496.1:1..58550,gap(32),
CO   AAHY01071497.1:1..40597,gap(503),AAHY01071498.1:1..15759,gap(57),
CO   AAHY01071499.1:1..26675,gap(20),AAHY01071500.1:1..18582,gap(413),
CO   complement(AAHY01071501.1:1..1199),gap(20),AAHY01071502.1:1..33677,gap(44),
CO   AAHY01071503.1:1..18107,gap(3723),AAHY01071504.1:1..24991,gap(20),
CO   AAHY01071505.1:1..19058,gap(20),AAHY01071506.1:1..21880,gap(239),
CO   AAHY01071507.1:1..13217,gap(20),AAHY01071508.1:1..7343,gap(234),
CO   AAHY01071509.1:1..1626,gap(1425),AAHY01071510.1:1..2512,gap(20),
CO   AAHY01071511.1:1..6859,gap(20),AAHY01071512.1:1..11014,gap(20),
CO   AAHY01071513.1:1..9451,gap(70),complement(AAHY01071514.1:1..4271),gap(131),
CO   AAHY01071515.1:1..9622,gap(143),AAHY01071516.1:1..11958,gap(189),
CO   complement(AAHY01071517.1:1..591),gap(147),AAHY01071518.1:1..15138,
CO   gap(559),AAHY01071519.1:1..3057,gap(2380),AAHY01071520.1:1..3677,gap(1185),
CO   AAHY01071521.1:1..37033,gap(40),AAHY01071522.1:1..23873,gap(120),
CO   AAHY01071523.1:1..6084,gap(20),complement(AAHY01071524.1:1..18609),gap(20),
CO   AAHY01071525.1:1..5172,gap(20),AAHY01071526.1:1..4300,gap(20),
CO   complement(AAHY01071527.1:1..1114),gap(20),
CO   complement(AAHY01071528.1:1..1088),gap(618),
CO   complement(AAHY01071529.1:1..2641),gap(300),AAHY01071530.1:1..627,gap(934),
CO   AAHY01071531.1:1..4528,gap(76),AAHY01071532.1:1..17078,gap(3268),
CO   complement(AAHY01071533.1:1..1396),gap(20),AAHY01071534.1:1..1645,
CO   gap(1877),AAHY01071535.1:1..28931,gap(48),AAHY01071536.1:1..29171,gap(20),
CO   AAHY01071537.1:1..6032,gap(20),AAHY01071538.1:1..5222,gap(205),
CO   complement(AAHY01071539.1:1..12801),gap(20),AAHY01071540.1:1..26282,
CO   gap(20),AAHY01071541.1:1..19841,gap(43),AAHY01071542.1:1..33778,gap(35),
CO   AAHY01071543.1:1..9561,gap(300),AAHY01071544.1:1..19954,gap(135),
CO   complement(AAHY01071545.1:1..5771),gap(20),
CO   complement(AAHY01071546.1:1..1443),gap(20),AAHY01071547.1:1..1718,gap(20),
CO   AAHY01071548.1:1..1768,gap(20),AAHY01071549.1:1..28350,gap(20),
CO   AAHY01071550.1:1..2126,gap(7317),AAHY01071551.1:1..1683,gap(20),
CO   AAHY01071552.1:1..2159,gap(117),AAHY01071553.1:1..1610,gap(20),
CO   AAHY01071554.1:1..5132,gap(176),AAHY01071555.1:1..355,gap(554),
CO   AAHY01071556.1:1..29583,gap(406),AAHY01071557.1:1..1004,gap(518),
CO   AAHY01071558.1:1..6871,gap(370),AAHY01071559.1:1..5563,gap(84),
CO   AAHY01071560.1:1..45061,gap(226),complement(AAHY01071561.1:1..22213),
CO   gap(20),AAHY01071562.1:1..9175,gap(638),AAHY01071563.1:1..31564,gap(20),
CO   complement(AAHY01071564.1:1..7354),gap(20),
CO   complement(AAHY01071565.1:1..1792),gap(20),AAHY01071566.1:1..3990,gap(20),
CO   AAHY01071567.1:1..11100,gap(747),complement(AAHY01071568.1:1..3280),
CO   gap(20),AAHY01071569.1:1..10706,gap(20),AAHY01071570.1:1..10320,gap(202),
CO   complement(AAHY01071571.1:1..5856),gap(20),
CO   complement(AAHY01071572.1:1..8045),gap(50),AAHY01071573.1:1..19654,
CO   gap(293),AAHY01071574.1:1..8845,gap(83),AAHY01071575.1:1..13062,gap(4679),
CO   complement(AAHY01071576.1:1..2950),gap(1100),
CO   complement(AAHY01071577.1:1..2015),gap(24),
CO   complement(AAHY01071578.1:1..14919),gap(20),
CO   complement(AAHY01071579.1:1..27706),gap(422),
CO   complement(AAHY01071580.1:1..11962),gap(20),AAHY01071581.1:1..13161,
CO   gap(1285),AAHY01071582.1:1..34752,gap(20),AAHY01071583.1:1..20236,gap(64),
CO   complement(AAHY01071584.1:1..832),gap(20),AAHY01071585.1:1..24425,gap(148),
CO   AAHY01071586.1:1..18354,gap(20),complement(AAHY01071587.1:1..8440),
CO   gap(6515),AAHY01071588.1:1..1334,gap(20),AAHY01071589.1:1..1574,gap(2948),
CO   AAHY01071590.1:1..3426,gap(20),AAHY01071591.1:1..5748,gap(20),
CO   AAHY01071592.1:1..8494,gap(1456),AAHY01071593.1:1..35770,gap(654),
CO   AAHY01071594.1:1..1218,gap(20),AAHY01071595.1:1..4836,gap(265),
CO   AAHY01071596.1:1..2788,gap(20),AAHY01071597.1:1..1303,gap(20),
CO   complement(AAHY01071598.1:1..15345),gap(20),
CO   complement(AAHY01071599.1:1..1067),gap(20),
CO   complement(AAHY01071600.1:1..5654),gap(20),AAHY01071601.1:1..1017,gap(20),
CO   complement(AAHY01071602.1:1..894),gap(20),AAHY01071603.1:1..2360,gap(20),
CO   AAHY01071604.1:1..7726,gap(20),complement(AAHY01071605.1:1..23368),
CO   gap(332),AAHY01071606.1:1..6198,gap(4544),AAHY01071607.1:1..5719,gap(20),
CO   AAHY01071608.1:1..8471,gap(986),AAHY01071609.1:1..1394,gap(1675),
CO   AAHY01071610.1:1..36973,gap(588),AAHY01071611.1:1..1733,gap(3074),
CO   AAHY01071612.1:1..6718,gap(148),AAHY01071613.1:1..6326,gap(20),
CO   AAHY01071614.1:1..18353,gap(702),AAHY01071615.1:1..2972,gap(1809),
CO   AAHY01071616.1:1..1201,gap(1477),AAHY01071617.1:1..1507,gap(2144),
CO   AAHY01071618.1:1..3510,gap(1001),AAHY01071619.1:1..3235,gap(20),
CO   complement(AAHY01071620.1:1..12559),gap(734),
CO   complement(AAHY01071621.1:1..1756),gap(20),AAHY01071622.1:1..1170,gap(20),
CO   AAHY01071623.1:1..2715,gap(20),AAHY01071624.1:1..2166,gap(255),
CO   complement(AAHY01071625.1:1..1119),gap(20),
CO   complement(AAHY01071626.1:1..2635),gap(20),AAHY01071627.1:1..33183,gap(20),
CO   complement(AAHY01071628.1:1..1103),gap(20),AAHY01071629.1:1..2938,gap(169),
CO   AAHY01071630.1:1..2560,gap(20),AAHY01071631.1:1..3891,gap(20),
CO   AAHY01071632.1:1..7398,gap(20),AAHY01071633.1:1..4095,gap(20),
CO   AAHY01071634.1:1..56528,gap(388),AAHY01071635.1:1..2678,gap(260),
CO   complement(AAHY01071636.1:1..997),gap(136),AAHY01071637.1:1..12637,gap(20),
CO   AAHY01071638.1:1..6860,gap(208),complement(AAHY01071639.1:1..1767),
CO   gap(418),AAHY01071640.1:1..19307,gap(20),AAHY01071641.1:1..38902,gap(71),
CO   complement(AAHY01071642.1:1..4477),gap(451),
CO   complement(AAHY01071643.1:1..14457),gap(20),
CO   complement(AAHY01071644.1:1..6443),gap(318),AAHY01071645.1:1..12934,
CO   gap(3371),AAHY01071646.1:1..18260,gap(464),AAHY01071647.1:1..57935,gap(20),
CO   AAHY01071648.1:1..2647,gap(20),AAHY01071649.1:1..1914,gap(20),
CO   AAHY01071650.1:1..3875,gap(20),AAHY01071651.1:1..6143,gap(20),
CO   complement(AAHY01071652.1:1..1835),gap(420),AAHY01071653.1:1..3559,gap(20),
CO   AAHY01071654.1:1..60062,gap(20),AAHY01071655.1:1..9605,gap(160),
CO   AAHY01071656.1:1..12503,gap(20),AAHY01071657.1:1..35072,gap(20),
CO   complement(AAHY01071658.1:1..1057),gap(20),AAHY01071659.1:1..2146,gap(20),
CO   complement(AAHY01071660.1:1..1507),gap(20),AAHY01071661.1:1..1911,gap(20),
CO   AAHY01071662.1:1..1091,gap(20),AAHY01071663.1:1..1126,gap(335),
CO   complement(AAHY01071664.1:1..1217),gap(4210),AAHY01071665.1:1..41121,
CO   gap(20),AAHY01071666.1:1..30338,gap(705),AAHY01071667.1:1..94048,gap(20),
CO   complement(AAHY01071668.1:1..2128),gap(20),AAHY01071669.1:1..26170,
CO   gap(619),AAHY01071670.1:1..6283,gap(176),AAHY01071671.1:1..37111,gap(632),
CO   AAHY01071672.1:1..3655,gap(20),AAHY01071673.1:1..42549,gap(45),
CO   AAHY01071674.1:1..26750,gap(20),complement(AAHY01071675.1:1..2008),gap(20),
CO   complement(AAHY01071676.1:1..4220),gap(20),AAHY01071677.1:1..20526,
CO   gap(1479),complement(AAHY01071678.1:1..2227),gap(20),
CO   complement(AAHY01071679.1:1..12037),gap(20),
CO   complement(AAHY01071680.1:1..25128),gap(20),AAHY01071681.1:1..1459,gap(20),
CO   AAHY01071682.1:1..51636,gap(308),AAHY01071683.1:1..12849,gap(20),
CO   AAHY01071684.1:1..20490,gap(20),AAHY01071685.1:1..22310,gap(356),
CO   AAHY01071686.1:1..6340,gap(20),AAHY01071687.1:1..18638,gap(20),
CO   AAHY01071688.1:1..18041,gap(32),AAHY01071689.1:1..7494,gap(2080),
CO   AAHY01071690.1:1..48784,gap(1435),AAHY01071691.1:1..1373,gap(1395),
CO   AAHY01071692.1:1..40806,gap(20),complement(AAHY01071693.1:1..78149),
CO   gap(316),complement(AAHY01071694.1:1..20744),gap(20),
CO   complement(AAHY01071695.1:1..7388),gap(3301),AAHY01071696.1:1..15650,
CO   gap(192),AAHY01071697.1:1..27010,gap(74),
CO   complement(AAHY01071698.1:1..43441),gap(20),AAHY01071699.1:1..17169,
CO   gap(92),AAHY01071700.1:1..1765,gap(39),AAHY01071701.1:1..31318,gap(226),
CO   complement(AAHY01071702.1:1..2410),gap(22),AAHY01071703.1:1..10666,
CO   gap(983),AAHY01071704.1:1..6541,gap(65),AAHY01071705.1:1..41334,gap(45),
CO   complement(AAHY01071706.1:1..11321),gap(67),AAHY01071707.1:1..23929,
CO   gap(20),AAHY01071708.1:1..9235,gap(20),complement(AAHY01071709.1:1..219),
CO   gap(224),complement(AAHY01071710.1:1..12959),gap(150),
CO   AAHY01071711.1:1..20389,gap(21425),AAHY01071712.1:1..24264,gap(277),
CO   complement(AAHY01071713.1:1..1346),gap(5160),AAHY01071714.1:1..16594,
CO   gap(20),AAHY01071715.1:1..30894,gap(463),AAHY01071716.1:1..3768,gap(764),
CO   AAHY01071717.1:1..40566,gap(39),AAHY01071718.1:1..30846,gap(178),
CO   AAHY01071719.1:1..47743,gap(20),AAHY01071720.1:1..19401,gap(20),
CO   AAHY01071721.1:1..9327,gap(255),AAHY01071722.1:1..15398,gap(277),
CO   AAHY01071723.1:1..26574,gap(47),complement(AAHY01071724.1:1..520),gap(20),
CO   AAHY01071725.1:1..100799,gap(35),AAHY01071726.1:1..1116,gap(143),
CO   AAHY01071727.1:1..36621,gap(91),AAHY01071728.1:1..16003,gap(116),
CO   AAHY01071729.1:1..45884,gap(290),AAHY01071730.1:1..26726,gap(31),
CO   complement(AAHY01071731.1:1..10144),gap(20),AAHY01071732.1:1..2707,gap(20),
CO   AAHY01071733.1:1..22728,gap(20),AAHY01071734.1:1..1924,gap(20),
CO   AAHY01071735.1:1..14065,gap(20),complement(AAHY01071736.1:1..49448),
CO   gap(20),complement(AAHY01071737.1:1..4498),gap(41),AAHY01071738.1:1..2547,
CO   gap(20),complement(AAHY01071739.1:1..28922),gap(162),
CO   complement(AAHY01071740.1:1..10025),gap(20),
CO   complement(AAHY01071741.1:1..8604),gap(5298),AAHY01071742.1:1..3965,
CO   gap(255),AAHY01071743.1:1..8402,gap(20),AAHY01071744.1:1..32339,gap(241),
CO   AAHY01071745.1:1..43856,gap(20),AAHY01071746.1:1..27823,gap(140),
CO   AAHY01071747.1:1..29957,gap(356),AAHY01071748.1:1..3117,gap(20),
CO   complement(AAHY01071749.1:1..8651),gap(23),AAHY01071750.1:1..17652,
CO   gap(179),complement(AAHY01071751.1:1..81743),gap(184),
CO   complement(AAHY01071752.1:1..59453),gap(20),AAHY01071753.1:1..1096,
CO   gap(3493),complement(AAHY01071754.1:1..1304),gap(20),
CO   AAHY01071755.1:1..9437,gap(3004),AAHY01071756.1:1..31500,gap(20),
CO   AAHY01071757.1:1..12889,gap(252),complement(AAHY01071758.1:1..6142),
CO   gap(281),AAHY01071759.1:1..8056,gap(119),AAHY01071760.1:1..40060,gap(20),
CO   AAHY01071761.1:1..7626,gap(18234),AAHY01071762.1:1..1198,gap(259),
CO   AAHY01071763.1:1..20152,gap(30),AAHY01071764.1:1..3329,gap(20),
CO   AAHY01071765.1:1..11390,gap(221),AAHY01071766.1:1..20049,gap(20),
CO   complement(AAHY01071767.1:1..1597),gap(1183),AAHY01071768.1:1..25746,
CO   gap(20),complement(AAHY01071769.1:1..2177),gap(20),AAHY01071770.1:1..4741,
CO   gap(938),AAHY01071771.1:1..17092,gap(20),AAHY01071772.1:1..17078,gap(127),
CO   AAHY01071773.1:1..4654,gap(182),AAHY01071774.1:1..11332,gap(20),
CO   AAHY01071775.1:1..7380,gap(200),AAHY01071776.1:1..11541,gap(1170),
CO   AAHY01071777.1:1..13599,gap(20),AAHY01071778.1:1..12588,gap(97),
CO   AAHY01071779.1:1..60727,gap(20),AAHY01071780.1:1..10089,gap(20),
CO   AAHY01071781.1:1..16620,gap(4583),AAHY01071782.1:1..10700,gap(20),
CO   AAHY01071783.1:1..31273,gap(75),AAHY01071784.1:1..4962,gap(20),
CO   AAHY01071785.1:1..1354,gap(20),AAHY01071786.1:1..17551,gap(20),
CO   complement(AAHY01071787.1:1..5338),gap(284),AAHY01071788.1:1..4041,
CO   gap(215),AAHY01071789.1:1..41589,gap(229),AAHY01071790.1:1..5427,gap(20),
CO   AAHY01071791.1:1..6250,gap(20),AAHY01071792.1:1..11379,gap(201),
CO   AAHY01071793.1:1..5978,gap(20),AAHY01071794.1:1..4541,gap(912),
CO   AAHY01071795.1:1..32986,gap(33),AAHY01071796.1:1..30964,gap(706),
CO   AAHY01071797.1:1..4702,gap(377),AAHY01071798.1:1..10670,gap(4075),
CO   AAHY01071799.1:1..2006,gap(20),AAHY01071800.1:1..4230,gap(20),
CO   AAHY01071801.1:1..1323,gap(20),AAHY01071802.1:1..1102,gap(1834),
CO   complement(AAHY01071803.1:1..1570),gap(20),AAHY01071804.1:1..16986,
CO   gap(4370),AAHY01071805.1:1..13707,gap(20),AAHY01071806.1:1..35315,gap(24),
CO   AAHY01071807.1:1..59456,gap(166),AAHY01071808.1:1..14758,gap(20),
CO   AAHY01071809.1:1..29073,gap(544),AAHY01071810.1:1..1889,gap(773),
CO   AAHY01071811.1:1..10463,gap(901),AAHY01071812.1:1..6885,gap(20),
CO   AAHY01071813.1:1..37355,gap(20),complement(AAHY01071814.1:1..1756),gap(20),
CO   AAHY01071815.1:1..8004,gap(2161),AAHY01071816.1:1..34967,gap(20),
CO   AAHY01071817.1:1..29127,gap(20),AAHY01071818.1:1..26920,gap(20),
CO   AAHY01071819.1:1..23789,gap(20),complement(AAHY01071820.1:1..4089),
CO   gap(247),complement(AAHY01071821.1:1..9503),gap(20),
CO   complement(AAHY01071822.1:1..1410),gap(20),
CO   complement(AAHY01071823.1:1..1260),gap(2518),AAHY01071824.1:1..52836,
CO   gap(20),AAHY01071825.1:1..9534,gap(20),AAHY01071826.1:1..29126,gap(465),
CO   AAHY01071827.1:1..5573,gap(20),AAHY01071828.1:1..1355,gap(2327),
CO   AAHY01071829.1:1..8394,gap(572),AAHY01071830.1:1..28333,gap(290),
CO   AAHY01071831.1:1..879,gap(270),complement(AAHY01071832.1:1..3007),gap(186),
CO   complement(AAHY01071833.1:1..1431),gap(20),AAHY01071834.1:1..2223,gap(20),
CO   complement(AAHY01071835.1:1..17333),gap(20),AAHY01071836.1:1..16331,
CO   gap(20),AAHY01071837.1:1..9540,gap(20),complement(AAHY01071838.1:1..10771),
CO   gap(99),AAHY01071839.1:1..17783,gap(20),AAHY01071840.1:1..16747,gap(166),
CO   AAHY01071841.1:1..2137,gap(20),AAHY01071842.1:1..1549,gap(20),
CO   AAHY01071843.1:1..2379,gap(1975),AAHY01071844.1:1..3097,gap(186),
CO   complement(AAHY01071845.1:1..3021),gap(20),
CO   complement(AAHY01071846.1:1..2199),gap(20),
CO   complement(AAHY01071847.1:1..1007),gap(3579),AAHY01071848.1:1..2348,
CO   gap(107),AAHY01071849.1:1..4967,gap(2076),AAHY01071850.1:1..13203,gap(20),
CO   AAHY01071851.1:1..1794,gap(1062),AAHY01071852.1:1..1078,gap(1470),
CO   AAHY01071853.1:1..4499,gap(85315),AAHY01071854.1:1..24353,gap(22232),
CO   AAHY01071855.1:1..18037,gap(89),AAHY01071856.1:1..1624,gap(921),
CO   AAHY01071857.1:1..6788,gap(182),AAHY01071858.1:1..5627,gap(20),
CO   AAHY01071859.1:1..68868,gap(241),AAHY01071860.1:1..113072,gap(268),
CO   AAHY01071861.1:1..2467,gap(583),AAHY01071862.1:1..49393,gap(20),
CO   AAHY01071863.1:1..4241,gap(20),AAHY01071864.1:1..1128,gap(20),
CO   AAHY01071865.1:1..3194,gap(5047),AAHY01071866.1:1..13009,gap(20),
CO   complement(AAHY01071867.1:1..43886),gap(20),AAHY01071868.1:1..32296,
CO   gap(20),AAHY01071869.1:1..75512,gap(20),AAHY01071870.1:1..2894,gap(20),
CO   AAHY01071871.1:1..45916,gap(286),AAHY01071872.1:1..37620,gap(4223),
CO   AAHY01071873.1:1..77649,gap(20),AAHY01071874.1:1..38004,gap(1515),
CO   AAHY01071875.1:1..231904,gap(20),AAHY01071876.1:1..176468,gap(20),
CO   AAHY01071877.1:1..111449,gap(20),AAHY01071878.1:1..5809,gap(20),
CO   AAHY01071879.1:1..201198,gap(20),AAHY01071880.1:1..17850,gap(323),
CO   complement(AAHY01071881.1:1..1106),gap(2658),AAHY01071882.1:1..2625,
CO   gap(160),AAHY01071883.1:1..1577,gap(20),AAHY01071884.1:1..6113,gap(20),
CO   complement(AAHY01071885.1:1..2467),gap(1517),AAHY01071886.1:1..1663,
CO   gap(20),AAHY01071887.1:1..2763,gap(572),AAHY01071888.1:1..2233,gap(16080),
CO   AAHY01071889.1:1..13709,gap(20),AAHY01071890.1:1..16501,gap(20),
CO   AAHY01071891.1:1..10070,gap(3146),AAHY01071892.1:1..20735,gap(1538),
CO   AAHY01071893.1:1..2795,gap(62),AAHY01071894.1:1..2478,gap(1152),
CO   AAHY01071895.1:1..1466,gap(1458),AAHY01071896.1:1..2254,gap(697),
CO   AAHY01071897.1:1..1579,gap(20),AAHY01071898.1:1..26380,gap(72198),
CO   AAHY01071899.1:1..2653,gap(20),AAHY01071900.1:1..1451,gap(20),
CO   AAHY01071901.1:1..1450,gap(1235),AAHY01071902.1:1..6500,gap(147),
CO   AAHY01071903.1:1..29956,gap(20),AAHY01071904.1:1..112326,gap(20),
CO   AAHY01071905.1:1..56546,gap(2428),complement(AAHY01071906.1:1..953),
CO   gap(1237),AAHY01071907.1:1..1822,gap(767),AAHY01071908.1:1..42295,
CO   gap(2874),AAHY01071909.1:1..69824,gap(20),AAHY01071910.1:1..5800,gap(20),
CO   AAHY01071911.1:1..75835,gap(710),AAHY01071912.1:1..109335,gap(20),
CO   AAHY01071913.1:1..5844,gap(665),AAHY01071914.1:1..2198,gap(765),
CO   AAHY01071915.1:1..18260)
//


spacer
spacer