spacer

EBI Dbfetch

ID   CH466568; SV 2; linear; genomic DNA; CON; MUS; 16236396 BP.
XX
AC   CH466568;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
XX
DE   Mus musculus 232000009780170 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-16236396
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-16236396
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-16236396
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; bd4ec548070bb8105f50dc29c26109c0.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000221.
DR   Ensembl-Gn; ENSMUSG00000015533; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021693; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021694; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021699; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021700; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021701; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021718; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021721; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021756; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042258; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042379; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042417; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074651; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022212; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022232; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022235; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036060; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038144; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038404; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056117; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070731; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092089; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120672; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122041; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123182; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123657; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129117; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152634; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177907; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70978843.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..16236396
FT                   /organism="Mus musculus"
FT                   /chromosome="13"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    8256..8290
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    17624..17715
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   gene            complement(21178..>22153)
FT                   /locus_tag="mCG_53909"
FT                   /note="gene_id=mCG53909.2"
FT   mRNA            complement(join(21178..21228,21840..>22153))
FT                   /locus_tag="mCG_53909"
FT                   /product="mCG53909"
FT                   /note="gene_id=mCG53909.2 transcript_id=mCT54092.2 created
FT                   on 26-FEB-2003"
FT   CDS             complement(join(21219..21228,21840..22153))
FT                   /codon_start=1
FT                   /locus_tag="mCG_53909"
FT                   /product="mCG53909"
FT                   /note="gene_id=mCG53909.2 transcript_id=mCT54092.2
FT                   protein_id=mCP41983.2"
FT                   /protein_id="EDL18515.1"
FT                   /translation="MVVSLAPLGPPYSAVQWDGELTDDLHWTATLRGHGCWTATLRGHG
FT                   CWTANPPRARLLDCEPSEGTAAGLRPSEGTAAGLQPSEGTAAGFSLTFSTWQVAQAYPH
FT                   CAP"
FT   assembly_gap    25811..26087
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    34979..34998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    58152..58171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    61418..61438
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    78406..78577
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    80994..81013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    84335..84540
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    99602..99621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(104081..136554)
FT                   /locus_tag="mCG_1033004"
FT                   /note="gene_id=mCG1033004.1"
FT   mRNA            complement(join(104081..104375,105711..105990,
FT                   136448..136554))
FT                   /locus_tag="mCG_1033004"
FT                   /product="mCG1033004"
FT                   /note="gene_id=mCG1033004.1 transcript_id=mCT150708.1
FT                   created on 26-FEB-2003"
FT   CDS             complement(104109..104291)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033004"
FT                   /product="mCG1033004"
FT                   /note="gene_id=mCG1033004.1 transcript_id=mCT150708.1
FT                   protein_id=mCP83849.1"
FT                   /protein_id="EDL18514.1"
FT                   /translation="MICSNSDCSVRQAVKRKRKEEGRVWLSCSSICSFSCLDFSCSQFS
FT                   VRLHGPMITDVFSGP"
FT   assembly_gap    115018..115214
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    123252..124026
FT                   /estimated_length=775
FT                   /gap_type="unknown"
FT   assembly_gap    142472..146982
FT                   /estimated_length=4511
FT                   /gap_type="unknown"
FT   assembly_gap    148739..149288
FT                   /estimated_length=550
FT                   /gap_type="unknown"
FT   assembly_gap    151302..151367
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   gene            complement(168487..>203344)
FT                   /gene="Sfrs12"
FT                   /locus_tag="mCG_17229"
FT                   /note="gene_id=mCG17229.2"
FT   mRNA            complement(join(168487..172683,173752..173896,
FT                   177625..177720,181243..181551,181874..181993,
FT                   186919..187033,187902..188032,189149..189327,
FT                   189763..189927,192615..192739,198050..198183,
FT                   203033..>203344))
FT                   /gene="Sfrs12"
FT                   /locus_tag="mCG_17229"
FT                   /product="splicing factor, arginine/serine-rich 12,
FT                   transcript variant mCT12821"
FT                   /note="gene_id=mCG17229.2 transcript_id=mCT12821.2 created
FT                   on 26-FEB-2003"
FT   mRNA            complement(join(170589..172683,173752..173896,
FT                   177625..177720,181243..181551,181874..181993,
FT                   186919..187033,187902..188032,189149..189327,
FT                   189763..189927,192615..>193237))
FT                   /gene="Sfrs12"
FT                   /locus_tag="mCG_17229"
FT                   /product="splicing factor, arginine/serine-rich 12,
FT                   transcript variant mCT180713"
FT                   /note="gene_id=mCG17229.2 transcript_id=mCT180713.0 created
FT                   on 26-FEB-2003"
FT   mRNA            complement(join(171998..172683,173752..173896,
FT                   177625..177720,181247..181551,181874..181993,
FT                   186919..>189746))
FT                   /gene="Sfrs12"
FT                   /locus_tag="mCG_17229"
FT                   /product="splicing factor, arginine/serine-rich 12,
FT                   transcript variant mCT180715"
FT                   /note="gene_id=mCG17229.2 transcript_id=mCT180715.0 created
FT                   on 26-FEB-2003"
FT   CDS             complement(join(172531..172683,173752..173896,
FT                   177625..177720,181243..181551,181874..181993,
FT                   186919..187033,187902..188032,189149..189327,
FT                   189763..189927,192615..192739,198050..198183,
FT                   203033..>203241))
FT                   /codon_start=1
FT                   /gene="Sfrs12"
FT                   /locus_tag="mCG_17229"
FT                   /product="splicing factor, arginine/serine-rich 12, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG17229.2 transcript_id=mCT12821.2
FT                   protein_id=mCP21956.2 isoform=CRA_d"
FT                   /protein_id="EDL18513.1"
FT                   /translation="RVVDVGEREGSSSEAGMNSGGGFGLGLGFGLFPTTVIQVTNLSSA
FT                   VTSEQMRTLFSFLGEIEELRLYPPDNTPLAFSSKVCYIKFRDPSSVGVAQHLTNTVFID
FT                   RALIVVPCAEGKIPEEAKALSLLAPAPTMTSLVPGAGLLPIPTSSPLTAVSSLGVSLSS
FT                   LGAIPAAALDPNITTLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLNSQTTTADQLLEFF
FT                   KQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVK
FT                   PPEMTPQAAAKELEEVMKRVREAQSFISAAIEPESGKSNERKGGRSRSHTRSKSRSSSK
FT                   SHSRRKRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSRSRDKRKDT
FT                   REKVKERVKEKEREKEREREKDREKDKERGKNKDKDREKEKDHEKERDKEKEKEQDKDK
FT                   EREKDRSKETDEKRKKEKKSRTPPRSYNASRRSRSTSRERRRRRSRSSSRSPRTSKTVK
FT                   RKSSRSPSPRGRNKKEKKREKERDHISDRRERERSTSTKKSSGDRDGKEKVEKSTTPVK
FT                   EKEHSKESDATVSKAADEKGSPRTEDEGKVQHNGNCQPNEESPCSKADAV"
FT   CDS             complement(join(172531..172683,173752..173896,
FT                   177625..177720,181243..181551,181874..181993,
FT                   186919..187033,187902..188032,189149..189327,
FT                   189763..189927,192615..>192761))
FT                   /codon_start=1
FT                   /gene="Sfrs12"
FT                   /locus_tag="mCG_17229"
FT                   /product="splicing factor, arginine/serine-rich 12, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG17229.2 transcript_id=mCT180713.0
FT                   protein_id=mCP103636.0 isoform=CRA_a"
FT                   /protein_id="EDL18510.1"
FT                   /translation="CLELASAGKIPEEAKALSLLAPAPTMTSLVPGAGLLPIPTSSPLT
FT                   AVSSLGVSLSSLGAIPAAALDPNITTLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLNSQ
FT                   TTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPL
FT                   KINHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPESGKSNERKGGRSRS
FT                   HTRSKSRSSSKSHSRRKRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRS
FT                   RSRSRDKRKDTREKVKERVKEKEREKEREREKDREKDKERGKNKDKDREKEKDHEKERD
FT                   KEKEKEQDKDKEREKDRSKETDEKRKKEKKSRTPPRSYNASRRSRSTSRERRRRRSRSS
FT                   SRSPRTSKTVKRKSSRSPSPRGRNKKEKKREKERDHISDRRERERSTSTKKSSGDRDGK
FT                   EKVEKSTTPVKEKEHSKESDATVSKAADEKGSPRTEDEGKVQHNGNCQPNEESPCSKAD
FT                   AV"
FT   CDS             complement(join(172647..172683,173752..173896,
FT                   177625..177720,181247..181551,181874..181993,
FT                   186919..>187094))
FT                   /codon_start=1
FT                   /gene="Sfrs12"
FT                   /locus_tag="mCG_17229"
FT                   /product="splicing factor, arginine/serine-rich 12, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG17229.2 transcript_id=mCT180715.0
FT                   protein_id=mCP103637.0 isoform=CRA_c"
FT                   /protein_id="EDL18512.1"
FT                   /translation="LLIGIFNCSELTLQSGFFLPESGKSNERKGGRSRSHTRSKSRSSS
FT                   KSHSRRKRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSRSRDKRKD
FT                   TREKVKERVKEKEREKEREREKDREKDKERGKNKDKDREKEKDHEKERDKEKEKEQDKD
FT                   KEREKDRSKETDEKRKKEKKSRTPPRSYNASRRSRSTRKGGGGGAGVLPGLQEHQRPSK
FT                   ESLLDLRLPGAEIRKRKREKKNGTTSVTGEKESVLPPQKRVLATETGRRKWRRVPHQLR
FT                   RRNTVKSQMQL"
FT   assembly_gap    176679..176733
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   mRNA            complement(join(181517..181551,181874..181993,
FT                   186919..187221,187902..188032,189149..189327,
FT                   189763..189927,192615..>193766))
FT                   /gene="Sfrs12"
FT                   /locus_tag="mCG_17229"
FT                   /product="splicing factor, arginine/serine-rich 12,
FT                   transcript variant mCT180714"
FT                   /note="gene_id=mCG17229.2 transcript_id=mCT180714.0 created
FT                   on 26-FEB-2003"
FT   assembly_gap    185578..185597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(187172..187221,187902..188032,
FT                   189149..189327,189763..189927,192615..>192761))
FT                   /codon_start=1
FT                   /gene="Sfrs12"
FT                   /locus_tag="mCG_17229"
FT                   /product="splicing factor, arginine/serine-rich 12, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG17229.2 transcript_id=mCT180714.0
FT                   protein_id=mCP103635.0 isoform=CRA_b"
FT                   /protein_id="EDL18511.1"
FT                   /translation="CLELASAGKIPEEAKALSLLAPAPTMTSLVPGAGLLPIPTSSPLT
FT                   AVSSLGVSLSSLGAIPAAALDPNITTLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLNSQ
FT                   TTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPL
FT                   KINHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPGWLHSTSLCNDFLGC
FT                   F"
FT   assembly_gap    213938..213957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    241454..241473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(249247..348790)
FT                   /gene="Erbb2ip"
FT                   /locus_tag="mCG_17227"
FT                   /note="gene_id=mCG17227.2"
FT   mRNA            complement(join(249247..251380,253385..253459,
FT                   253888..253980,255294..255500,258482..258598,
FT                   264072..265602,269881..270064,271728..271842,
FT                   274031..274207,275388..275561,276078..276199,
FT                   281177..281276,285251..285320,287420..287535,
FT                   287836..287965,288276..288348,289780..289924,
FT                   290475..290549,292692..292755,297067..297123,
FT                   298848..298937,299631..299709,315267..315384,
FT                   317265..317462,320362..320409,347822..348220,
FT                   348324..348790))
FT                   /gene="Erbb2ip"
FT                   /locus_tag="mCG_17227"
FT                   /product="Erbb2 interacting protein"
FT                   /note="gene_id=mCG17227.2 transcript_id=mCT16177.2 created
FT                   on 13-NOV-2002"
FT   CDS             complement(join(251273..251380,253385..253459,
FT                   253888..253980,255294..255500,258482..258598,
FT                   264072..265602,269881..270064,271728..271842,
FT                   274031..274207,275388..275561,276078..276199,
FT                   281177..281276,285251..285320,287420..287535,
FT                   287836..287965,288276..288348,289780..289924,
FT                   290475..290549,292692..292755,297067..297123,
FT                   298848..298937,299631..299709,315267..315384,
FT                   317265..317453))
FT                   /codon_start=1
FT                   /gene="Erbb2ip"
FT                   /locus_tag="mCG_17227"
FT                   /product="Erbb2 interacting protein"
FT                   /note="gene_id=mCG17227.2 transcript_id=mCT16177.2
FT                   protein_id=mCP21946.2"
FT                   /db_xref="GOA:B7ZNY4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="MGI:MGI:1890169"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZNY4"
FT                   /protein_id="EDL18509.1"
FT                   /translation="MTTKRSLFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFE
FT                   KTLEELYLDANQIEELPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLRELDVSKNGI
FT                   QEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKL
FT                   QILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLREFWMDGNRLTFI
FT                   PGFIGSLRQLTYLDVSKNNIEMVEEGISTCENLQDFLLSSNSLQQLPETIGSLKNVTTL
FT                   KIDENQLMYLPDSIGGLRSIEELDCSFNEIEALPSSIGQLTNMRTFAADHNYLQQLPPE
FT                   IGNWKNITVLFLHCNKLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLS
FT                   DNQSKPLIPLQKETDTETQKMVLTNYMFPQQPRTEDVMFISDNESFNPALWEEQRKQRA
FT                   QVAFECDEDKDEREAPPREGNLKRYPTPYPDELKNMVKTVQTIVHRLKDEETNEESGRD
FT                   LKQHEDQQVVNKDKCVKTSESTTTKSKLDEREKYMNSVQKMSEPEAETNGGNLPVTASM
FT                   KLSGNLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIESSINQPKVVALSNNKKDDAK
FT                   DADSLSDEVTHNSNQNNSNCSSPSRMSDSVSLNTDSSQDTSLCSPVKQTPVDSNSKVRQ
FT                   EDENFNSLLQNGVNLNNSPEEKFKINDKKDFKLPEYDLNIEEQLVLIEKDIDSKATSDD
FT                   SRQLDHINMNINKLVTNNIFQPEVMERSKMQDIVLGTGFLSIHPKNEAEHIENGAKCPN
FT                   LESINKVNGLCEDTAPSPGRVEPQKASSSADVGISKSTEDLSPQRSGPTGAVVKSHSIT
FT                   NMETGGLKIYDILGDDGPQPPSAAVKIASAVDGKNIVRSKSATLLYDQPLQVFTAASSS
FT                   SELLSGTKAVFKFDSNHNPEEPDIIRAATVSGPQSTPHLYGPPQYNVQYSGSATVKDTL
FT                   WHPKQNPQIDPVSFPPQRLPRSESAENHSYAKHSANMNFSNHNNVRANTGYHLQQRLAP
FT                   ARHGEMWAISPNDRLVPAVTRTTIQRQSSVSSTASVNLGDPTRRTEGDYLSYRELHSMG
FT                   RTPVMSGSQRPLSARAYSIDGPNTSRPQSARPSINEIPERTMSVSDFNYSRTSPSKRPN
FT                   TRVGSEHSLLDPPGKSKVPHDWREQVLRHIEAKKLEKHPQTSSPGECCQDDRFMSEEQN
FT                   HPSGALSHRGLPDSLMKMPLSNGQMGQPLRPQAHYSQTHHPPQASVARHPSREQLIDYL
FT                   MLKVAHQPPYTHPHCSPRQGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDG
FT                   IFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFHNAVDLIIVREVSS
FT                   "
FT   assembly_gap    277333..278029
FT                   /estimated_length=697
FT                   /gap_type="unknown"
FT   assembly_gap    297883..297902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    310235..310254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    348226..348312
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    348804..348832
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   gene            complement(365803..387211)
FT                   /locus_tag="mCG_147609"
FT                   /note="gene_id=mCG147609.0"
FT   mRNA            complement(join(365803..366752,387121..387211))
FT                   /locus_tag="mCG_147609"
FT                   /product="mCG147609"
FT                   /note="gene_id=mCG147609.0 transcript_id=mCT187872.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(365846..365959)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147609"
FT                   /product="mCG147609"
FT                   /note="gene_id=mCG147609.0 transcript_id=mCT187872.0
FT                   protein_id=mCP108833.0"
FT                   /protein_id="EDL18508.1"
FT                   /translation="MWSLPNYINFLSLSYFHIQKEKKKNNGIYLLEILSDM"
FT   assembly_gap    370417..370587
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    386731..386820
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    402425..402568
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    406684..406703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    411991..412098
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    415147..419649
FT                   /estimated_length=4503
FT                   /gap_type="unknown"
FT   assembly_gap    421197..421216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    429643..429935
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   gene            complement(440429..>527311)
FT                   /gene="Nln"
FT                   /locus_tag="mCG_17234"
FT                   /note="gene_id=mCG17234.1"
FT   mRNA            complement(join(440429..442453,453042..453178,
FT                   454357..454485,454801..454987,463690..463891,
FT                   467996..468362,470005..470140,476248..476408,
FT                   476974..477076,479252..479359,486703..486851,
FT                   490271..490530,527125..>527311))
FT                   /gene="Nln"
FT                   /locus_tag="mCG_17234"
FT                   /product="neurolysin (metallopeptidase M3 family)"
FT                   /note="gene_id=mCG17234.1 transcript_id=mCT12824.2 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(442319..442453,453042..453178,
FT                   454357..454485,454801..454987,463690..463891,
FT                   467996..468362,470005..470140,476248..476408,
FT                   476974..477076,479252..479359,486703..486851,
FT                   490271..490530,527125..>527309))
FT                   /codon_start=1
FT                   /gene="Nln"
FT                   /locus_tag="mCG_17234"
FT                   /product="neurolysin (metallopeptidase M3 family)"
FT                   /note="gene_id=mCG17234.1 transcript_id=mCT12824.2
FT                   protein_id=mCP21933.2"
FT                   /protein_id="EDL18507.1"
FT                   /translation="WLAASVSRSGLLRSARSRLPGSQTPPPASCTYQAGGPRASCCRPP
FT                   GLPMITLCLSALRGLHRAGGSRIRLRMTLGREAASPLQAMSSYTAAGRNVLRWDLSPEQ
FT                   IRTRTEELIAQTKQVYDTVGTINLEDVTYENCLQVLADIEVKYIVERTMLDFPQHVSSD
FT                   REVRAASTEADKRLSRFDIEMSMREDVFQRIVHLQETCDLEKIKPEARRYLEKSIKMGK
FT                   RNGLHLPEHVKNEIKSMKKRMSELCIDFNKNLNEDDTSLVFSKAELGALPDDFIDSLEK
FT                   TDEDKYKVTLKYPHYFPVMKKCCVPETRRKMEMAFHTRCKEENTIILQQLLPLRAQVAK
FT                   LLGYNTHADFVLELNTAKSTSHVATFLDDLSQKLKPLGEAEREFILSLKKKECEERGFA
FT                   YDGKINAWDLHYYMTQTEELKYSVDQESLKEYFPIEVVTEGLLSIYQELLGLSFEQVAD
FT                   AHVWNKSVSLYTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMSV
FT                   AALVVNFSQPIAGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVP
FT                   SQMLENWVWDIDSLRKLSKHYRDGHPITDELLEKLVASRLVNTGLLTLRQIVLSKVDQS
FT                   LHTNASLDAASEYAKYCTEILGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDM
FT                   FHSCFRKEGIMNPEVGMKYRNLILKPGGSLDGMDMLQNFLQREPNQKAFLMSRGLNAS"
FT   assembly_gap    447980..448143
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    512391..512410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            527461..559366
FT                   /gene="Sgtb"
FT                   /locus_tag="mCG_17231"
FT                   /note="gene_id=mCG17231.3"
FT   mRNA            join(527461..527678,528779..528898,536028..536131,
FT                   539394..539463,542122..542221,547204..547308,
FT                   549896..550034,550125..550187,552563..552600,
FT                   552799..552882,557667..559366)
FT                   /gene="Sgtb"
FT                   /locus_tag="mCG_17231"
FT                   /product="small glutamine-rich tetratricopeptide repeat
FT                   (TPR)-containing, beta, transcript variant mCT12823"
FT                   /note="gene_id=mCG17231.3 transcript_id=mCT12823.3 created
FT                   on 13-JUN-2003"
FT   CDS             join(528799..528898,536028..536131,539394..539463,
FT                   542122..542221,547204..547308,549896..550034,
FT                   550125..550187,552563..552600,552799..552882,
FT                   557667..557778)
FT                   /codon_start=1
FT                   /gene="Sgtb"
FT                   /locus_tag="mCG_17231"
FT                   /product="small glutamine-rich tetratricopeptide repeat
FT                   (TPR)-containing, beta, isoform CRA_a"
FT                   /note="gene_id=mCG17231.3 transcript_id=mCT12823.3
FT                   protein_id=mCP21932.3 isoform=CRA_a"
FT                   /protein_id="EDL18505.1"
FT                   /translation="MSSVKPLVYAVIRFLREQSQMDAYTSDEQESLEVAIQCLETVFKI
FT                   SPEDTHLAVSQPLTEMFTNSVCKNDIRPLSNSVPEDVGKADQLKDEGNNHMKEENYAAA
FT                   VDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLAL
FT                   TAMNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTGLSFDMASLINNP
FT                   AFITMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQNP
FT                   ELIEQLRNHIRSRSFSSSADEHS"
FT   mRNA            join(<528803..528898,539394..539463,542122..542221,
FT                   547204..547308,549896..550034,550125..550187,
FT                   552563..552600,552799..552882,557667..>557725)
FT                   /gene="Sgtb"
FT                   /locus_tag="mCG_17231"
FT                   /product="small glutamine-rich tetratricopeptide repeat
FT                   (TPR)-containing, beta, transcript variant mCT191198"
FT                   /note="gene_id=mCG17231.3 transcript_id=mCT191198.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<528821..528898,539394..539463,542122..542221,
FT                   547204..547308,549896..550034,550125..550187,
FT                   552563..552600,552799..552882,557667..>557725)
FT                   /codon_start=1
FT                   /gene="Sgtb"
FT                   /locus_tag="mCG_17231"
FT                   /product="small glutamine-rich tetratricopeptide repeat
FT                   (TPR)-containing, beta, isoform CRA_b"
FT                   /note="gene_id=mCG17231.3 transcript_id=mCT191198.0
FT                   protein_id=mCP112160.0 isoform=CRA_b"
FT                   /protein_id="EDL18506.1"
FT                   /translation="FMQLFVSCGNKVRWMHILLMNKKVWKNDIRPLSNSVPEDVGKADQ
FT                   LKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAI
FT                   AIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSS
FT                   PTGTGLSFDMASLINNPAFITMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSS
FT                   LIQAGQQFAQQIQQQNPELIEQL"
FT   assembly_gap    556404..556423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(561224..597865)
FT                   /gene="2410002O22Rik"
FT                   /locus_tag="mCG_17232"
FT                   /note="gene_id=mCG17232.2"
FT   mRNA            complement(join(561224..562172,562335..562485,
FT                   566560..566660,567399..567597,569328..569461,
FT                   571451..571468,573591..573635,574132..574204,
FT                   580279..580406,586233..586317,587874..587973,
FT                   589231..589299,597530..597861))
FT                   /gene="2410002O22Rik"
FT                   /locus_tag="mCG_17232"
FT                   /product="RIKEN cDNA 2410002O22, transcript variant
FT                   mCT12826"
FT                   /note="gene_id=mCG17232.2 transcript_id=mCT12826.2 created
FT                   on 13-NOV-2002"
FT   mRNA            complement(join(561268..562172,562335..562485,
FT                   566560..566660,567399..567597,569328..569461,
FT                   573591..573635,574132..574204,580279..580406,
FT                   586233..586317,587874..587973,589231..589299,
FT                   597530..>597864))
FT                   /gene="2410002O22Rik"
FT                   /locus_tag="mCG_17232"
FT                   /product="RIKEN cDNA 2410002O22, transcript variant
FT                   mCT191199"
FT                   /note="gene_id=mCG17232.2 transcript_id=mCT191199.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(562065..562172,562335..562485,
FT                   566560..566660,567399..567597,569328..569461,
FT                   573591..573635,574132..574204,580279..580406,
FT                   586233..586317,587874..587973,589231..589299,
FT                   597530..>597617))
FT                   /codon_start=1
FT                   /gene="2410002O22Rik"
FT                   /locus_tag="mCG_17232"
FT                   /product="RIKEN cDNA 2410002O22, isoform CRA_c"
FT                   /note="gene_id=mCG17232.2 transcript_id=mCT191199.0
FT                   protein_id=mCP112161.0 isoform=CRA_c"
FT                   /protein_id="EDL18504.1"
FT                   /translation="NFSLRRLRSEVPAKMEVNPPKQEHLLALKVMRLTKPTLFTNIPVT
FT                   CEEKDLPGDLFNQLMKDDPSTVNGAEILMLGEMLTLPQNFGNIFLGETFSSYISVHNDS
FT                   NQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVS
FT                   YTTQGGEKMYFRKFFKFQVLKPLDVKTKFYNAETDEVFLEAQIQNITTSPMFMEKVSLE
FT                   PSIMYNVTELNSVTQAGECISTFGSRGYLQPMDTRQYLYCLKPKKEFAEKAGIIKGVTV
FT                   IGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCKITNC
FT                   SSERMMDLVLEMCNTNSIHWCGISGRQLGKLHPSSSLCLALTLLSSVQGLQSVSGLRLT
FT                   DTFLKRTYEYDDIAQVCVVSAAVEVEA"
FT   CDS             complement(join(562065..562172,562335..562485,
FT                   566560..566660,567399..567597,569328..569461,
FT                   571451..571468,573591..573635,574132..574204,
FT                   580279..580406,586233..586317,587874..587973,
FT                   589231..589299,597530..597575))
FT                   /codon_start=1
FT                   /gene="2410002O22Rik"
FT                   /locus_tag="mCG_17232"
FT                   /product="RIKEN cDNA 2410002O22, isoform CRA_b"
FT                   /note="gene_id=mCG17232.2 transcript_id=mCT12826.2
FT                   protein_id=mCP21926.2 isoform=CRA_b"
FT                   /protein_id="EDL18503.1"
FT                   /translation="MEVNPPKQEHLLALKVMRLTKPTLFTNIPVTCEEKDLPGDLFNQL
FT                   MKDDPSTVNGAEILMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKADLQ
FT                   TSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSYTTQGGEKMYFRKF
FT                   FKFQVLKPLDVKTKFYNAESDLSSVTDEVFLEAQIQNITTSPMFMEKVSLEPSIMYNVT
FT                   ELNSVTQAGECISTFGSRGYLQPMDTRQYLYCLKPKKEFAEKAGIIKGVTVIGKLDIVW
FT                   KTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCKITNCSSERMMDL
FT                   VLEMCNTNSIHWCGISGRQLGKLHPSSSLCLALTLLSSVQGLQSVSGLRLTDTFLKRTY
FT                   EYDDIAQVCVVSAAVEVEA"
FT   assembly_gap    563685..563704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    564868..564887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    587255..587332
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   mRNA            complement(join(593139..594420,597530..597865))
FT                   /gene="2410002O22Rik"
FT                   /locus_tag="mCG_17232"
FT                   /product="RIKEN cDNA 2410002O22, transcript variant
FT                   mCT118692"
FT                   /note="gene_id=mCG17232.2 transcript_id=mCT118692.0 created
FT                   on 13-NOV-2002"
FT   CDS             complement(join(594380..594420,597530..597575))
FT                   /codon_start=1
FT                   /gene="2410002O22Rik"
FT                   /locus_tag="mCG_17232"
FT                   /product="RIKEN cDNA 2410002O22, isoform CRA_a"
FT                   /note="gene_id=mCG17232.2 transcript_id=mCT118692.0
FT                   protein_id=mCP83905.1 isoform=CRA_a"
FT                   /protein_id="EDL18502.1"
FT                   /translation="MEVNPPKQEHLLALKGPVSSDLTRKTIL"
FT   gene            <598213..623832
FT                   /gene="Trim23"
FT                   /locus_tag="mCG_17235"
FT                   /note="gene_id=mCG17235.1"
FT   mRNA            join(<598213..598377,600490..600652,604142..604263,
FT                   606817..607095,607477..607659,609079..609294,
FT                   611433..611567,617403..617532,618007..618117,
FT                   619482..619606,620644..623832)
FT                   /gene="Trim23"
FT                   /locus_tag="mCG_17235"
FT                   /product="tripartite motif protein 23, transcript variant
FT                   mCT12825"
FT                   /note="gene_id=mCG17235.1 transcript_id=mCT12825.2 created
FT                   on 26-NOV-2002"
FT   CDS             join(598213..598377,600490..600652,604142..604263,
FT                   606817..607095,607477..607659,609079..609294,
FT                   611433..611567,617403..617532,618007..618117,
FT                   619482..619606,620644..620823)
FT                   /codon_start=1
FT                   /gene="Trim23"
FT                   /locus_tag="mCG_17235"
FT                   /product="tripartite motif protein 23, isoform CRA_a"
FT                   /note="gene_id=mCG17235.1 transcript_id=mCT12825.2
FT                   protein_id=mCP21937.2 isoform=CRA_a"
FT                   /protein_id="EDL18499.1"
FT                   /translation="MRRGFWVGRSTPPLSKRLSCSCGAAPSRMAALAVNKPGAGVDSGR
FT                   QGSRGTAVVKVLECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFDR
FT                   QVTDLGDSGVWGLKKNFALLELLERLQNGHIGQYGAAEEAIGTSGESIIRCDEDEAHVA
FT                   SVYCTVCATHLCSDCSQVTHSTKTLAKHRRVPLADKPHEKTMCCQHQVHAIEFVCLEEG
FT                   CQTSPLMCCVCKEYGKHQGHKHSVLEPEANQIRASILDMAHCIRTFTEEISDYSRKLVG
FT                   IVQHIEGGEQIVEDGIGMAHTEHVPGTAENARSCVRAYFSDLHETLCRQEEMALSVVDA
FT                   HVREKLIWLRQQQEDMTILLSQVSTACLHCEKTLQQDDCRVVLAKQEITRLLETLQKQQ
FT                   QQFTEVADHIQLDASIPVTFTKDNRVHIGPKMEIRVVTLGLDGAGKTTILFKLKQDEFM
FT                   QPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISE
FT                   AHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDA
FT                   RSGMGLYEGLDWLSRQLVAAGVLDVA"
FT   mRNA            join(<598254..598377,600490..600652,604142..604263,
FT                   606817..607095,609079..609294,611433..611567,
FT                   617403..617532,618007..618117,619482..619606,
FT                   620644..622785)
FT                   /gene="Trim23"
FT                   /locus_tag="mCG_17235"
FT                   /product="tripartite motif protein 23, transcript variant
FT                   mCT191208"
FT                   /note="gene_id=mCG17235.1 transcript_id=mCT191208.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<598255..598377,600490..600652,604142..604263,
FT                   606817..607095,609079..609294,611433..611567,
FT                   617403..617532,618007..618117,619482..619606,
FT                   620644..620823)
FT                   /codon_start=1
FT                   /gene="Trim23"
FT                   /locus_tag="mCG_17235"
FT                   /product="tripartite motif protein 23, isoform CRA_c"
FT                   /note="gene_id=mCG17235.1 transcript_id=mCT191208.0
FT                   protein_id=mCP112163.0 isoform=CRA_c"
FT                   /protein_id="EDL18501.1"
FT                   /translation="SKRLSCSCGAAPSRMAALAVNKPGAGVDSGRQGSRGTAVVKVLEC
FT                   GVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFDRQVTDLGDSGVWGLK
FT                   KNFALLELLERLQNGHIGQYGAAEEAIGTSGESIIRCDEDEAHVASVYCTVCATHLCSD
FT                   CSQVTHSTKTLAKHRRVPLADKPHEKTMCCQHQVHAIEFVCLEEGCQTSPLMCCVCKEY
FT                   GKHQGHKVPGTAENARSCVRAYFSDLHETLCRQEEMALSVVDAHVREKLIWLRQQQEDM
FT                   TILLSQVSTACLHCEKTLQQDDCRVVLAKQEITRLLETLQKQQQQFTEVADHIQLDASI
FT                   PVTFTKDNRVHIGPKMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYK
FT                   NLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRD
FT                   ALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARSGMGLYEGLDWLSRQ
FT                   LVAAGVLDVA"
FT   mRNA            join(<598512..600652,604142..604263,606817..607095,
FT                   607477..607659,609079..609294,611433..611567,
FT                   617403..617532,618007..618117,619482..619606,
FT                   620644..621461)
FT                   /gene="Trim23"
FT                   /locus_tag="mCG_17235"
FT                   /product="tripartite motif protein 23, transcript variant
FT                   mCT191207"
FT                   /note="gene_id=mCG17235.1 transcript_id=mCT191207.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<600385..600652,604142..604263,606817..607095,
FT                   607477..607659,609079..609294,611433..611567,
FT                   617403..617532,618007..618117,619482..619606,
FT                   620644..620823)
FT                   /codon_start=1
FT                   /gene="Trim23"
FT                   /locus_tag="mCG_17235"
FT                   /product="tripartite motif protein 23, isoform CRA_b"
FT                   /note="gene_id=mCG17235.1 transcript_id=mCT191207.0
FT                   protein_id=mCP112162.0 isoform=CRA_b"
FT                   /protein_id="EDL18500.1"
FT                   /translation="NTKKHAWLGQLFLNLKYVNIVSVVFTGHMFLFYIQVLECGVCEDV
FT                   FSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFDRQVTDLGDSGVWGLKKNFALL
FT                   ELLERLQNGHIGQYGAAEEAIGTSGESIIRCDEDEAHVASVYCTVCATHLCSDCSQVTH
FT                   STKTLAKHRRVPLADKPHEKTMCCQHQVHAIEFVCLEEGCQTSPLMCCVCKEYGKHQGH
FT                   KHSVLEPEANQIRASILDMAHCIRTFTEEISDYSRKLVGIVQHIEGGEQIVEDGIGMAH
FT                   TEHVPGTAENARSCVRAYFSDLHETLCRQEEMALSVVDAHVREKLIWLRQQQEDMTILL
FT                   SQVSTACLHCEKTLQQDDCRVVLAKQEITRLLETLQKQQQQFTEVADHIQLDASIPVTF
FT                   TKDNRVHIGPKMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKF
FT                   TIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDALLL
FT                   IFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARSGMGLYEGLDWLSRQLVAA
FT                   GVLDVA"
FT   assembly_gap    616812..616831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(624537..>647983)
FT                   /gene="Ppwd1"
FT                   /locus_tag="mCG_17225"
FT                   /note="gene_id=mCG17225.2"
FT   mRNA            complement(join(624537..625057,626509..626691,
FT                   627407..627488,629024..629205,632944..633133,
FT                   636507..636697,639455..639902,641880..642000,
FT                   642134..642234,644392..644494,647648..>647983))
FT                   /gene="Ppwd1"
FT                   /locus_tag="mCG_17225"
FT                   /product="peptidylprolyl isomerase domain and WD repeat
FT                   containing 1"
FT                   /note="gene_id=mCG17225.2 transcript_id=mCT16175.2 created
FT                   on 26-FEB-2003"
FT   CDS             complement(join(624914..625057,626509..626691,
FT                   627407..627488,629024..629205,632944..633133,
FT                   636507..636697,639455..639902,641880..642000,
FT                   642134..642234,644392..644494,647648..>647981))
FT                   /codon_start=1
FT                   /gene="Ppwd1"
FT                   /locus_tag="mCG_17225"
FT                   /product="peptidylprolyl isomerase domain and WD repeat
FT                   containing 1"
FT                   /note="gene_id=mCG17225.2 transcript_id=mCT16175.2
FT                   protein_id=mCP21941.2"
FT                   /protein_id="EDL18498.1"
FT                   /translation="CSLIGPAAPTAANQKALPAADGQKLRRGSGKPSSLGRRVSSNASD
FT                   DMATESGSDSQLRRRRRRDPEGSEKTELSEREPALAVAGSEENDDENEERWVGPLPVEA
FT                   TLAKKRKVLEFERVYLDNLPSASMYERSYMHRDVITHVVCTKTDFIITASHDGHVKFWK
FT                   KIEEGIEFVKHFRSHLGVIESIAVSSEGALFCSVGDDKAMKVFDVVNFDMINMLKLGYF
FT                   PGQCEWIYCPGDAISSVAASEKSTGKIFIYDGRGDNQPLHIFDKLHVSPLTQIRLNPVY
FT                   KAVVSSDKSGMIEYWTGPPHEYKFPKNVNWEYKTDTDLYEFAKCKAYPTSICFSPDGKK
FT                   IATIGSDRKVRIFRFLTGKLMRVFDESLSMFTELQQMRQQLPDMEFGRRMAVERELEKV
FT                   DAVRLVNIVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRVMQLALFQGIAKK
FT                   HRAAATIEMKASENPVLQNIQADPTIVCTSFKKNRFYMFTKREPEDTKTADSDRDVFNE
FT                   KPSKEEVMAATQAEGPKRVSDSAIVHTSMGDIHIKLFPVECPKTVENFCVHSRNGYYNG
FT                   HTFHRIIKGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG
FT                   SQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSIINITVK"
FT   gene            <647653..668688
FT                   /gene="Cenpk"
FT                   /locus_tag="mCG_17230"
FT                   /note="gene_id=mCG17230.2"
FT   mRNA            join(<647653..648044,649771..649921,651700..651756,
FT                   653188..653273,655220..655266,661233..661315,
FT                   661399..661497,661790..661916,664322..664375,
FT                   668434..668683)
FT                   /gene="Cenpk"
FT                   /locus_tag="mCG_17230"
FT                   /product="centromere protein K, transcript variant
FT                   mCT191197"
FT                   /note="gene_id=mCG17230.2 transcript_id=mCT191197.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(647653..648044,649771..649921,651700..651756,
FT                   653188..653260,655220..655266,661233..661315,
FT                   661399..661497,661790..661916,664322..664375,
FT                   665636..666202)
FT                   /gene="Cenpk"
FT                   /locus_tag="mCG_17230"
FT                   /product="centromere protein K, transcript variant
FT                   mCT175613"
FT                   /note="gene_id=mCG17230.2 transcript_id=mCT175613.0 created
FT                   on 13-NOV-2002"
FT   mRNA            join(648430..648698,649771..649921,651700..651756,
FT                   653188..653260,655220..655266,661233..661315,
FT                   661399..661497,661790..661916,664322..664375,
FT                   668434..668688)
FT                   /gene="Cenpk"
FT                   /locus_tag="mCG_17230"
FT                   /product="centromere protein K, transcript variant
FT                   mCT16179"
FT                   /note="gene_id=mCG17230.2 transcript_id=mCT16179.1 created
FT                   on 13-NOV-2002"
FT   CDS             join(648628..648698,649771..649921,651700..651756,
FT                   653188..653260,655220..655266,661233..661315,
FT                   661399..661497,661790..661916,664322..664375,
FT                   668434..668592)
FT                   /codon_start=1
FT                   /gene="Cenpk"
FT                   /locus_tag="mCG_17230"
FT                   /product="centromere protein K, isoform CRA_c"
FT                   /note="gene_id=mCG17230.2 transcript_id=mCT16179.1
FT                   protein_id=mCP21925.2 isoform=CRA_c"
FT                   /protein_id="EDL18497.1"
FT                   /translation="MLPCSVYSNNKAASCTTSPLVIYSSCSKVKKTIKDMSENKQEVHP
FT                   DTITDVEAVIDTEEELIKECEEMWKDMEDCQNKLSLIGTETLTNADAQLSLLIMQMKCL
FT                   TAELGQWKKRKPEIIPLNEDVLLTLGKEEFQKLRCDLEMVLSTIQSKNEKLKEDLEREQ
FT                   QWLDEQQQILDTLNVLNSDVENQVVTLTESRIFNELTTKIRGIKEFKEKLLLTLGAFLD
FT                   NHFPLPEASTPKKRKNIQDSNAQLITLNEILEMLINRMFDVPHDPYVKIRDSFWPPYIE
FT                   LLLRYGIALRHPEDPSQIRLEAFHQ"
FT   CDS             join(649805..649921,651700..651756,653188..653260,
FT                   655220..655266,661233..661315,661399..661497,
FT                   661790..661916,664322..664375,665636..665740)
FT                   /codon_start=1
FT                   /gene="Cenpk"
FT                   /locus_tag="mCG_17230"
FT                   /product="centromere protein K, isoform CRA_a"
FT                   /note="gene_id=mCG17230.2 transcript_id=mCT175613.0
FT                   protein_id=mCP98535.0 isoform=CRA_a"
FT                   /protein_id="EDL18495.1"
FT                   /translation="MSENKQEVHPDTITDVEAVIDTEEELIKECEEMWKDMEDCQNKLS
FT                   LIGTETLTNADAQLSLLIMQMKCLTAELGQWKKRKPEIIPLNEDVLLTLGKEEFQKLRC
FT                   DLEMVLSTIQSKNEKLKEDLEREQQWLDEQQQILDTLNVLNSDVENQVVTLTESRIFNE
FT                   LTTKIRGIKEFKEKLLLTLGAFLDNHFPLPEASTPKKRKNIQDSNAQLITLNEILEVPL
FT                   RAMGSTLESCWFPRETLLEEAAFSLASASVG"
FT   CDS             join(<653222..653273,655220..655266,661233..661315,
FT                   661399..661497,661790..661916,664322..664375,
FT                   668434..668592)
FT                   /codon_start=1
FT                   /gene="Cenpk"
FT                   /locus_tag="mCG_17230"
FT                   /product="centromere protein K, isoform CRA_b"
FT                   /note="gene_id=mCG17230.2 transcript_id=mCT191197.0
FT                   protein_id=mCP112159.0 isoform=CRA_b"
FT                   /protein_id="EDL18496.1"
FT                   /translation="LLNLVNGRKENPKVRLLVIPLNEDVLLTLGKEEFQKLRCDLEMVL
FT                   STIQSKNEKLKEDLEREQQWLDEQQQILDTLNVLNSDVENQVVTLTESRIFNELTTKIR
FT                   GIKEFKEKLLLTLGAFLDNHFPLPEASTPKKRKNIQDSNAQLITLNEILEMLINRMFDV
FT                   PHDPYVKIRDSFWPPYIELLLRYGIALRHPEDPSQIRLEAFHQ"
FT   assembly_gap    664993..665012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    670447..670466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    674511..674530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    675631..675650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    676386..676405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    678411..678430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    697577..698049
FT                   /estimated_length=473
FT                   /gap_type="unknown"
FT   assembly_gap    700250..703138
FT                   /estimated_length=2889
FT                   /gap_type="unknown"
FT   assembly_gap    704391..704410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    709424..709443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <709905..918750
FT                   /locus_tag="mCG_117555"
FT                   /note="gene_id=mCG117555.1"
FT   mRNA            join(<709905..710183,716517..716894,719232..719596,
FT                   729294..729462,734788..734999,735709..735792,
FT                   736311..736456,769404..769447,774896..775001,
FT                   788917..789063,791777..791913,797761..797902,
FT                   812197..812304,819902..820047,821983..822046,
FT                   848966..849099,850865..850988,851821..851901,
FT                   866123..866286,866885..867774,884263..884392,
FT                   892382..892586,898690..898866,901576..901732,
FT                   915652..918750)
FT                   /locus_tag="mCG_117555"
FT                   /product="mCG117555, transcript variant mCT180712"
FT                   /note="gene_id=mCG117555.1 transcript_id=mCT180712.0
FT                   created on 26-FEB-2003"
FT   mRNA            join(<709940..710070,716517..716894,719232..719596,
FT                   729294..729462,734788..734999,735709..735792,
FT                   736311..736456,769404..769447,774896..775001,
FT                   788917..789063,791777..791913,797761..797902,
FT                   812197..812304,819902..820047,821983..822046,
FT                   835728..835830,848966..849099,851821..851901,
FT                   866123..866286,866885..867774,884263..884392,
FT                   892382..892586,898690..898866,901576..901732,
FT                   915652..916305)
FT                   /locus_tag="mCG_117555"
FT                   /product="mCG117555, transcript variant mCT118690"
FT                   /note="gene_id=mCG117555.1 transcript_id=mCT118690.1
FT                   created on 26-FEB-2003"
FT   CDS             join(<716765..716894,719232..719596,729294..729462,
FT                   734788..734999,735709..735792,736311..736456,
FT                   769404..769447,774896..775001,788917..789063,
FT                   791777..791813)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117555"
FT                   /product="mCG117555, isoform CRA_a"
FT                   /note="gene_id=mCG117555.1 transcript_id=mCT180712.0
FT                   protein_id=mCP103634.0 isoform=CRA_a"
FT                   /protein_id="EDL18493.1"
FT                   /translation="VALQKHSVFQIMEISWKTLTWILSLIMASSEFYSDHRLSYSSQEE
FT                   FLTYLEHYQLTIPIRVDQNGAFLSFTVKNDKHSRRRRSMDLLDPQQAVSKLFFKLSAYG
FT                   KHFHLNLTLNTNFVSKHFTVEYWGKDGPQWKHDFLDNCHYTGYLQDQHSTTKVALSNCV
FT                   GLHGIIATEDEEYFIEPLKNTTEDSKHFSYENGHPHVIYKKSTLQQQHIYDHSHCGVSD
FT                   LTGSGKPWWLNKTSSFPSLPPINDTHIHHRKRRSVSTERFVETLVVADKMMVGYHGRKD
FT                   IEHYILSVMNIVAKLYRDSSLGNVVNIIVARLIVLTEDQPNLEINHHADKSLDSFCKWQ
FT                   KSILSHQSDGNTIPENGIAHHDNAVLITRYDICTYKNKPCGTLGLASVAGMCEPERSCS
FT                   INEDIGLGSAFTIAHEIGHNFGMNHDGIGNSCGTKGHEAAKLMAAHITANTNPFSWSAC
FT                   SRDYITSFLEFLKLGDSISGS"
FT   CDS             join(<716765..716894,719232..719596,729294..729462,
FT                   734788..734999,735709..735792,736311..736456,
FT                   769404..769447,774896..775001,788917..789063,
FT                   791777..791813)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117555"
FT                   /product="mCG117555, isoform CRA_a"
FT                   /note="gene_id=mCG117555.1 transcript_id=mCT118690.1
FT                   protein_id=mCP83897.1 isoform=CRA_a"
FT                   /protein_id="EDL18494.1"
FT                   /translation="VALQKHSVFQIMEISWKTLTWILSLIMASSEFYSDHRLSYSSQEE
FT                   FLTYLEHYQLTIPIRVDQNGAFLSFTVKNDKHSRRRRSMDLLDPQQAVSKLFFKLSAYG
FT                   KHFHLNLTLNTNFVSKHFTVEYWGKDGPQWKHDFLDNCHYTGYLQDQHSTTKVALSNCV
FT                   GLHGIIATEDEEYFIEPLKNTTEDSKHFSYENGHPHVIYKKSTLQQQHIYDHSHCGVSD
FT                   LTGSGKPWWLNKTSSFPSLPPINDTHIHHRKRRSVSTERFVETLVVADKMMVGYHGRKD
FT                   IEHYILSVMNIVAKLYRDSSLGNVVNIIVARLIVLTEDQPNLEINHHADKSLDSFCKWQ
FT                   KSILSHQSDGNTIPENGIAHHDNAVLITRYDICTYKNKPCGTLGLASVAGMCEPERSCS
FT                   INEDIGLGSAFTIAHEIGHNFGMNHDGIGNSCGTKGHEAAKLMAAHITANTNPFSWSAC
FT                   SRDYITSFLEFLKLGDSISGS"
FT   assembly_gap    772884..773029
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    776208..776227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    818784..818954
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    852998..853017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    862034..862053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    876574..876649
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    940307..940326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    951159..951178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    959901..959920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    983901..984391
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   gene            complement(1002156..>1045393)
FT                   /locus_tag="mCG_1033002"
FT                   /note="gene_id=mCG1033002.1"
FT   mRNA            complement(join(1002156..1002188,1013193..1013311,
FT                   1040367..1040534,1045283..>1045393))
FT                   /locus_tag="mCG_1033002"
FT                   /product="mCG1033002"
FT                   /note="gene_id=mCG1033002.1 transcript_id=mCT150706.1
FT                   created on 26-FEB-2003"
FT   assembly_gap    1008125..1008362
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   CDS             complement(join(1013311,1040367..1040534,
FT                   1045283..>1045392))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033002"
FT                   /product="mCG1033002"
FT                   /note="gene_id=mCG1033002.1 transcript_id=mCT150706.1
FT                   protein_id=mCP83845.1"
FT                   /protein_id="EDL18492.1"
FT                   /translation="DSKAWESSCWQSHHRRKPRGIPQSLHSEPAARPTVSRTSLRWTLL
FT                   ETIPSSRVDIHLFALPARSLEEASRQCSHLVMSFWLPRWISAGRSYN"
FT   gene            complement(1053314..>1237360)
FT                   /locus_tag="mCG_22913"
FT                   /note="gene_id=mCG22913.3"
FT   mRNA            complement(join(1053314..1053815,1080266..1080369,
FT                   1083517..1083626,1142682..1142779,1213056..1213216,
FT                   1216969..1217002,1217823..1217902,1222691..1222760,
FT                   1224785..1224888,1225452..1225550,1227171..1227314,
FT                   1228122..1228234,1231646..1231742,1237116..1237358))
FT                   /locus_tag="mCG_22913"
FT                   /product="mCG22913, transcript variant mCT22352"
FT                   /note="gene_id=mCG22913.3 transcript_id=mCT22352.2 created
FT                   on 26-NOV-2002"
FT   mRNA            complement(join(1053405..1053815,1080266..1080369,
FT                   1083517..1083626,1142682..1142779,1213056..1213207,
FT                   1216969..1217002,1217823..1217902,1222691..1222760,
FT                   1224785..1224888,1225452..1225550,1227171..1227314,
FT                   1228122..1228234,1231646..1231742,1237116..>1237360))
FT                   /locus_tag="mCG_22913"
FT                   /product="mCG22913, transcript variant mCT191206"
FT                   /note="gene_id=mCG22913.3 transcript_id=mCT191206.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1053653..1053815,1080266..1080369,
FT                   1083517..1083626,1142682..1142779,1213056..1213207,
FT                   1216969..1217002,1217823..1217902,1222691..1222760,
FT                   1224785..1224888,1225452..1225550,1227171..1227314,
FT                   1228122..1228234,1231646..1231742,1237116..>1237169))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22913"
FT                   /product="mCG22913, isoform CRA_a"
FT                   /note="gene_id=mCG22913.3 transcript_id=mCT191206.0
FT                   protein_id=mCP112146.0 isoform=CRA_a"
FT                   /protein_id="EDL18490.1"
FT                   /translation="ALSKMSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFI
FT                   QLCLEAYYDNTIFHRVVPGFIVQGGDPTGTGTGGESIYGAPFKDEFHSRLRFNRRGLVA
FT                   MANAGPHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLTEVDIDDEERPRNPH
FT                   RIKSCEVLFNPFDDITPREIKKPKNEKPEEEVKKLKPKGTKNFSLLSFGEEAEEEEEEV
FT                   NRVSQSMKGRSKSSHDLLKDDPHLSSVPAVESEKDDATGDLEDDGEDDSAERDEYMEDD
FT                   EKNLMRERIAKRLKKDASASVKSAGDGEKKPASRSEELRKEARQLKRELLAAKQKKETA
FT                   IKVEEGREEEEAAPDGAVAEYRREKQKYEALRKQQPKKGTSREDQTLALLSQFKSKLTQ
FT                   AITETPENSVPEAEVEDDEGWMSHVLQFEDKTRKVKDASMQDSDTFEIYDPRNPVNKRR
FT                   REESKKLLREKKERR"
FT   CDS             complement(join(1053653..1053815,1080266..1080369,
FT                   1083517..1083626,1142682..1142779,1213056..1213216,
FT                   1216969..1217002,1217823..1217902,1222691..1222760,
FT                   1224785..1224888,1225452..1225550,1227171..1227314,
FT                   1228122..1228234,1231646..1231742,1237116..1237157))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22913"
FT                   /product="mCG22913, isoform CRA_b"
FT                   /note="gene_id=mCG22913.3 transcript_id=mCT22352.2
FT                   protein_id=mCP21951.2 isoform=CRA_b"
FT                   /protein_id="EDL18491.1"
FT                   /translation="MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCL
FT                   EAYYDNTIFHRVVPGFIVQGGDPTGTGTGGESIYGAPFKDEFHSRLRFNRRGLVAMANA
FT                   GPHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLTEVDIDDEERPRNPHRIKS
FT                   CEVLFNPFDDITPREIKKPKNEKPEEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVS
FT                   QSMKGRSKSSHDLLKDDPHLSSVPAVESEKDDATGDLEDLLQDGEDDSAERDEYMEDDE
FT                   KNLMRERIAKRLKKDASASVKSAGDGEKKPASRSEELRKEARQLKRELLAAKQKKETAI
FT                   KVEEGREEEEAAPDGAVAEYRREKQKYEALRKQQPKKGTSREDQTLALLSQFKSKLTQA
FT                   ITETPENSVPEAEVEDDEGWMSHVLQFEDKTRKVKDASMQDSDTFEIYDPRNPVNKRRR
FT                   EESKKLLREKKERR"
FT   assembly_gap    1065038..1065113
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    1079827..1079948
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    1135793..1135812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1155222..1155241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1160012..1160148
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    1166415..1166434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1167703..1168313
FT                   /estimated_length=611
FT                   /gap_type="unknown"
FT   assembly_gap    1186191..1186210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1191228..1191247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1227686..1227705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1230652..1230671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1237614..1259358
FT                   /gene="3110031B13Rik"
FT                   /locus_tag="mCG_22912"
FT                   /note="gene_id=mCG22912.2"
FT   mRNA            join(1237614..1237795,1247488..1247535,1253287..1253430,
FT                   1254681..1254753,1257798..1259358)
FT                   /gene="3110031B13Rik"
FT                   /locus_tag="mCG_22912"
FT                   /product="RIKEN cDNA 3110031B13, transcript variant
FT                   mCT22351"
FT                   /note="gene_id=mCG22912.2 transcript_id=mCT22351.1 created
FT                   on 13-NOV-2002"
FT   mRNA            join(<1237681..1237795,1247488..1247535,1253287..1253538,
FT                   1254681..1254753,1257798..1259101)
FT                   /gene="3110031B13Rik"
FT                   /locus_tag="mCG_22912"
FT                   /product="RIKEN cDNA 3110031B13, transcript variant
FT                   mCT191203"
FT                   /note="gene_id=mCG22912.2 transcript_id=mCT191203.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(1237783..1237795,1247488..1247535,1253287..1253430,
FT                   1254681..1254753,1257798..1257981)
FT                   /codon_start=1
FT                   /gene="3110031B13Rik"
FT                   /locus_tag="mCG_22912"
FT                   /product="RIKEN cDNA 3110031B13, isoform CRA_b"
FT                   /note="gene_id=mCG22912.2 transcript_id=mCT22351.1
FT                   protein_id=mCP21947.1 isoform=CRA_b"
FT                   /protein_id="EDL18489.1"
FT                   /translation="MAVPGCNKDNVRAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVS
FT                   STSSEDSDEENEELNKLQALQEKRINEEEEKKKEKSREKIKLKKRRKRSYSSATEEDSA
FT                   KQKKQKYQKKEKKKEKKNKSKKGKHHKKEKKKRKKEKRSSPYHSELTKK"
FT   CDS             <1257999..1258346
FT                   /codon_start=1
FT                   /gene="3110031B13Rik"
FT                   /locus_tag="mCG_22912"
FT                   /product="RIKEN cDNA 3110031B13, isoform CRA_a"
FT                   /note="gene_id=mCG22912.2 transcript_id=mCT191203.0
FT                   protein_id=mCP112145.0 isoform=CRA_a"
FT                   /protein_id="EDL18488.1"
FT                   /translation="LRKFKNSVFLTVEPSLEVLCDYTLQEVPASSIKTFSPIGALLSLT
FT                   ICIKPISLLSRCASSIDMRTYKAHHSFGGLGRCCPSVSQLARGFTAVTGMIYLAALSRV
FT                   RLPVAQLPRQE"
FT   assembly_gap    1260125..1260494
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   gene            complement(1265823..>1284431)
FT                   /gene="A930021C24Rik"
FT                   /locus_tag="mCG_22908"
FT                   /note="gene_id=mCG22908.1"
FT   mRNA            complement(join(1265823..1266598,1278828..1278985,
FT                   1284060..>1284431))
FT                   /gene="A930021C24Rik"
FT                   /locus_tag="mCG_22908"
FT                   /product="RIKEN cDNA A930021C24"
FT                   /note="gene_id=mCG22908.1 transcript_id=mCT22347.1 created
FT                   on 20-NOV-2002"
FT   CDS             complement(join(1278863..1278985,1284060..>1284431))
FT                   /codon_start=1
FT                   /gene="A930021C24Rik"
FT                   /locus_tag="mCG_22908"
FT                   /product="RIKEN cDNA A930021C24"
FT                   /note="gene_id=mCG22908.1 transcript_id=mCT22347.1
FT                   protein_id=mCP21959.1"
FT                   /protein_id="EDL18487.1"
FT                   /translation="RAESSGTSWTAGGRAERAQRLSARHLDPKSQEAPRVAWAWDERSP
FT                   STHRTHLGILSTAAGDEPEQPPVLGLLQPQPQLRGAFPVPAARRWGRAALLLRLRRPQV
FT                   LLQRAGQLLPLQAQLHVEPQYWCSGWIGNRCPCLTCLCHQCLCPLLLISVHKTSKIRQW
FT                   P"
FT   assembly_gap    1287553..1288148
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    1322074..1326995
FT                   /estimated_length=4922
FT                   /gap_type="unknown"
FT   assembly_gap    1332645..1332664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1335809..1335889
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   gene            1339612..1340467
FT                   /locus_tag="mCG_49934"
FT                   /note="gene_id=mCG49934.1"
FT   mRNA            1339612..1340467
FT                   /locus_tag="mCG_49934"
FT                   /product="mCG49934"
FT                   /note="gene_id=mCG49934.1 transcript_id=mCT50117.1 created
FT                   on 26-FEB-2003"
FT   CDS             1339712..1340191
FT                   /codon_start=1
FT                   /locus_tag="mCG_49934"
FT                   /product="mCG49934"
FT                   /note="gene_id=mCG49934.1 transcript_id=mCT50117.1
FT                   protein_id=mCP42002.2"
FT                   /protein_id="EDL18486.1"
FT                   /translation="MAPTKQTARKSTCGKAPRKKLATKAAHKSAPSTGGVKKPHRYRPG
FT                   TVALCEIRRYQKATELLIRKLPFQHLVREIAQVFKTDLRFQSAAIGALQEASEAYLVGL
FT                   FEDTNLCAIHAKRVVTMPKDIQLTLRICGVHVQESTMRGNISFSKIFFSSSSCYQ"
FT   assembly_gap    1366624..1366643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1372188..1475873)
FT                   /gene="D13Bwg1146e"
FT                   /locus_tag="mCG_22909"
FT                   /note="gene_id=mCG22909.2"
FT   mRNA            complement(join(1372188..1372886,1385392..1385462,
FT                   1388289..1388436,1404221..1404351,1473925..1474091,
FT                   1475017..1475873))
FT                   /gene="D13Bwg1146e"
FT                   /locus_tag="mCG_22909"
FT                   /product="DNA segment, Chr 13, Brigham & Women's Genetics
FT                   1146 expressed"
FT                   /note="gene_id=mCG22909.2 transcript_id=mCT22348.2 created
FT                   on 20-NOV-2002"
FT   CDS             complement(join(1372795..1372886,1385392..1385462,
FT                   1388289..1388436,1404221..1404351,1473925..1474091,
FT                   1475017..1475181))
FT                   /codon_start=1
FT                   /gene="D13Bwg1146e"
FT                   /locus_tag="mCG_22909"
FT                   /product="DNA segment, Chr 13, Brigham & Women's Genetics
FT                   1146 expressed"
FT                   /note="gene_id=mCG22909.2 transcript_id=mCT22348.2
FT                   protein_id=mCP21961.2"
FT                   /protein_id="EDL18485.1"
FT                   /translation="MSSAPNGRKKRPSRSTRSSIFQISKPPLQSGDWERRGSGSESAHK
FT                   TQRALDDCKMLVQEFNTQVALYRELVISIGDVSVSCPSLRAEMHKTRTKGCEMARQAHQ
FT                   KLAAISGPEDGEIHPEICRLYIQLQCCLEMYTTEMLKSICLLGSLQFHRKGKEASGGAK
FT                   NLDSKIEENAETPALEDSLSSPLESQQQCWQVATDIENTERDMREMKNLLSKLRETMPL
FT                   PLKNQDDSSLLNLTPYPMVRRRKRRFFGLCCLVSS"
FT   assembly_gap    1396288..1396432
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    1398583..1398613
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    1414468..1414677
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    1423535..1423696
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    1435768..1436237
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    1465900..1465919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1483582..1483601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1487526..1488971
FT                   /estimated_length=1446
FT                   /gap_type="unknown"
FT   assembly_gap    1494391..1494410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1503536..1543195
FT                   /gene="4933425L06Rik"
FT                   /locus_tag="mCG_22911"
FT                   /note="gene_id=mCG22911.1"
FT   mRNA            join(1503536..1503765,1521852..1522003,1530694..1531274,
FT                   1532516..1532663,1533770..1533935,1540064..1540211,
FT                   1541224..1541410,1542650..1543195)
FT                   /gene="4933425L06Rik"
FT                   /locus_tag="mCG_22911"
FT                   /product="RIKEN cDNA 4933425L06"
FT                   /note="gene_id=mCG22911.1 transcript_id=mCT22350.1 created
FT                   on 26-FEB-2003"
FT   CDS             join(1503575..1503765,1521852..1522003,1530694..1531274,
FT                   1532516..1532663,1533770..1533935,1540064..1540211,
FT                   1541224..1541410,1542650..1542834)
FT                   /codon_start=1
FT                   /gene="4933425L06Rik"
FT                   /locus_tag="mCG_22911"
FT                   /product="RIKEN cDNA 4933425L06"
FT                   /note="gene_id=mCG22911.1 transcript_id=mCT22350.1
FT                   protein_id=mCP21966.2"
FT                   /db_xref="GOA:Q9D3Z8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="MGI:MGI:1914013"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D3Z8"
FT                   /protein_id="EDL18484.1"
FT                   /translation="MEAPEEEPPALAPPQPAKLGEELSPQTQGNQSGDMDSYNLTILHF
FT                   NDVYDVDSSTEEPVGGAARFATAVKRFSILNPLLIFSGDCLNPSILSTITKGKHMISIL
FT                   NELGVHFAVFGNHEFDFGVDILEEYMKQMHFTWFLSNVHDRFTSEPLGHGAVKKIVNWN
FT                   NRKIGLMGLVEEDWLDTLATVNKANVNYKDYVETANELAVELRAEGADLVIAMTHMKWK
FT                   NDTRLAQHAEGLDLILGGHDHEYGIKKVNETWIVKSGSDFKNLTKIDIQLFDASFQYVF
FT                   EKVEILSYLEEDSYIKAIVRDFTQNIQYMLEEVLCPIDVALDGREITVRRCESNLGNLV
FT                   TNAMLEATHADVALLNSGTLRYDRIHPPGNFTLHDLLAILPIVDPVLVVRATGAQLLEA
FT                   LENGVYKYPALDGRFPQVAGLEFGFDPDAEPGHRVIRDTVKVQGQYLQRKKVYLLAIKE
FT                   YIANGKDGYSMFRACPRMFDPETAQVLSTVVMNHFESIKILQGKKKCLSGHRMSLITTT
FT                   NKSPSLTAFEEETDGPLGVIAVPGLEGRIFHISPDMKEHLHQLRAARQQGLRTFPTISD
FT                   SARETSDSD"
FT   gene            complement(1549523..1715098)
FT                   /locus_tag="mCG_22907"
FT                   /note="gene_id=mCG22907.2"
FT   mRNA            complement(join(1549523..1550599,1586597..1586722,
FT                   1601699..1601924,1667222..1667257,1670170..1671126,
FT                   1672811..1672906,1691463..1691597,1715030..1715098))
FT                   /locus_tag="mCG_22907"
FT                   /product="mCG22907, transcript variant mCT175933"
FT                   /note="gene_id=mCG22907.2 transcript_id=mCT175933.0 created
FT                   on 20-NOV-2002"
FT   mRNA            complement(join(1549612..1550599,1586597..1586722,
FT                   1601699..1601924,1667222..1667257,1670170..1671126,
FT                   1672811..1672909,1691463..1691597,1714541..>1714709))
FT                   /locus_tag="mCG_22907"
FT                   /product="mCG22907, transcript variant mCT191209"
FT                   /note="gene_id=mCG22907.2 transcript_id=mCT191209.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1550341..1550599,1586597..1586722,
FT                   1601699..1601924,1667222..1667257,1670170..1671126,
FT                   1672811..1672906,1691463..1691597,1714541..>1714763))
FT                   /locus_tag="mCG_22907"
FT                   /product="mCG22907, transcript variant mCT191210"
FT                   /note="gene_id=mCG22907.2 transcript_id=mCT191210.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1550400..1550599,1586597..1586722,
FT                   1601699..1601924,1667222..1667257,1670170..1671126,
FT                   1672811..1672906,1691463..1691597,1714541..>1714762))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22907"
FT                   /product="mCG22907, isoform CRA_c"
FT                   /note="gene_id=mCG22907.2 transcript_id=mCT191210.0
FT                   protein_id=mCP112144.0 isoform=CRA_c"
FT                   /protein_id="EDL18482.1"
FT                   /translation="AGGSTRGQARRRPRAARGRRGAGAQADVGRRIPGQGVGLREHLQR
FT                   FPRGLSPAASRLWSRPRRECWEPGGARTQMKRSEESTSTQSPEEQTGTLHCWRCRKCIA
FT                   SSGCFMTPLETQVVEDRHESVDAQNTCHLWHMNVDALPEWISCLLQKAQWTVGKLNCPF
FT                   CGARLGGFNFVSTPKCSCGQLAAVHLCKSRTDHQAAQGGRLMRPALKHLPHPGVPSGCD
FT                   KETLLTGGGSKTRNHWLLSMARNSNGLGRLTEALCLEVRATYFEMKNEKLLFKASDPKC
FT                   QPFVPQPDTGRCPSRASHRKSHSLDLNISEKLILLPTLYEIHRKPTAYPRLNETGPIDL
FT                   SGLALPCSNSSCSFQSPPSFDPNMLLHRLSVAPHETQAQRGRECQCGLEASSVYSDHAN
FT                   ANSLPFLMDLPSAGRSVLEASDQEEHLSQLDFLRSASFPLGTINHRLNNRERSKLRTLR
FT                   RQQRRERWLQKQGKYSGVGLLDHMTVSNEMSTDEETEFPEEKDSYMCAVCLDVYFNPYM
FT                   CYPCHHIFCEPCLRTLAKDNPASTPCPLCRTIISRVFLQTELNNATKTFFTKEYLKIKQ
FT                   SFQKSSSAKWPLPSCRKGFHLFGGFHRRAAPVTRRQFPHGAHRMDYLHFEDDSRGWWFD
FT                   MDMVIIYIYSVNWVIGFVVFCFLCYFFFPF"
FT   CDS             complement(join(1550400..1550599,1586597..1586722,
FT                   1601699..1601924,1667222..1667257,1670170..1671126,
FT                   1672811..1672909,1691463..1691597,1714541..>1714708))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22907"
FT                   /product="mCG22907, isoform CRA_b"
FT                   /note="gene_id=mCG22907.2 transcript_id=mCT191209.0
FT                   protein_id=mCP112143.0 isoform=CRA_b"
FT                   /protein_id="EDL18481.1"
FT                   /translation="RRGAGAQADVGRRIPGQGVGLREHLQRFPRGLSPAASRLWSRPRR
FT                   ECWEPGGARTQMKRSEESTSTQSPEEQTGTLHCWRCRKCIASSGCFMTPLETQVVEQDR
FT                   HESVDAQNTCHLWHMNVDALPEWISCLLQKAQWTVGKLNCPFCGARLGGFNFVSTPKCS
FT                   CGQLAAVHLCKSRTDHQAAQGGRLMRPALKHLPHPGVPSGCDKETLLTGGGSKTRNHWL
FT                   LSMARNSNGLGRLTEALCLEVRATYFEMKNEKLLFKASDPKCQPFVPQPDTGRCPSRAS
FT                   HRKSHSLDLNISEKLILLPTLYEIHRKPTAYPRLNETGPIDLSGLALPCSNSSCSFQSP
FT                   PSFDPNMLLHRLSVAPHETQAQRGRECQCGLEASSVYSDHANANSLPFLMDLPSAGRSV
FT                   LEASDQEEHLSQLDFLRSASFPLGTINHRLNNRERSKLRTLRRQQRRERWLQKQGKYSG
FT                   VGLLDHMTVSNEMSTDEETEFPEEKDSYMCAVCLDVYFNPYMCYPCHHIFCEPCLRTLA
FT                   KDNPASTPCPLCRTIISRVFLQTELNNATKTFFTKEYLKIKQSFQKSSSAKWPLPSCRK
FT                   GFHLFGGFHRRAAPVTRRQFPHGAHRMDYLHFEDDSRGWWFDMDMVIIYIYSVNWVIGF
FT                   VVFCFLCYFFFPF"
FT   CDS             complement(join(1550400..1550599,1586597..1586722,
FT                   1601699..1601924,1667222..1667257,1670170..1671126,
FT                   1672811..1672906,1691463..1691597))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22907"
FT                   /product="mCG22907, isoform CRA_a"
FT                   /note="gene_id=mCG22907.2 transcript_id=mCT175933.0
FT                   protein_id=mCP98855.0 isoform=CRA_a"
FT                   /protein_id="EDL18480.1"
FT                   /translation="MKRSEESTSTQSPEEQTGTLHCWRCRKCIASSGCFMTPLETQVVE
FT                   DRHESVDAQNTCHLWHMNVDALPEWISCLLQKAQWTVGKLNCPFCGARLGGFNFVSTPK
FT                   CSCGQLAAVHLCKSRTDHQAAQGGRLMRPALKHLPHPGVPSGCDKETLLTGGGSKTRNH
FT                   WLLSMARNSNGLGRLTEALCLEVRATYFEMKNEKLLFKASDPKCQPFVPQPDTGRCPSR
FT                   ASHRKSHSLDLNISEKLILLPTLYEIHRKPTAYPRLNETGPIDLSGLALPCSNSSCSFQ
FT                   SPPSFDPNMLLHRLSVAPHETQAQRGRECQCGLEASSVYSDHANANSLPFLMDLPSAGR
FT                   SVLEASDQEEHLSQLDFLRSASFPLGTINHRLNNRERSKLRTLRRQQRRERWLQKQGKY
FT                   SGVGLLDHMTVSNEMSTDEETEFPEEKDSYMCAVCLDVYFNPYMCYPCHHIFCEPCLRT
FT                   LAKDNPASTPCPLCRTIISRVFLQTELNNATKTFFTKEYLKIKQSFQKSSSAKWPLPSC
FT                   RKGFHLFGGFHRRAAPVTRRQFPHGAHRMDYLHFEDDSRGWWFDMDMVIIYIYSVNWVI
FT                   GFVVFCFLCYFFFPF"
FT   assembly_gap    1584437..1584456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1592475..1592494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(1595212..1595618,1601699..1601924,
FT                   1667222..1667257,1670170..1671126,1672811..1672906,
FT                   1691463..1691597,1715030..1715097))
FT                   /locus_tag="mCG_22907"
FT                   /product="mCG22907, transcript variant mCT22346"
FT                   /note="gene_id=mCG22907.2 transcript_id=mCT22346.2 created
FT                   on 20-NOV-2002"
FT   CDS             complement(join(1595560..1595618,1601699..1601924,
FT                   1667222..1667257,1670170..1671126,1672811..1672906,
FT                   1691463..1691597))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22907"
FT                   /product="mCG22907, isoform CRA_d"
FT                   /note="gene_id=mCG22907.2 transcript_id=mCT22346.2
FT                   protein_id=mCP21958.2 isoform=CRA_d"
FT                   /protein_id="EDL18483.1"
FT                   /translation="MKRSEESTSTQSPEEQTGTLHCWRCRKCIASSGCFMTPLETQVVE
FT                   DRHESVDAQNTCHLWHMNVDALPEWISCLLQKAQWTVGKLNCPFCGARLGGFNFVSTPK
FT                   CSCGQLAAVHLCKSRTDHQAAQGGRLMRPALKHLPHPGVPSGCDKETLLTGGGSKTRNH
FT                   WLLSMARNSNGLGRLTEALCLEVRATYFEMKNEKLLFKASDPKCQPFVPQPDTGRCPSR
FT                   ASHRKSHSLDLNISEKLILLPTLYEIHRKPTAYPRLNETGPIDLSGLALPCSNSSCSFQ
FT                   SPPSFDPNMLLHRLSVAPHETQAQRGRECQCGLEASSVYSDHANANSLPFLMDLPSAGR
FT                   SVLEASDQEEHLSQLDFLRSASFPLGTINHRLNNRERSKLRTLRRQQRRERWLQKQGKY
FT                   SGVGLLDHMTVSNEMSTDEETEFPEEKDSYMCAVCLDVYFNPYMCYPCHHIFCEPCLRT
FT                   LAKDNPASTPCPLCRTIISRVFLQTAQAGSCGRLIPIFQRKPPR"
FT   assembly_gap    1614285..1614375
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    1643827..1643846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1657597..1657616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1664016..1664035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1714278..1714446
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    1718938..1718957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1733783..1733802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1757293..1757312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1798379..1799228
FT                   /estimated_length=850
FT                   /gap_type="unknown"
FT   assembly_gap    1800736..1801042
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    1811738..1811757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1822196..1822583
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   assembly_gap    1826386..1826489
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    1842126..1842145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1843749..1843768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1862135..1865053
FT                   /gene="Htr1a"
FT                   /locus_tag="mCG_22910"
FT                   /note="gene_id=mCG22910.2"
FT   mRNA            1862135..1865053
FT                   /gene="Htr1a"
FT                   /locus_tag="mCG_22910"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 1A"
FT                   /note="gene_id=mCG22910.2 transcript_id=mCT22349.2 created
FT                   on 13-NOV-2002"
FT   CDS             1862749..1864014
FT                   /codon_start=1
FT                   /gene="Htr1a"
FT                   /locus_tag="mCG_22910"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 1A"
FT                   /note="gene_id=mCG22910.2 transcript_id=mCT22349.2
FT                   protein_id=mCP21965.2"
FT                   /db_xref="GOA:Q64264"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000610"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96273"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64264"
FT                   /protein_id="EDL18479.1"
FT                   /translation="MDMFSLGQGNNTTTSLEPFGTGGNDTGLSNVTFSYQVITSLLLGT
FT                   LIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTL
FT                   GQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLI
FT                   GFLISIPPMLGWRTPEDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAA
FT                   RFRIRKTVKKVEKKGAGTSFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAV
FT                   RQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARE
FT                   RKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVI
FT                   YAYFNKDFQNAFKKIIKCKFCR"
FT   assembly_gap    1867172..1867481
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    1876423..1876442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1884014..1884149
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    1894049..1894068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1989061..1989273
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    1996313..1996332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2000405..2000479
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    2050463..2051135
FT                   /estimated_length=673
FT                   /gap_type="unknown"
FT   assembly_gap    2058313..2058332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2094279..2095186
FT                   /estimated_length=908
FT                   /gap_type="unknown"
FT   assembly_gap    2096386..2096801
FT                   /estimated_length=416
FT                   /gap_type="unknown"
FT   assembly_gap    2098946..2098965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2128120..2128139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2129663..2129682
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2146982..2147001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2168176..2169947
FT                   /estimated_length=1772
FT                   /gap_type="unknown"
FT   assembly_gap    2178976..2181080
FT                   /estimated_length=2105
FT                   /gap_type="unknown"
FT   assembly_gap    2194903..2194922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2196142..2196993
FT                   /estimated_length=852
FT                   /gap_type="unknown"
FT   assembly_gap    2197841..2197860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2199128..2199147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2200644..2200663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2204228..2204247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2209863..2209882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2214868..2265808
FT                   /estimated_length=50941
FT                   /gap_type="unknown"
FT   assembly_gap    2294467..2295678
FT                   /estimated_length=1212
FT                   /gap_type="unknown"
FT   gene            2296871..2297230
FT                   /pseudo
FT                   /locus_tag="mCG_53459"
FT                   /note="gene_id=mCG53459.2"
FT   mRNA            2296871..2297230
FT                   /pseudo
FT                   /locus_tag="mCG_53459"
FT                   /note="gene_id=mCG53459.2 transcript_id=mCT53642.2 created
FT                   on 26-FEB-2003"
FT   assembly_gap    2298635..2299145
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   assembly_gap    2337580..2338785
FT                   /estimated_length=1206
FT                   /gap_type="unknown"
FT   assembly_gap    2365437..2365609
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    2371326..2371345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2381074..2381296
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    2406411..2406525
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    2453593..2453612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2516167..2516186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2554850..2554893
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    2578680..2578768
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    2582367..2582968
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   gene            complement(2590620..2591124)
FT                   /pseudo
FT                   /locus_tag="mCG_59080"
FT                   /note="gene_id=mCG59080.2"
FT   mRNA            complement(2590620..2591124)
FT                   /pseudo
FT                   /locus_tag="mCG_59080"
FT                   /note="gene_id=mCG59080.2 transcript_id=mCT59263.2 created
FT                   on 26-FEB-2003"
FT   assembly_gap    2598082..2598101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2612059..2612078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2619980..2619999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2623405..2623424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2624878..2627005
FT                   /estimated_length=2128
FT                   /gap_type="unknown"
FT   assembly_gap    2701898..2704177
FT                   /estimated_length=2280
FT                   /gap_type="unknown"
FT   assembly_gap    2750409..2752916
FT                   /estimated_length=2508
FT                   /gap_type="unknown"
FT   assembly_gap    2753984..2755150
FT                   /estimated_length=1167
FT                   /gap_type="unknown"
FT   assembly_gap    2757644..2757663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2759037..2759056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2760144..2760163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2778565..2778607
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    2821448..2821579
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    2843141..2843160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2852048..2852067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2860100..2860228
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    2889896..2889974
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    2892587..2892606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2898839..2898858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2902054..2902073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2903113..2903132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2911588..2911607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2912648..2912667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2913686..2913705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2915360..2915379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2969407..2969426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2982186..2983293
FT                   /estimated_length=1108
FT                   /gap_type="unknown"
FT   assembly_gap    2993510..2993735
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    2995067..2995086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3019727..3028910
FT                   /estimated_length=9184
FT                   /gap_type="unknown"
FT   assembly_gap    3038327..3041394
FT                   /estimated_length=3068
FT                   /gap_type="unknown"
FT   assembly_gap    3045067..3045230
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    3050208..3050497
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    3053482..3053501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3057515..3057534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3074168..3074595
FT                   /estimated_length=428
FT                   /gap_type="unknown"
FT   assembly_gap    3083757..3083776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3086381..3086400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3088611..3088630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3142039..3142058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3156912..3299431)
FT                   /gene="Ipo11"
FT                   /locus_tag="mCG_9795"
FT                   /note="gene_id=mCG9795.2"
FT   mRNA            complement(join(3156912..3158267,3174698..3174782,
FT                   3185289..3185384,3204448..3204569,3209706..3209819,
FT                   3210601..3210696,3219080..3219160,3219571..3219650,
FT                   3223223..3223299,3228226..3228341,3233032..3233145,
FT                   3237870..3237986,3238608..3238648,3239304..3239337,
FT                   3242013..3242139,3245242..3245347,3245926..3245973,
FT                   3249058..3249148,3251753..3251796,3254005..3254157,
FT                   3254812..3255004,3258193..3258263,3259594..3259642,
FT                   3261296..3261354,3263062..3263194,3272632..3272835,
FT                   3273180..3273252,3281950..3282050,3287433..3287576,
FT                   3299276..3299431))
FT                   /gene="Ipo11"
FT                   /locus_tag="mCG_9795"
FT                   /product="importin 11, transcript variant mCT175935"
FT                   /note="gene_id=mCG9795.2 transcript_id=mCT175935.0 created
FT                   on 20-NOV-2002"
FT   mRNA            complement(join(3156912..3158267,3174698..3174782,
FT                   3185289..3185384,3204448..3204569,3209706..3209819,
FT                   3210601..3210696,3219080..3219160,3219571..3219650,
FT                   3219841..3219867,3223223..3223299,3228226..3228341,
FT                   3233032..3233145,3237870..3237986,3238608..3238648,
FT                   3239304..3239337,3242013..3242139,3245242..3245347,
FT                   3245926..3245973,3249058..3249148,3251753..3251796,
FT                   3254005..3254157,3254812..3255004,3258193..3258263,
FT                   3259594..3259642,3261296..3261354,3263062..3263194,
FT                   3272632..3272835,3273180..3273252,3281950..3282050,
FT                   3287433..3287576,3299276..3299431))
FT                   /gene="Ipo11"
FT                   /locus_tag="mCG_9795"
FT                   /product="importin 11, transcript variant mCT9813"
FT                   /note="gene_id=mCG9795.2 transcript_id=mCT9813.2 created on
FT                   20-NOV-2002"
FT   CDS             complement(join(3158103..3158267,3174698..3174782,
FT                   3185289..3185384,3204448..3204569,3209706..3209819,
FT                   3210601..3210696,3219080..3219160,3219571..3219650,
FT                   3223223..3223299,3228226..3228341,3233032..3233145,
FT                   3237870..3237986,3238608..3238648,3239304..3239337,
FT                   3242013..3242139,3245242..3245347,3245926..3245973,
FT                   3249058..3249148,3251753..3251796,3254005..3254157,
FT                   3254812..3255004,3258193..3258263,3259594..3259642,
FT                   3261296..3261354,3263062..3263194,3272632..3272835,
FT                   3273180..3273252,3281950..3282050,3287433..3287570))
FT                   /codon_start=1
FT                   /gene="Ipo11"
FT                   /locus_tag="mCG_9795"
FT                   /product="importin 11, isoform CRA_a"
FT                   /note="gene_id=mCG9795.2 transcript_id=mCT175935.0
FT                   protein_id=mCP98857.0 isoform=CRA_a"
FT                   /protein_id="EDL18476.1"
FT                   /translation="MDLNSASSVVLQVLTQATSQDTAVLKPAEEQLKQWETQPGFYSVL
FT                   LNIFTNHTLDINVRWLAVLYFKHGIDRYWRRVAPHALSEEEKSTLRAGLITNFNEPINQ
FT                   IATQIAVLIAKVARLDCPRQWPELIPTLVESVKVQDDLRQHRALLTFYHVTKTLASKRL
FT                   AADRKLFYDLASGIYNFACSLWNHHTDTFLQHVSSGNEAAVLSSLERTLLSLKVLRKLT
FT                   VNGFVEPHKNMEVMGFLHGIFERLKQFLECSRSIGTDNVCRDRLEKTIILFTKVLLDFL
FT                   DQHPISFTPLIQRSLEFSVSYVFTEVGEGVTFERFIVQCMNLIKMIVKNYAYKPSKNFE
FT                   DSSPETLEAHKIKMAFFTYPTLTEICRRLVSHYFLLTEEELTMWEEDPEGFTVEETGGD
FT                   SWKYSLRPCTEVLFIDIFHEYNQTLTPVLLEMMQTLEGPTNVEDMNALLIKDAVYNAVG
FT                   LAAFELFDSVDFDQWFKTQLLPELQVSHNRYKPLRRRVIWLIGQWISVKFKSDLRPMLY
FT                   EAICNLLQDQDLVVRIETATTLKLTVDDFEFRTDQFLPYLETMFTLLFQLLQQVTECDT
FT                   KMHVLHVLSCVIERVNVQIRPYVGCLVQYLPLLWKQSEEHNMLRCAILTTLIHLVQGLG
FT                   ADSKNLYPFLLPVIQLSTDVSQPPHVYLLEDGLELWLVTLENSPCVTPELLRIFQNMSP
FT                   LLELSSENLRTCFKIINGYIFLSSTEFLQTYAAGLCQSFYELLPEITTEGQVQVLKVVE
FT                   NALKVNPVLGPQMFQRILPCVFRGVIEGERYPVVMSIYLAVMGRVLLQNTSFFSSLLNE
FT                   MGHEFNQEMDQLLGNVIEMWVDRMDNITQPERKKLSALALLSLLPSDNSVIQDKFCGII
FT                   NISVEALHDVMTEDPETRTYKDCMLMSQHEEPKVTEDEEPPTEQDKRKKMLALKDPVHT
FT                   VSLQQFIYEKLKAQQEILGEQGFQSLMETVDTEIVTQLQEFLQGF"
FT   CDS             complement(join(3158103..3158267,3174698..3174782,
FT                   3185289..3185384,3204448..3204569,3209706..3209819,
FT                   3210601..3210696,3219080..3219160,3219571..3219650,
FT                   3219841..3219867,3223223..3223299,3228226..3228341,
FT                   3233032..3233145,3237870..3237986,3238608..3238648,
FT                   3239304..3239337,3242013..3242139,3245242..3245347,
FT                   3245926..3245973,3249058..3249148,3251753..3251796,
FT                   3254005..3254157,3254812..3255004,3258193..3258263,
FT                   3259594..3259642,3261296..3261354,3263062..3263194,
FT                   3272632..3272835,3273180..3273252,3281950..3282050,
FT                   3287433..3287570))
FT                   /codon_start=1
FT                   /gene="Ipo11"
FT                   /locus_tag="mCG_9795"
FT                   /product="importin 11, isoform CRA_b"
FT                   /note="gene_id=mCG9795.2 transcript_id=mCT9813.2
FT                   protein_id=mCP10647.2 isoform=CRA_b"
FT                   /protein_id="EDL18477.1"
FT                   /translation="MDLNSASSVVLQVLTQATSQDTAVLKPAEEQLKQWETQPGFYSVL
FT                   LNIFTNHTLDINVRWLAVLYFKHGIDRYWRRVAPHALSEEEKSTLRAGLITNFNEPINQ
FT                   IATQIAVLIAKVARLDCPRQWPELIPTLVESVKVQDDLRQHRALLTFYHVTKTLASKRL
FT                   AADRKLFYDLASGIYNFACSLWNHHTDTFLQHVSSGNEAAVLSSLERTLLSLKVLRKLT
FT                   VNGFVEPHKNMEVMGFLHGIFERLKQFLECSRSIGTDNVCRDRLEKTIILFTKVLLDFL
FT                   DQHPISFTPLIQRSLEFSVSYVFTEVGEGVTFERFIVQCMNLIKMIVKNYAYKPSKNFE
FT                   DSSPETLEAHKIKMAFFTYPTLTEICRRLVSHYFLLTEEELTMWEEDPEGFTVEETGGD
FT                   SWKYSLRPCTEVLFIDIFHEYNQTLTPVLLEMMQTLEGPTNVEDMNALLIKDAVYNAVG
FT                   LAAFELFDSVDFDQWFKTQLLPELQVSHNRYKPLRRRVIWLIGQWISVKFKSDLRPMLY
FT                   EAICNLLQDQDLVVRIETATTLKLTVDDFEFRTDQFLPYLETMFTLLFQLLQQVTECDT
FT                   KMHVLHVLSCVIERVNVQIRPYVGCLVQYLPLLWKQSEEHNMLRCAILTTLIHLVQGLG
FT                   ADSKNLYPFLLPVIQLSTDVSQPPHVYLLEDGLELWLVTLENSPCVTPELLRIFQNMSP
FT                   LLELPSSCLANELSSENLRTCFKIINGYIFLSSTEFLQTYAAGLCQSFYELLPEITTEG
FT                   QVQVLKVVENALKVNPVLGPQMFQRILPCVFRGVIEGERYPVVMSIYLAVMGRVLLQNT
FT                   SFFSSLLNEMGHEFNQEMDQLLGNVIEMWVDRMDNITQPERKKLSALALLSLLPSDNSV
FT                   IQDKFCGIINISVEALHDVMTEDPETRTYKDCMLMSQHEEPKVTEDEEPPTEQDKRKKM
FT                   LALKDPVHTVSLQQFIYEKLKAQQEILGEQGFQSLMETVDTEIVTQLQEFLQGF"
FT   assembly_gap    3176990..3177308
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    3188518..3188829
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   gene            complement(3196136..3198672)
FT                   /locus_tag="mCG_147607"
FT                   /note="gene_id=mCG147607.0"
FT   mRNA            complement(join(3196136..3197112,3198488..3198672))
FT                   /locus_tag="mCG_147607"
FT                   /product="mCG147607"
FT                   /note="gene_id=mCG147607.0 transcript_id=mCT187870.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3196265..3196840)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147607"
FT                   /product="mCG147607"
FT                   /note="gene_id=mCG147607.0 transcript_id=mCT187870.0
FT                   protein_id=mCP108831.0"
FT                   /db_xref="GOA:Q8C2M7"
FT                   /db_xref="MGI:MGI:5317337"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C2M7"
FT                   /protein_id="EDL18478.1"
FT                   /translation="MMAWHKVSTSGNPLESPVAESSRVWEPARASPASRPFQESTLANA
FT                   LETTAVVSAQTQLTSVTLTSEKNTALPIDASSVSGKASLICTQEVEKLNEAFDFLLAFF
FT                   ILACVLIIFLIYKVIQFKQKLKALEDSVENRLEYYSFYQSARYNVTASVCNTSPDSLES
FT                   SGLQQIGLDKQIVPENGAQVILFEHSAL"
FT   assembly_gap    3199975..3199994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3240720..3240739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3290282..3290467
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    3308185..3308204
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3309591..3322713
FT                   /gene="1500031M22Rik"
FT                   /locus_tag="mCG_9793"
FT                   /note="gene_id=mCG9793.2"
FT   mRNA            join(3309591..3309752,3310055..3310128,3311170..3311256,
FT                   3312024..3312085,3312161..3312254,3312338..3312387,
FT                   3314289..3314412,3314787..3314879,3315918..3315982,
FT                   3317160..3317223,3319582..3319688,3321143..3322713)
FT                   /gene="1500031M22Rik"
FT                   /locus_tag="mCG_9793"
FT                   /product="RIKEN cDNA 1500031M22, transcript variant
FT                   mCT9808"
FT                   /note="gene_id=mCG9793.2 transcript_id=mCT9808.2 created on
FT                   20-NOV-2002"
FT   mRNA            join(<3309596..3309752,3310055..3310128,3311170..3311256,
FT                   3312024..3312254,3312338..3312387,3314289..3314412,
FT                   3314787..3314879,3315918..3315982,3317160..3317223,
FT                   3319582..3319688,3321143..3321212)
FT                   /gene="1500031M22Rik"
FT                   /locus_tag="mCG_9793"
FT                   /product="RIKEN cDNA 1500031M22, transcript variant
FT                   mCT191193"
FT                   /note="gene_id=mCG9793.2 transcript_id=mCT191193.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<3309646..3309752,3310055..3310128,3311170..3312254,
FT                   3312338..3312387,3314289..3314412,3314787..3314879,
FT                   3315918..3315982,3317160..3317223,3319582..3319688,
FT                   3321143..3322712)
FT                   /gene="1500031M22Rik"
FT                   /locus_tag="mCG_9793"
FT                   /product="RIKEN cDNA 1500031M22, transcript variant
FT                   mCT191194"
FT                   /note="gene_id=mCG9793.2 transcript_id=mCT191194.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(3309674..3309752,3310055..3310128,3311170..3311256,
FT                   3312024..3312085,3312161..3312254,3312338..3312387,
FT                   3314289..3314412,3314787..3314879,3315918..3315982,
FT                   3317160..3317223,3319582..3319688,3321143..3321185)
FT                   /codon_start=1
FT                   /gene="1500031M22Rik"
FT                   /locus_tag="mCG_9793"
FT                   /product="RIKEN cDNA 1500031M22, isoform CRA_b"
FT                   /note="gene_id=mCG9793.2 transcript_id=mCT9808.2
FT                   protein_id=mCP10641.2 isoform=CRA_b"
FT                   /protein_id="EDL18475.1"
FT                   /translation="MPKAKSAASSRRRDRQEQRRELKRAGGLMFNTGIGQHILKNPLIV
FT                   NSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPLA
FT                   SKLQVLVGDVLKSDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILMFQREFALRL
FT                   VAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINFQE
FT                   WDGLVRITFVRKNKTLSAAFKSSAVQQLLEKNYRIHCSVQNTVIPEDFSIADKIQQILT
FT                   STGFSDKRARSMDIDDFIRLLHGFNAEGIHFS"
FT   CDS             join(<3312090..3312254,3312338..3312387,3314289..3314412,
FT                   3314787..3314879,3315918..3315982,3317160..3317223,
FT                   3319582..3319688,3321143..3321185)
FT                   /codon_start=1
FT                   /gene="1500031M22Rik"
FT                   /locus_tag="mCG_9793"
FT                   /product="RIKEN cDNA 1500031M22, isoform CRA_a"
FT                   /note="gene_id=mCG9793.2 transcript_id=mCT191193.0
FT                   protein_id=mCP112151.0 isoform=CRA_a"
FT                   /protein_id="EDL18473.1"
FT                   /translation="VYVITKGHFSLLKQALTISLLVFRPLASKLQVLVGDVLKSDLPFF
FT                   DACVANLPYQISSPFVFKLLLHRPFFRCAILMFQREFALRLVAKPGDKLYCRLSINTQL
FT                   LARVDHLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRITFVRKNKTLSA
FT                   AFKSSAVQQLLEKNYRIHCSVQNTVIPEDFSIADKIQQILTSTGFSDKRARSMDIDDFI
FT                   RLLHGFNAEGIHFS"
FT   CDS             join(<3312090..3312254,3312338..3312387,3314289..3314412,
FT                   3314787..3314879,3315918..3315982,3317160..3317223,
FT                   3319582..3319688,3321143..3321185)
FT                   /codon_start=1
FT                   /gene="1500031M22Rik"
FT                   /locus_tag="mCG_9793"
FT                   /product="RIKEN cDNA 1500031M22, isoform CRA_a"
FT                   /note="gene_id=mCG9793.2 transcript_id=mCT191194.0
FT                   protein_id=mCP112152.0 isoform=CRA_a"
FT                   /protein_id="EDL18474.1"
FT                   /translation="VYVITKGHFSLLKQALTISLLVFRPLASKLQVLVGDVLKSDLPFF
FT                   DACVANLPYQISSPFVFKLLLHRPFFRCAILMFQREFALRLVAKPGDKLYCRLSINTQL
FT                   LARVDHLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRITFVRKNKTLSA
FT                   AFKSSAVQQLLEKNYRIHCSVQNTVIPEDFSIADKIQQILTSTGFSDKRARSMDIDDFI
FT                   RLLHGFNAEGIHFS"
FT   gene            complement(3322824..3384619)
FT                   /gene="Kif2a"
FT                   /locus_tag="mCG_9794"
FT                   /note="gene_id=mCG9794.3"
FT   mRNA            complement(join(3322824..3324710,3326827..3326962,
FT                   3327504..3327605,3331154..3331304,3337011..3337078,
FT                   3337887..3337997,3339163..3339367,3339493..3339635,
FT                   3340486..3340577,3341434..3341497,3341939..3342029,
FT                   3345025..3345187,3345694..3345748,3347540..3347635,
FT                   3349743..3349843,3350425..3350547,3352500..3352554,
FT                   3355623..3355739,3356308..3356402,3384517..3384614))
FT                   /gene="Kif2a"
FT                   /locus_tag="mCG_9794"
FT                   /product="kinesin family member 2A, transcript variant
FT                   mCT175624"
FT                   /note="gene_id=mCG9794.3 transcript_id=mCT175624.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(3323070..3324710,3326827..3326962,
FT                   3327504..3327605,3331154..3331304,3332220..3332333,
FT                   3337011..3337078,3337887..3337997,3339163..3339367,
FT                   3339493..3339635,3340486..3340577,3341434..3341497,
FT                   3341939..3342029,3345025..3345187,3345694..3345748,
FT                   3347540..3347635,3349743..3349843,3350425..3350547,
FT                   3352500..3352554,3355623..3355739,3356308..3356402,
FT                   3359207..3359589,3384517..3384619))
FT                   /gene="Kif2a"
FT                   /locus_tag="mCG_9794"
FT                   /product="kinesin family member 2A, transcript variant
FT                   mCT9809"
FT                   /note="gene_id=mCG9794.3 transcript_id=mCT9809.2 created on
FT                   10-JUN-2003"
FT   CDS             complement(join(3324625..3324710,3326827..3326962,
FT                   3327504..3327605,3331154..3331304,3337011..3337078,
FT                   3337887..3337997,3339163..3339367,3339493..3339635,
FT                   3340486..3340577,3341434..3341497,3341939..3342029,
FT                   3345025..3345187,3345694..3345748,3347540..3347635,
FT                   3349743..3349843,3350425..3350547,3352500..3352554,
FT                   3355623..3355739,3356308..3356402,3384517..3384580))
FT                   /codon_start=1
FT                   /gene="Kif2a"
FT                   /locus_tag="mCG_9794"
FT                   /product="kinesin family member 2A, isoform CRA_a"
FT                   /note="gene_id=mCG9794.3 transcript_id=mCT175624.1
FT                   protein_id=mCP98546.1 isoform=CRA_a"
FT                   /protein_id="EDL18470.1"
FT                   /translation="MATANFGKIQIGIYVEIKRSDGRIHQAMVTSLNEDNESVTVEWIE
FT                   NGDTKGKEIDLESIFSLNPDLVPDEDIEPSPELPPPSSSSKVNKIVKNRRTVAAVKNDP
FT                   PPRDNRVVGSARARPSQLPEQSSSAQQNGSVSDISPVQAAKKEFGPPSRRKSNCVKEVE
FT                   KLQEKREKRRLQQQELREKRAQDVDATNPNYEIMCMIRDFRGSLDYRPLTTADPIDEHR
FT                   ICVCVRKRPLNKKETQMKDLDVITIPSKDVVMVHEPKQKVDLTRYLENQTFRFDYAFDD
FT                   SAPNEMVYRFTARPLVETIFERGMATCFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYAL
FT                   AARDVFLMLKKPNYKKLELQVYATFFEIYSGKVFDLLNRKTKLRVLEDGKQQVQVVGLQ
FT                   EREVKCVEDVLKLIDIGNSCRTSGQTSANAHSSRSHAVFQIILRRKGKLHGKFSLIDLA
FT                   GNERGADTSSADRQTRLEGAEINKSLLALKECIRALGRNKPHTPFRASKLTQVLRDSFI
FT                   GENSRTCMIATISPGMASCENTLNTLRYANRVKELTVNPAAAGDVHPIMHHPPSQIDDL
FT                   ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVEDHRAVFQESI
FT                   RWIEDEKALLEMTEEVDYDVDSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQAS
FT                   KQINPKRPRAL"
FT   CDS             complement(join(3324625..3324710,3326827..3326962,
FT                   3327504..3327605,3331154..3331304,3332220..3332333,
FT                   3337011..3337078,3337887..3337997,3339163..3339367,
FT                   3339493..3339635,3340486..3340577,3341434..3341497,
FT                   3341939..3342029,3345025..3345187,3345694..3345748,
FT                   3347540..3347635,3349743..3349843,3350425..3350547,
FT                   3352500..3352554,3355623..3355739,3356308..3356385))
FT                   /codon_start=1
FT                   /gene="Kif2a"
FT                   /locus_tag="mCG_9794"
FT                   /product="kinesin family member 2A, isoform CRA_b"
FT                   /note="gene_id=mCG9794.3 transcript_id=mCT9809.2
FT                   protein_id=mCP10636.1 isoform=CRA_b"
FT                   /protein_id="EDL18471.1"
FT                   /translation="MVTSLNEDNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEDI
FT                   EPSPELPPPSSSSKVNKIVKNRRTVAAVKNDPPPRDNRVVGSARARPSQLPEQSSSAQQ
FT                   NGSVSDISPVQAAKKEFGPPSRRKSNCVKEVEKLQEKREKRRLQQQELREKRAQDVDAT
FT                   NPNYEIMCMIRDFRGSLDYRPLTTADPIDEHRICVCVRKRPLNKKETQMKDLDVITIPS
FT                   KDVVMVHEPKQKVDLTRYLENQTFRFDYAFDDSAPNEMVYRFTARPLVETIFERGMATC
FT                   FAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDVFLMLKKPNYKKLELQVYATFFE
FT                   IYSGKVFDLLNRKTKLRVLEDGKQQVQVVGLQEREVKCVEDVLKLIDIGNSCRTSGQTS
FT                   ANAHSSRSHAVFQIILRRKGKLHGKFSLIDLAGNERGADTSSADRQTRLEGAEINKSLL
FT                   ALKECIRALGRNKPHTPFRASKLTQVLRDSFIGENSRTCMIATISPGMASCENTLNTLR
FT                   YANRVKEFGISPSDIPFSQGGGSRPDLSPSYDYDDFSPSITRVKELTVNPAAAGDVHPI
FT                   MHHPPSQIDDLETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVV
FT                   EDHRAVFQESIRWIEDEKALLEMTEEVDYDVDSYATQLEAILEQKIDILTELRDKVKSF
FT                   RAALQEEEQASKQINPKRPRAL"
FT   assembly_gap    3339883..3339902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3342200..3342747,3345025..3345187,
FT                   3345694..3345748,3347540..3347635,3349743..3349843,
FT                   3350425..3350547,3352500..3352554,3355623..3355739,
FT                   3356308..3356402,3384150..3384256))
FT                   /gene="Kif2a"
FT                   /locus_tag="mCG_9794"
FT                   /product="kinesin family member 2A, transcript variant
FT                   mCT185686"
FT                   /note="gene_id=mCG9794.3 transcript_id=mCT185686.0 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(3342684..3342747,3345025..3345187,
FT                   3345694..3345748,3347540..3347635,3349743..3349843,
FT                   3350425..3350547,3352500..3352554,3355623..3355739,
FT                   3356308..3356385))
FT                   /codon_start=1
FT                   /gene="Kif2a"
FT                   /locus_tag="mCG_9794"
FT                   /product="kinesin family member 2A, isoform CRA_c"
FT                   /note="gene_id=mCG9794.3 transcript_id=mCT185686.0
FT                   protein_id=mCP106944.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9D481"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="MGI:MGI:108390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D481"
FT                   /protein_id="EDL18472.1"
FT                   /translation="MVTSLNEDNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEDI
FT                   EPSPELPPPSSSSKVNKIVKNRRTVAAVKNDPPPRDNRVVGSARARPSQLPEQSSSAQQ
FT                   NGSVSDISPVQAAKKEFGPPSRRKSNCVKEVEKLQEKREKRRLQQQELREKRAQDVDAT
FT                   NPNYEIMCMIRDFRGSLDYRPLTTADPIDEHRICVCVRKRPLNKKETQMKDLDVITIPS
FT                   KDVVMVHEPKQKVDLTRYLENQTFRFDYAFDDSAPNEMVYRLFSKLIMILSSSGWTKNK
FT                   LC"
FT   assembly_gap    3343120..3343139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3346769..3346809
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    3384836..3384855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3385083..>3395883
FT                   /locus_tag="mCG_52932"
FT                   /note="gene_id=mCG52932.1"
FT   mRNA            join(<3385083..3386494,3388777..3388833,3395138..3395311,
FT                   3395627..3395883)
FT                   /locus_tag="mCG_52932"
FT                   /product="mCG52932, transcript variant mCT53115"
FT                   /note="gene_id=mCG52932.1 transcript_id=mCT53115.1 created
FT                   on 20-NOV-2002"
FT   CDS             <3385085..3385510
FT                   /codon_start=1
FT                   /locus_tag="mCG_52932"
FT                   /product="mCG52932, isoform CRA_b"
FT                   /note="gene_id=mCG52932.1 transcript_id=mCT53115.1
FT                   protein_id=mCP32453.1 isoform=CRA_b"
FT                   /protein_id="EDL18469.1"
FT                   /translation="TRAGFDSARGGLRGAGNDSRRPSRAPAPRARCRRNGLRAEWDRGF
FT                   RGAGLRGTDRLKNWLSAFLWLSDRMPLRGSRSLRNLIKAGACLVQASHQLWREERVSST
FT                   LSRNEDLPLPFTSQLIAIQSEALLGYQRACPAILLLQ"
FT   mRNA            join(<3385555..3386494,3388777..3388833,3394088..3394348,
FT                   3395138..3395311,3395627..>3395883)
FT                   /locus_tag="mCG_52932"
FT                   /product="mCG52932, transcript variant mCT191192"
FT                   /note="gene_id=mCG52932.1 transcript_id=mCT191192.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3395230..3395311,3395627..>3395883)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52932"
FT                   /product="mCG52932, isoform CRA_a"
FT                   /note="gene_id=mCG52932.1 transcript_id=mCT191192.0
FT                   protein_id=mCP112148.0 isoform=CRA_a"
FT                   /protein_id="EDL18468.1"
FT                   /translation="CKQQDQTAVQQCLSGDKRLCQLQGNFRGQRSIYGPKRLLRPMSLR
FT                   RMLISRQQKILMKQENPVGDNKEHFCKEGPVMATAISSKGLPSNGYPFGDDNQVLQRIT
FT                   WTPIKSQRT"
FT   assembly_gap    3403593..3403612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3409483..3409502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3410727..3410746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3412000..3412019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3413368..3413871
FT                   /estimated_length=504
FT                   /gap_type="unknown"
FT   assembly_gap    3414967..3414986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3416269..3416288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3429720..3429739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3436498..3436517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3518028..3518272
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    3519373..3519392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3527864..3528112
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    3530437..3531253
FT                   /estimated_length=817
FT                   /gap_type="unknown"
FT   assembly_gap    3550076..3550137
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    3555170..3555218
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    3564292..3564421
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    3569488..3569507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3606667..3606686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3634067..3634092
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    3653937..3654121
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    3660963..3661016
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    3686902..3686921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3719769..3722812
FT                   /estimated_length=3044
FT                   /gap_type="unknown"
FT   assembly_gap    3732976..3733004
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    3763262..3763281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3766069..3766088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3767275..3767294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3781334..>3782254)
FT                   /locus_tag="mCG_51413"
FT                   /note="gene_id=mCG51413.2"
FT   mRNA            complement(3781334..>3782254)
FT                   /locus_tag="mCG_51413"
FT                   /product="mCG51413"
FT                   /note="gene_id=mCG51413.2 transcript_id=mCT51596.2 created
FT                   on 20-FEB-2003"
FT   CDS             complement(3781627..>3782253)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51413"
FT                   /product="mCG51413"
FT                   /note="gene_id=mCG51413.2 transcript_id=mCT51596.2
FT                   protein_id=mCP32484.2"
FT                   /protein_id="EDL18467.1"
FT                   /translation="DPGGAAAASDMFKVIQRSVGPASLSLLTFRVYAAPKKDSPHKSYM
FT                   KIDELSLYSVPEGQSKYVEEPRTQLEENISQLRHHCEPYTSFCQEIYSHTKPKVDHFVQ
FT                   WGVDNYNYLQNAPPGFFPRLGVIGFAGFVGLLFARGSKIKKLVYPPFFMGLGASVYYPQ
FT                   QAITIAQITGEKLYDWGLRGYIVIEDLWKQNFQKPGNVKNSPGNK"
FT   assembly_gap    3788787..3788901
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    3794707..3794825
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    3799885..3803646
FT                   /estimated_length=3762
FT                   /gap_type="unknown"
FT   assembly_gap    3804892..3804911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3834081..3834175
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   gene            <3836993..3846360
FT                   /locus_tag="mCG_142514"
FT                   /note="gene_id=mCG142514.0"
FT   mRNA            join(<3836993..3837098,3839619..3840742,3842842..3846360)
FT                   /locus_tag="mCG_142514"
FT                   /product="mCG142514, transcript variant mCT180605"
FT                   /note="gene_id=mCG142514.0 transcript_id=mCT180605.0
FT                   created on 20-FEB-2003"
FT   mRNA            join(<3836993..3837098,3839720..3841168)
FT                   /locus_tag="mCG_142514"
FT                   /product="mCG142514, transcript variant mCT180606"
FT                   /note="gene_id=mCG142514.0 transcript_id=mCT180606.0
FT                   created on 20-FEB-2003"
FT   CDS             <3840350..3840646
FT                   /codon_start=1
FT                   /locus_tag="mCG_142514"
FT                   /product="mCG142514, isoform CRA_a"
FT                   /note="gene_id=mCG142514.0 transcript_id=mCT180605.0
FT                   protein_id=mCP103527.0 isoform=CRA_a"
FT                   /protein_id="EDL18465.1"
FT                   /translation="APNSWSSGYECHGSSSTCTPCFDFCLDLSSSPLYRPFLTFLSSCI
FT                   QRLLFECLLYILEAKRLINQNMIKKQSMLQEGSNQQSKKEPVQCVRWLKSQVG"
FT   CDS             <3840350..3840646
FT                   /codon_start=1
FT                   /locus_tag="mCG_142514"
FT                   /product="mCG142514, isoform CRA_a"
FT                   /note="gene_id=mCG142514.0 transcript_id=mCT180606.0
FT                   protein_id=mCP103528.0 isoform=CRA_a"
FT                   /protein_id="EDL18466.1"
FT                   /translation="APNSWSSGYECHGSSSTCTPCFDFCLDLSSSPLYRPFLTFLSSCI
FT                   QRLLFECLLYILEAKRLINQNMIKKQSMLQEGSNQQSKKEPVQCVRWLKSQVG"
FT   assembly_gap    3851029..3854148
FT                   /estimated_length=3120
FT                   /gap_type="unknown"
FT   assembly_gap    3862411..3862630
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    3867362..3867381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3883343..3883915
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   gene            complement(3890985..>3933433)
FT                   /locus_tag="mCG_142513"
FT                   /note="gene_id=mCG142513.0"
FT   mRNA            complement(join(3890985..3891520,3891710..3891847,
FT                   3893489..3893635,3905037..3905094,3906986..3907091,
FT                   3933360..>3933433))
FT                   /locus_tag="mCG_142513"
FT                   /product="mCG142513, transcript variant mCT180602"
FT                   /note="gene_id=mCG142513.0 transcript_id=mCT180602.0
FT                   created on 20-FEB-2003"
FT   CDS             complement(join(3891368..3891520,3891710..>3891766))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142513"
FT                   /product="mCG142513, isoform CRA_a"
FT                   /note="gene_id=mCG142513.0 transcript_id=mCT180602.0
FT                   protein_id=mCP103524.0 isoform=CRA_a"
FT                   /protein_id="EDL18462.1"
FT                   /translation="PLAARWSRGDPAQSPLDVQRRSSGHQQPQTETTETGSQHTSVHLL
FT                   NCVCQILRHSNEESDQYGISSIMS"
FT   mRNA            complement(join(3891414..3891523,3891710..3891847,
FT                   3906986..3907091,3933360..>3933430))
FT                   /locus_tag="mCG_142513"
FT                   /product="mCG142513, transcript variant mCT180603"
FT                   /note="gene_id=mCG142513.0 transcript_id=mCT180603.0
FT                   created on 20-FEB-2003"
FT   CDS             complement(join(3891442..3891523,3891710..>3891807))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142513"
FT                   /product="mCG142513, isoform CRA_b"
FT                   /note="gene_id=mCG142513.0 transcript_id=mCT180603.0
FT                   protein_id=mCP103525.0 isoform=CRA_b"
FT                   /protein_id="EDL18463.1"
FT                   /translation="EKTVTYRAEENPGDHWQPDGAGVTQLSHPWMFSREEAPAISSHRL
FT                   KPQRLGASIRPSIF"
FT   mRNA            complement(join(3893024..3893635,3933360..>3933410))
FT                   /locus_tag="mCG_142513"
FT                   /product="mCG142513, transcript variant mCT180604"
FT                   /note="gene_id=mCG142513.0 transcript_id=mCT180604.0
FT                   created on 20-FEB-2003"
FT   CDS             complement(join(3893383..3893635,3933360..>3933409))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142513"
FT                   /product="mCG142513, isoform CRA_c"
FT                   /note="gene_id=mCG142513.0 transcript_id=mCT180604.0
FT                   protein_id=mCP103526.0 isoform=CRA_c"
FT                   /protein_id="EDL18464.1"
FT                   /translation="VSIGLVCSASLFFNNNRNPSFIDTWHTASTMGNNKHEENKHTDVY
FT                   VYQLYSQRQAMSVLKWSTPAGLVHDSMMSWDIRLWSVFFVFLFVVFSLTSTFDGC"
FT   assembly_gap    3894411..3894430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3899300..3900458
FT                   /estimated_length=1159
FT                   /gap_type="unknown"
FT   assembly_gap    3903012..3903031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3930542..3930561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3941368..3941452
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    3947446..3947465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3949972..3950533
FT                   /estimated_length=562
FT                   /gap_type="unknown"
FT   assembly_gap    3952459..3952661
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    3968730..3968749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3981266..3981303
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    4023074..4023228
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    4029292..4029311
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4030840..4030877
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    4034889..4035876
FT                   /estimated_length=988
FT                   /gap_type="unknown"
FT   assembly_gap    4037747..4037766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4039184..4039247
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    4043651..4043689
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   gene            <4054320..4059094
FT                   /locus_tag="mCG_142512"
FT                   /note="gene_id=mCG142512.0"
FT   mRNA            join(<4054320..4054508,4056873..4057028,4058816..4059094)
FT                   /locus_tag="mCG_142512"
FT                   /product="mCG142512"
FT                   /note="gene_id=mCG142512.0 transcript_id=mCT180597.0
FT                   created on 20-FEB-2003"
FT   CDS             join(<4054451..4054508,4056873..4057027)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142512"
FT                   /product="mCG142512"
FT                   /note="gene_id=mCG142512.0 transcript_id=mCT180597.0
FT                   protein_id=mCP103519.0"
FT                   /protein_id="EDL18461.1"
FT                   /translation="PVLSGGWLIQGLEVGKEFPDVQVEGSLPSSHLLQQPSRFIRNIKA
FT                   RGFCKPSASFASSERGCPWTSCSKL"
FT   gene            complement(4091545..>4154737)
FT                   /locus_tag="mCG_10236"
FT                   /note="gene_id=mCG10236.2"
FT   mRNA            complement(join(4091545..4094226,4095501..4095582,
FT                   4097156..4097319,4097978..4098135,4100728..4100863,
FT                   4105308..4105568,4107169..4107315,4110472..4110618,
FT                   4110897..4111073,4115120..4115299,4136485..4136635,
FT                   4140298..4140446,4154381..>4154737))
FT                   /locus_tag="mCG_10236"
FT                   /product="mCG10236"
FT                   /note="gene_id=mCG10236.2 transcript_id=mCT10298.2 created
FT                   on 01-JUL-2003"
FT   CDS             complement(join(4093364..4094226,4095501..4095582,
FT                   4097156..4097319,4097978..4098135,4100728..4100863,
FT                   4105308..4105568,4107169..4107315,4110472..4110618,
FT                   4110897..4111073,4115120..4115299,4136485..4136635,
FT                   4140298..4140446,4154381..>4154735))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10236"
FT                   /product="mCG10236"
FT                   /note="gene_id=mCG10236.2 transcript_id=mCT10298.2
FT                   protein_id=mCP10625.1"
FT                   /protein_id="EDL18460.1"
FT                   /translation="FHLSGTVTEPAIQPEPETVCNVAISFDRCKITSVTCSCGNKDIFY
FT                   CAHVVALSLYRIRKPEQVKLHLPISETLFQMNRDQLQKFVQYLITVHHTEVLPTAQKLA
FT                   DEILSQNSEINQVHGAPDPTAGASIDDENCWHLDEEQVQEQVKVFLSQGGYHGSGKQLN
FT                   MLFAKVREMLKMRDSNGARMLTLITEQFMADPRLSLWRQQGTAMTDKYRQLWDELGALW
FT                   MCIVLNPHCKLEQKASWLKQLKKWNSVDVCPWEDGNHGSELPNLTNALPQGANANQDSS
FT                   NRPHRTVFTRAIEACDLHWQDSHLQHIISSDLYTNYCYHDDTENSLFDSRGWPLWHEHV
FT                   PTACARVDALRSHGYPREALRLAIAIVNTLRRQQQKQLEMFRTQKKELPHKSITSITNL
FT                   EGWVGHPLDPVGTLFSSLMEACHTDGDAFSGFSDCTDNMGQCKSLEYHHLPAHKFLEEG
FT                   ESYVTLAVEVALIGLGQQRIMPDGLYTQEKVCRNEEQLISKLQEIELDDTLVKIFRKQA
FT                   VFLLEAGPYSGLGEIIHRESVPMHTFAKYLFTSLLPHDAELAYKIALRAMRLLVLESTA
FT                   PTGDLSRPHHIASVVPNRYPRWFTLSHIESQQCELASTMLTAAKGDVRRLETVLESIQK
FT                   NIHSSSHIFKLAQDAFKIATLMDSLPDITLLKVSLELGLQVMRMTLSTLNWRRREMVRW
FT                   LVTCATEVGVYALDSIMQSWFTLFTPTEATSIVATTVMSNSTIVRLHLDCHQQEKLASS
FT                   ARTLALQCAMKDPQNCALSALTLCEKDHIAFETAYQIVLDAATTGMSYTQLFTIARYME
FT                   HRGYPMRAYKLATLAMTHLNLSYNQDTHPAINDVLWACALSHSLGKNELAAIIPLVVKS
FT                   VKCATVLSDILRRCTLTTPGMVGLHGRRNSGKLMSLDKAPLRQLLDATIGAYINTTHSR
FT                   LTHISPRHYSEFIEFLSKARETFLMAHDGHIQFTQFIDNLKQIYKGKKKLMMLVRERFG
FT                   "
FT   assembly_gap    4146126..4146182
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    4149125..4149144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4160124..4160143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4189332..4190332
FT                   /estimated_length=1001
FT                   /gap_type="unknown"
FT   assembly_gap    4195899..4195918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4227217..4227703
FT                   /estimated_length=487
FT                   /gap_type="unknown"
FT   assembly_gap    4242819..4242909
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    4246218..4248331
FT                   /estimated_length=2114
FT                   /gap_type="unknown"
FT   assembly_gap    4254156..4254544
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    4255634..4256711
FT                   /estimated_length=1078
FT                   /gap_type="unknown"
FT   assembly_gap    4259734..4261877
FT                   /estimated_length=2144
FT                   /gap_type="unknown"
FT   assembly_gap    4280420..4280584
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    4283966..4284931
FT                   /estimated_length=966
FT                   /gap_type="unknown"
FT   assembly_gap    4304721..4304740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4318235..4318571
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    4322978..4323175
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    4328726..4328745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4357791..4357810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4363452..4369052
FT                   /locus_tag="mCG_1033067"
FT                   /note="gene_id=mCG1033067.1"
FT   mRNA            join(<4363452..4363683,4367540..4369052)
FT                   /locus_tag="mCG_1033067"
FT                   /product="mCG1033067"
FT                   /note="gene_id=mCG1033067.1 transcript_id=mCT150771.1
FT                   created on 20-FEB-2003"
FT   CDS             join(<4363630..4363683,4367540..4367866)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033067"
FT                   /product="mCG1033067"
FT                   /note="gene_id=mCG1033067.1 transcript_id=mCT150771.1
FT                   protein_id=mCP83936.1"
FT                   /protein_id="EDL18459.1"
FT                   /translation="ATDAFQQSPLGLEDPNLQNNHSVMNFDVRSEPPETVGFLEEYLMC
FT                   SDEQPQEPRGYLCHCSFAVRRHHDHCTSYKGKHLIGAALQFQRFSPLLSWQETWQHAGG
FT                   HGAAGGDESCTSGSTGSRKRTG"
FT   assembly_gap    4366163..4366182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4366721..>4522731)
FT                   /locus_tag="mCG_10234"
FT                   /note="gene_id=mCG10234.2"
FT   mRNA            complement(join(4366721..4368798,4376250..4376307,
FT                   4388596..4388682,4522547..>4522731))
FT                   /locus_tag="mCG_10234"
FT                   /product="mCG10234, transcript variant mCT180595"
FT                   /note="gene_id=mCG10234.2 transcript_id=mCT180595.0 created
FT                   on 20-FEB-2003"
FT   CDS             complement(4368315..>4368548)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10234"
FT                   /product="mCG10234, isoform CRA_a"
FT                   /note="gene_id=mCG10234.2 transcript_id=mCT180595.0
FT                   protein_id=mCP103517.0 isoform=CRA_a"
FT                   /protein_id="EDL18454.1"
FT                   /translation="YRLKIKTQFKRLWLTEPGARRHWSRRASSPHAFALHSALVFSLLG
FT                   REDFGFCTGSKKIWGEVTSSYLSIKVGVDPLG"
FT   gene            <4408795..4413514
FT                   /locus_tag="mCG_51409"
FT                   /note="gene_id=mCG51409.1"
FT   mRNA            join(<4408795..4408841,4410773..4410916,4411786..4413514)
FT                   /locus_tag="mCG_51409"
FT                   /product="mCG51409, transcript variant mCT51592"
FT                   /note="gene_id=mCG51409.1 transcript_id=mCT51592.1 created
FT                   on 20-FEB-2003"
FT   mRNA            join(<4408805..4408841,4410773..4410916,4411732..4412381)
FT                   /locus_tag="mCG_51409"
FT                   /product="mCG51409, transcript variant mCT180601"
FT                   /note="gene_id=mCG51409.1 transcript_id=mCT180601.0 created
FT                   on 20-FEB-2003"
FT   mRNA            join(<4408839..4408988,4410773..4410916,4411786..4413512)
FT                   /locus_tag="mCG_51409"
FT                   /product="mCG51409, transcript variant mCT180600"
FT                   /note="gene_id=mCG51409.1 transcript_id=mCT180600.0 created
FT                   on 20-FEB-2003"
FT   CDS             join(<4410879..4410916,4411732..4412032)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51409"
FT                   /product="mCG51409, isoform CRA_b"
FT                   /note="gene_id=mCG51409.1 transcript_id=mCT180601.0
FT                   protein_id=mCP103523.0 isoform=CRA_b"
FT                   /protein_id="EDL18457.1"
FT                   /translation="SQGKIRGHYSNISLLFCFVFFFFPPSLHSPSCFLLAAKMLDIKAW
FT                   AEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQKRQENIA
FT                   KAKRLKKD"
FT   CDS             join(<4410879..4410916,4411786..4412032)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51409"
FT                   /product="mCG51409, isoform CRA_a"
FT                   /note="gene_id=mCG51409.1 transcript_id=mCT180600.0
FT                   protein_id=mCP103522.0 isoform=CRA_a"
FT                   /protein_id="EDL18456.1"
FT                   /translation="SQGKIRGHYSNISCFLLAAKMLDIKAWAEYVVEWAAKDPYGFLTT
FT                   VILALTPLFLASAVLSWKLAKMIEAREKEQKKKQKRQENIAKAKRLKKD"
FT   CDS             join(<4410879..4410916,4411786..4412032)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51409"
FT                   /product="mCG51409, isoform CRA_a"
FT                   /note="gene_id=mCG51409.1 transcript_id=mCT51592.1
FT                   protein_id=mCP32467.1 isoform=CRA_a"
FT                   /protein_id="EDL18458.1"
FT                   /translation="SQGKIRGHYSNISCFLLAAKMLDIKAWAEYVVEWAAKDPYGFLTT
FT                   VILALTPLFLASAVLSWKLAKMIEAREKEQKKKQKRQENIAKAKRLKKD"
FT   mRNA            complement(join(4416936..4417268,4445564..4445604,
FT                   4455780..4455869,4522547..>4522720))
FT                   /locus_tag="mCG_10234"
FT                   /product="mCG10234, transcript variant mCT10293"
FT                   /note="gene_id=mCG10234.2 transcript_id=mCT10293.2 created
FT                   on 20-FEB-2003"
FT   CDS             complement(join(4417020..4417268,4445564..4445604,
FT                   4455780..4455869,4522547..>4522718))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10234"
FT                   /product="mCG10234, isoform CRA_b"
FT                   /note="gene_id=mCG10234.2 transcript_id=mCT10293.2
FT                   protein_id=mCP10648.1 isoform=CRA_b"
FT                   /protein_id="EDL18455.1"
FT                   /translation="LRWRVEASDLEFGAGMSWWSGVWRSVWSALSREVREHVGTDHLGN
FT                   KYYYVAEYKNWRGQTIREKRIVEAANRKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEIL
FT                   KNEKYREEIKIKSQDFYEKDKLGKETSEELLPSPTATQVKGHASAPYFGREEPSVAPTS
FT                   TGKTFQPGSWTPEDGKRQSQ"
FT   assembly_gap    4464120..4464208
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    4497858..4497877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4522210..4522246
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            4522841..4559221
FT                   /gene="Ercc8"
FT                   /locus_tag="mCG_10235"
FT                   /note="gene_id=mCG10235.2"
FT   mRNA            join(4522841..4522974,4524757..4524852,4530509..4530610,
FT                   4533529..4533652,4536857..4536938,4538146..4538214,
FT                   4539708..4539774,4541722..4541822,4542677..4542801,
FT                   4547809..4548006,4551304..4551387,4557909..4559221)
FT                   /gene="Ercc8"
FT                   /locus_tag="mCG_10235"
FT                   /product="excision repaiross-complementing rodent repair
FT                   deficiency, complementation group 8, transcript variant
FT                   mCT10296"
FT                   /note="gene_id=mCG10235.2 transcript_id=mCT10296.3 created
FT                   on 01-JUL-2003"
FT   mRNA            join(4522841..4522974,4524757..4524852,4533529..4533652,
FT                   4536857..4536938,4538146..4538214,4539708..4539774,
FT                   4541722..4541822,4542677..4542801,4547809..4548006,
FT                   4551304..4551387,4557909..4559221)
FT                   /gene="Ercc8"
FT                   /locus_tag="mCG_10235"
FT                   /product="excision repaiross-complementing rodent repair
FT                   deficiency, complementation group 8, transcript variant
FT                   mCT175926"
FT                   /note="gene_id=mCG10235.2 transcript_id=mCT175926.1 created
FT                   on 01-JUL-2003"
FT   mRNA            join(4522841..4522974,4524757..4524852,4533529..4533652,
FT                   4536857..4536938,4538146..4538214,4539708..4540455,
FT                   4540602..4541353)
FT                   /gene="Ercc8"
FT                   /locus_tag="mCG_10235"
FT                   /product="excision repaiross-complementing rodent repair
FT                   deficiency, complementation group 8, transcript variant
FT                   mCT186476"
FT                   /note="gene_id=mCG10235.2 transcript_id=mCT186476.0 created
FT                   on 01-JUL-2003"
FT   mRNA            join(4522841..4522974,4524757..4524852,4530509..4530610,
FT                   4533529..4533652,4536857..4536938,4538146..4538752)
FT                   /gene="Ercc8"
FT                   /locus_tag="mCG_10235"
FT                   /product="excision repaiross-complementing rodent repair
FT                   deficiency, complementation group 8, transcript variant
FT                   mCT175927"
FT                   /note="gene_id=mCG10235.2 transcript_id=mCT175927.0 created
FT                   on 01-JUL-2003"
FT   mRNA            join(4522841..4522974,4524757..4527782)
FT                   /gene="Ercc8"
FT                   /locus_tag="mCG_10235"
FT                   /product="excision repaiross-complementing rodent repair
FT                   deficiency, complementation group 8, transcript variant
FT                   mCT186477"
FT                   /note="gene_id=mCG10235.2 transcript_id=mCT186477.0 created
FT                   on 01-JUL-2003"
FT   mRNA            join(<4522858..4522974,4524757..4524852,4533529..4533652,
FT                   4536857..4536938,4538146..4538214,4539708..4539774,
FT                   4539959..4540060,4541722..4541822,4542677..4542801,
FT                   4547809..4548006,4551304..4551387,4557909..4558834)
FT                   /gene="Ercc8"
FT                   /locus_tag="mCG_10235"
FT                   /product="excision repaiross-complementing rodent repair
FT                   deficiency, complementation group 8, transcript variant
FT                   mCT191211"
FT                   /note="gene_id=mCG10235.2 transcript_id=mCT191211.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(4522898..4522974,4524757..4524852,4530509..4530610,
FT                   4533529..4533652,4536857..4536938,4538146..4538214,
FT                   4539708..4539774,4541722..4541822,4542677..4542801,
FT                   4547809..4548006,4551304..4551387,4557909..4557977)
FT                   /codon_start=1
FT                   /gene="Ercc8"
FT                   /locus_tag="mCG_10235"
FT                   /product="excision repaiross-complementing rodent repair
FT                   deficiency, complementation group 8, isoform CRA_a"
FT                   /note="gene_id=mCG10235.2 transcript_id=mCT10296.3
FT                   protein_id=mCP10623.3 isoform=CRA_a"
FT                   /protein_id="EDL18448.1"
FT                   /translation="MLSFLSARQSGLEDPLRLRRAQSTRRVLGLELNKDRDVERIHGSG
FT                   VNTLDIEPVEGRYMLSGGSDGVVVLYDLENASRQPHYTCKAVCSVGRSHPDVHKYSVET
FT                   VQWYPHDTGMFTSSSFDKTLKVWDTNTLQAADVFNFEETVYSHHMSPAATKHCLVAVGT
FT                   RGPKVQLCDLKSGSCSHILQGHRQEILAVSWSPRHDYILATASADSRVKLWDVRRASGC
FT                   LLTLDQHNGKKSQAAESANTAHNGKVNGLCFTSDGLHLLTIGTDNRMRLWNSSSGDNTL
FT                   VNYGKVCNDSRKGLQFAVSCGCSSEFVFVPHGSTIAVYAVHSGERLAMLKGHYKSVDCC
FT                   VFQPNFQELYSGSRDCNILAWVPPSYEPVPDDDDEAPAKSQLNPAFADAWSSSDEDG"
FT   CDS             join(4522898..4522974,4524757..4524852,4530509..4530610,
FT                   4533529..4533652,4536857..4536938,4538146..4538267)
FT                   /codon_start=1
FT                   /gene="Ercc8"
FT                   /locus_tag="mCG_10235"
FT                   /product="excision repaiross-complementing rodent repair
FT                   deficiency, complementation group 8, isoform CRA_c"
FT                   /note="gene_id=mCG10235.2 transcript_id=mCT175927.0
FT                   protein_id=mCP98849.1 isoform=CRA_c"
FT                   /db_xref="GOA:D3YU16"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1919241"
FT                   /db_xref="UniProtKB/TrEMBL:D3YU16"
FT                   /protein_id="EDL18450.1"
FT                   /translation="MLSFLSARQSGLEDPLRLRRAQSTRRVLGLELNKDRDVERIHGSG
FT                   VNTLDIEPVEGRYMLSGGSDGVVVLYDLENASRQPHYTCKAVCSVGRSHPDVHKYSVET
FT                   VQWYPHDTGMFTSSSFDKTLKVWDTNTLQAADVFNFEETVYSHHMSPAATKHCLVAVGT
FT                   RGPKVQLCDLKSGSCSHILQGIFSFFKYGTTTTFTKQ"
FT   CDS             join(4522898..4522974,4524757..4524853)
FT                   /codon_start=1
FT                   /gene="Ercc8"
FT                   /locus_tag="mCG_10235"
FT                   /product="excision repaiross-complementing rodent repair
FT                   deficiency, complementation group 8, isoform CRA_e"
FT                   /note="gene_id=mCG10235.2 transcript_id=mCT186477.0
FT                   protein_id=mCP107181.0 isoform=CRA_e"
FT                   /db_xref="GOA:D6RET0"
FT                   /db_xref="MGI:MGI:1919241"
FT                   /db_xref="UniProtKB/TrEMBL:D6RET0"
FT                   /protein_id="EDL18452.1"
FT                   /translation="MLSFLSARQSGLEDPLRLRRAQSTRRVLGLELNKDRDVERIHGSG
FT                   VNTLDIEPVEGR"
FT   CDS             join(4533593..4533652,4536857..4536938,4538146..4538214,
FT                   4539708..4539774,4541722..4541822,4542677..4542801,
FT                   4547809..4548006,4551304..4551387,4557909..4557977)
FT                   /codon_start=1
FT                   /gene="Ercc8"
FT                   /locus_tag="mCG_10235"
FT                   /product="excision repaiross-complementing rodent repair
FT                   deficiency, complementation group 8, isoform CRA_b"
FT                   /note="gene_id=mCG10235.2 transcript_id=mCT175926.1
FT                   protein_id=mCP98848.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TZV2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:1919241"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TZV2"
FT                   /protein_id="EDL18449.1"
FT                   /translation="MFTSSSFDKTLKVWDTNTLQAADVFNFEETVYSHHMSPAATKHCL
FT                   VAVGTRGPKVQLCDLKSGSCSHILQGHRQEILAVSWSPRHDYILATASADSRVKLWDVR
FT                   RASGCLLTLDQHNGKKSQAAESANTAHNGKVNGLCFTSDGLHLLTIGTDNRMRLWNSSS
FT                   GDNTLVNYGKVCNDSRKGLQFAVSCGCSSEFVFVPHGSTIAVYAVHSGERLAMLKGHYK
FT                   SVDCCVFQPNFQELYSGSRDCNILAWVPPSYEPVPDDDDEAPAKSQLNPAFADAWSSSD
FT                   EDG"
FT   CDS             join(4533593..4533652,4536857..4536938,4538146..4538214,
FT                   4539708..4539778)
FT                   /codon_start=1
FT                   /gene="Ercc8"
FT                   /locus_tag="mCG_10235"
FT                   /product="excision repaiross-complementing rodent repair
FT                   deficiency, complementation group 8, isoform CRA_d"
FT                   /note="gene_id=mCG10235.2 transcript_id=mCT186476.0
FT                   protein_id=mCP107180.0 isoform=CRA_d"
FT                   /protein_id="EDL18451.1"
FT                   /translation="MFTSSSFDKTLKVWDTNTLQAADVFNFEETVYSHHMSPAATKHCL
FT                   VAVGTRGPKVQLCDLKSGSCSHILQGHRQEILAVSWSPRHDYILATAR"
FT   CDS             join(<4540047..4540060,4541722..4541822,4542677..4542801,
FT                   4547809..4548006,4551304..4551387,4557909..4557977)
FT                   /codon_start=1
FT                   /gene="Ercc8"
FT                   /locus_tag="mCG_10235"
FT                   /product="excision repaiross-complementing rodent repair
FT                   deficiency, complementation group 8, isoform CRA_f"
FT                   /note="gene_id=mCG10235.2 transcript_id=mCT191211.0
FT                   protein_id=mCP112153.0 isoform=CRA_f"
FT                   /protein_id="EDL18453.1"
FT                   /translation="AHQFSADSRVKLWDVRRASGCLLTLDQHNGKKSQAAESANTAHNG
FT                   KVNGLCFTSDGLHLLTIGTDNRMRLWNSSSGDNTLVNYGKVCNDSRKGLQFAVSCGCSS
FT                   EFVFVPHGSTIAVYAVHSGERLAMLKGHYKSVDCCVFQPNFQELYSGSRDCNILAWVPP
FT                   SYEPVPDDDDEAPAKSQLNPAFADAWSSSDEDG"
FT   assembly_gap    4540456..4540601
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    4550197..4550216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4552524..4553316
FT                   /estimated_length=793
FT                   /gap_type="unknown"
FT   gene            complement(4560203..4563158)
FT                   /locus_tag="mCG_147608"
FT                   /note="gene_id=mCG147608.0"
FT   mRNA            complement(join(4560203..4560465,4560486..4563158))
FT                   /locus_tag="mCG_147608"
FT                   /product="mCG147608"
FT                   /note="gene_id=mCG147608.0 transcript_id=mCT187871.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(4561616..4562068)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147608"
FT                   /product="mCG147608"
FT                   /note="gene_id=mCG147608.0 transcript_id=mCT187871.0
FT                   protein_id=mCP108832.0"
FT                   /protein_id="EDL18447.1"
FT                   /translation="MFFAKKKKKKKRLGIVEAHVCHPSTGEAKAAGSGAGIQTECGGLN
FT                   ENGLHRLTELYTGHQRGALYERTKRCGLVGGSVSLGVDPEVPKPIPSLEALFLLSADSD
FT                   IQLLATSPAPCLPACHPDLHLHENGLSPQLNAFPCKSHCGFGVASQ"
FT   assembly_gap    4574241..4574664
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    4578309..4578328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4578329..4648758
FT                   /gene="Elovl7"
FT                   /locus_tag="mCG_113071"
FT                   /note="gene_id=mCG113071.1"
FT   mRNA            join(4578329..4578357,4620419..4620550,4630907..4631097,
FT                   4634347..4634427,4635543..4635599,4638023..4638128,
FT                   4643314..4643450,4646185..4648758)
FT                   /gene="Elovl7"
FT                   /locus_tag="mCG_113071"
FT                   /product="ELOVL family member 7, elongation of long chain
FT                   fatty acids (yeast), transcript variant mCT114149"
FT                   /note="gene_id=mCG113071.1 transcript_id=mCT114149.1
FT                   created on 20-NOV-2002"
FT   mRNA            join(<4578329..4578357,4620419..4620550,4630907..4631051,
FT                   4634347..4634427,4635543..4635599,4638023..4638128,
FT                   4643314..4643450,4646185..4647784)
FT                   /gene="Elovl7"
FT                   /locus_tag="mCG_113071"
FT                   /product="ELOVL family member 7, elongation of long chain
FT                   fatty acids (yeast), transcript variant mCT191187"
FT                   /note="gene_id=mCG113071.1 transcript_id=mCT191187.0
FT                   created on 09-MAR-2004"
FT   gene            complement(4584329..4584704)
FT                   /pseudo
FT                   /locus_tag="mCG_10239"
FT                   /note="gene_id=mCG10239.1"
FT   mRNA            complement(4584329..4584704)
FT                   /pseudo
FT                   /locus_tag="mCG_10239"
FT                   /note="gene_id=mCG10239.1 transcript_id=mCT10301.2 created
FT                   on 20-FEB-2003"
FT   gene            complement(4596922..4597387)
FT                   /pseudo
FT                   /locus_tag="mCG_50624"
FT                   /note="gene_id=mCG50624.2"
FT   mRNA            complement(4596922..4597387)
FT                   /pseudo
FT                   /locus_tag="mCG_50624"
FT                   /note="gene_id=mCG50624.2 transcript_id=mCT50807.1 created
FT                   on 20-FEB-2003"
FT   CDS             join(4620487..4620550,4630907..4631097,4634347..4634427,
FT                   4635543..4635599,4638023..4638128,4643314..4643450,
FT                   4646185..4646394)
FT                   /codon_start=1
FT                   /gene="Elovl7"
FT                   /locus_tag="mCG_113071"
FT                   /product="ELOVL family member 7, elongation of long chain
FT                   fatty acids (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG113071.1 transcript_id=mCT114149.1
FT                   protein_id=mCP83916.1 isoform=CRA_b"
FT                   /protein_id="EDL18446.1"
FT                   /translation="MAFSDLTSRTVRFYDNWIKDADPRVEDYLLMSSPLPQTIILGLYV
FT                   YFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDY
FT                   SQSPRAMRMVHTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVK
FT                   FAAGGLGTFHAFLNTAVHVVMYSYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTIHI
FT                   GQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTLENGNCKSKRH
FT                   "
FT   CDS             join(<4631031..4631051,4634347..4634427,4635543..4635599,
FT                   4638023..4638128,4643314..4643450,4646185..4646394)
FT                   /codon_start=1
FT                   /gene="Elovl7"
FT                   /locus_tag="mCG_113071"
FT                   /product="ELOVL family member 7, elongation of long chain
FT                   fatty acids (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG113071.1 transcript_id=mCT191187.0
FT                   protein_id=mCP112154.0 isoform=CRA_a"
FT                   /protein_id="EDL18445.1"
FT                   /translation="TQESDDNFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFS
FT                   KFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAVHV
FT                   VMYSYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTIHIGQIFFMEDCNYQYPVFLYI
FT                   IMSYGCIFLLLFLHFWYRAYTKGQRLPKTLENGNCKSKRH"
FT   assembly_gap    4652219..4652452
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    4657067..4657145
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    4658426..4658445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4669945..4671273
FT                   /estimated_length=1329
FT                   /gap_type="unknown"
FT   assembly_gap    4673041..4673430
FT                   /estimated_length=390
FT                   /gap_type="unknown"
FT   assembly_gap    4673980..4674081
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   gene            complement(4674236..4676527)
FT                   /pseudo
FT                   /locus_tag="mCG_10232"
FT                   /note="gene_id=mCG10232.1"
FT   mRNA            complement(4674236..4676527)
FT                   /pseudo
FT                   /locus_tag="mCG_10232"
FT                   /note="gene_id=mCG10232.1 transcript_id=mCT10294.1 created
FT                   on 20-FEB-2003"
FT   gene            4682138..4769506
FT                   /gene="Depdc1b"
FT                   /locus_tag="mCG_10238"
FT                   /note="gene_id=mCG10238.2"
FT   mRNA            join(4682138..4682271,4689751..4690016,4723171..4723306,
FT                   4728670..4728797,4729996..4730126,4735301..4735348,
FT                   4740177..4740317,4749215..4749381,4751191..4751367,
FT                   4754777..4754962,4756484..4757500)
FT                   /gene="Depdc1b"
FT                   /locus_tag="mCG_10238"
FT                   /product="DEP domain containing 1B, transcript variant
FT                   mCT10300"
FT                   /note="gene_id=mCG10238.2 transcript_id=mCT10300.2 created
FT                   on 20-FEB-2003"
FT   mRNA            join(<4682182..4682271,4689751..4690016,4723171..4723306,
FT                   4728670..4728797,4729996..4730126,4735301..4735348,
FT                   4740177..4740317,4749215..4749381,4751191..4751367,
FT                   4754777..4754962,4756484..4756783,4768526..4768675,
FT                   4769387..4769506)
FT                   /gene="Depdc1b"
FT                   /locus_tag="mCG_10238"
FT                   /product="DEP domain containing 1B, transcript variant
FT                   mCT180596"
FT                   /note="gene_id=mCG10238.2 transcript_id=mCT180596.0 created
FT                   on 20-FEB-2003"
FT   CDS             join(<4682182..4682271,4689751..4690016,4723171..4723306,
FT                   4728670..4728797,4729996..4730126,4735301..4735348,
FT                   4740177..4740317,4749215..4749381,4751191..4751367,
FT                   4754777..4754962,4756484..4756645)
FT                   /codon_start=1
FT                   /gene="Depdc1b"
FT                   /locus_tag="mCG_10238"
FT                   /product="DEP domain containing 1B, isoform CRA_a"
FT                   /note="gene_id=mCG10238.2 transcript_id=mCT180596.0
FT                   protein_id=mCP103518.0 isoform=CRA_a"
FT                   /protein_id="EDL18443.1"
FT                   /translation="ESPPALPRDCCALAMEHRVVGPGPYRATRLWNETVELFRARMPLR
FT                   RHRCRFKSYEHCFTASEAVDWLHELLRNSQNFGPEVTRKQTVQLLGKFLKNHVIEDIKG
FT                   KWGQEDFEDNRHLYRFPPSSPLKPYPKKPLYQRDVIKFPEWNDPPPGTSQENIPVRPIV
FT                   MNSEMWFKRHSIAIGEVPACRLVHRRQLTEANVEEIWKSTTLSYLQKILGLDSLEEVLN
FT                   TKLVSSKFIIHNVYSVSKQGVVILDDKSKELPHWVLSAMKCLANWPNCTDWKQPMYLGF
FT                   EKDVFKTIADYYGHLKEPLLTFHLFDAFVSVLGLLPKEKTAIEAFQLCCLLLPPENRRK
FT                   LQLLMRMMARICLNKEMPPLSDGFGTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFL
FT                   MDNYQEILKVPLVLQTSIEERVAHLRRVQIKYPGADMDITLSAPSFCRQISPEEFEYQR
FT                   AYGSQEPLAALLEEVIADDKLSSKEKKKKLKQFQKSYPEVYQERFPTPESEALLFPEKP
FT                   KAKPQLFMWALRKPFQPFQRTRSFRM"
FT   CDS             join(4682224..4682271,4689751..4690016,4723171..4723306,
FT                   4728670..4728797,4729996..4730126,4735301..4735348,
FT                   4740177..4740317,4749215..4749381,4751191..4751367,
FT                   4754777..4754962,4756484..4756645)
FT                   /codon_start=1
FT                   /gene="Depdc1b"
FT                   /locus_tag="mCG_10238"
FT                   /product="DEP domain containing 1B, isoform CRA_b"
FT                   /note="gene_id=mCG10238.2 transcript_id=mCT10300.2
FT                   protein_id=mCP10633.2 isoform=CRA_b"
FT                   /db_xref="GOA:A7MCV2"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="MGI:MGI:2145425"
FT                   /db_xref="UniProtKB/TrEMBL:A7MCV2"
FT                   /protein_id="EDL18444.1"
FT                   /translation="MEHRVVGPGPYRATRLWNETVELFRARMPLRRHRCRFKSYEHCFT
FT                   ASEAVDWLHELLRNSQNFGPEVTRKQTVQLLGKFLKNHVIEDIKGKWGQEDFEDNRHLY
FT                   RFPPSSPLKPYPKKPLYQRDVIKFPEWNDPPPGTSQENIPVRPIVMNSEMWFKRHSIAI
FT                   GEVPACRLVHRRQLTEANVEEIWKSTTLSYLQKILGLDSLEEVLNTKLVSSKFIIHNVY
FT                   SVSKQGVVILDDKSKELPHWVLSAMKCLANWPNCTDWKQPMYLGFEKDVFKTIADYYGH
FT                   LKEPLLTFHLFDAFVSVLGLLPKEKTAIEAFQLCCLLLPPENRRKLQLLMRMMARICLN
FT                   KEMPPLSDGFGTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVPLVL
FT                   QTSIEERVAHLRRVQIKYPGADMDITLSAPSFCRQISPEEFEYQRAYGSQEPLAALLEE
FT                   VIADDKLSSKEKKKKLKQFQKSYPEVYQERFPTPESEALLFPEKPKAKPQLFMWALRKP
FT                   FQPFQRTRSFRM"
FT   assembly_gap    4701006..4701049
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    4725467..4725486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4730992..4731041
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    4752806..4752825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4753932..4753951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4762668..4763211
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    4772803..4772923
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    4775363..4775382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4778222..4778241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4779504..4779523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4782710..4786934
FT                   /estimated_length=4225
FT                   /gap_type="unknown"
FT   assembly_gap    4788539..4788558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4799617..4799749
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    4817050..4817115
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   gene            4817916..6314505
FT                   /gene="Pde4d"
FT                   /locus_tag="mCG_142316"
FT                   /note="gene_id=mCG142316.0"
FT   mRNA            join(4817916..4818037,4892521..4892611,5002981..5003141,
FT                   5035059..5035252,5208189..5208321,5382054..5382283,
FT                   6095076..6095267,6112266..6112302,6124198..6124271,
FT                   6127295..6127344,6262597..6262709,6294985..6295078,
FT                   6296423..6296595,6297684..6297782,6298974..6299138,
FT                   6300269..6300368,6309283..6309437,6310457..6310579,
FT                   6311252..6311434,6311974..6312517)
FT                   /gene="Pde4d"
FT                   /locus_tag="mCG_142316"
FT                   /product="phosphodiesterase 4D, cAMP specific, transcript
FT                   variant mCT180599"
FT                   /note="gene_id=mCG142316.0 transcript_id=mCT180599.0
FT                   created on 20-FEB-2003"
FT   assembly_gap    4821906..4822267
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    4823930..4826008
FT                   /estimated_length=2079
FT                   /gap_type="unknown"
FT   assembly_gap    4868400..4871497
FT                   /estimated_length=3098
FT                   /gap_type="unknown"
FT   assembly_gap    4876238..4876547
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    4877724..4878695
FT                   /estimated_length=972
FT                   /gap_type="unknown"
FT   assembly_gap    4903223..4903242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4941297..4941316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4942905..4943006
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    4980588..4981079
FT                   /estimated_length=492
FT                   /gap_type="unknown"
FT   assembly_gap    4982083..4982102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4995063..4995082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4999132..4999180
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   mRNA            join(5003053..5003141,5208189..5208321,5382054..5382283,
FT                   6095076..6095267,6112266..6112302,6124198..6124271,
FT                   6127295..6127344,6262597..6262709,6294985..6295078,
FT                   6296423..6296595,6297684..6297782,6298974..6299138,
FT                   6300269..6300368,6309283..6309437,6310457..6310579,
FT                   6311252..6311434,6311974..6312517)
FT                   /gene="Pde4d"
FT                   /locus_tag="mCG_142316"
FT                   /product="phosphodiesterase 4D, cAMP specific, transcript
FT                   variant mCT180598"
FT                   /note="gene_id=mCG142316.0 transcript_id=mCT180598.0
FT                   created on 20-FEB-2003"
FT   assembly_gap    5003432..5003451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5012105..5012299
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   gene            5019620..5020414
FT                   /pseudo
FT                   /locus_tag="mCG_113069"
FT                   /note="gene_id=mCG113069.0"
FT   mRNA            5019620..5020414
FT                   /pseudo
FT                   /locus_tag="mCG_113069"
FT                   /note="gene_id=mCG113069.0 transcript_id=mCT114147.0
FT                   created on 20-FEB-2003"
FT   assembly_gap    5027606..5028724
FT                   /estimated_length=1119
FT                   /gap_type="unknown"
FT   assembly_gap    5029164..5029183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5091517..5091536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5096255..5096451
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    5139441..5144864
FT                   /estimated_length=5424
FT                   /gap_type="unknown"
FT   assembly_gap    5174963..5174982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(5208280..5208321,5382054..5382283,6095076..6095267,
FT                   6112266..6112302,6124198..6124271,6127295..6127344,
FT                   6262597..6262709,6294985..6295078,6296423..6296595,
FT                   6297684..6297782,6298974..6299138,6300269..6300368,
FT                   6309283..6309437,6310457..6310579,6311252..6311434,
FT                   6311974..6312387)
FT                   /codon_start=1
FT                   /gene="Pde4d"
FT                   /locus_tag="mCG_142316"
FT                   /product="phosphodiesterase 4D, cAMP specific, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG142316.0 transcript_id=mCT180598.0
FT                   protein_id=mCP103520.0 isoform=CRA_b"
FT                   /db_xref="GOA:A2RSH1"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="MGI:MGI:99555"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSH1"
FT                   /protein_id="EDL18440.1"
FT                   /translation="MERDTCDVLSRSKSASEETLHSCNEEEDPFRGMEPYLVRRLSSRS
FT                   IQLPPLAFRQLEQADLRSESENIPRPTSLPLKILPLIAVTSADSSGFDVDNGTSAGRSP
FT                   LDPMTSPGSGLILQANFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVT
FT                   PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEE
FT                   LDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQH
FT                   EVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLTNSCIPRFGVKTEQEDVLAKELEDV
FT                   NKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVA
FT                   YHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNS
FT                   ELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKH
FT                   MNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDR
FT                   IMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQD
FT                   ILDTLEDNREWYQSTIPQSPSPAPDDQEEGRQGQTEKFQFELTLEEDCESDTEKDSGSQ
FT                   VEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVAEEESQPETCVPDDCCPDT"
FT   CDS             join(5208280..5208321,5382054..5382283,6095076..6095267,
FT                   6112266..6112302,6124198..6124271,6127295..6127344,
FT                   6262597..6262709,6294985..6295078,6296423..6296595,
FT                   6297684..6297782,6298974..6299138,6300269..6300368,
FT                   6309283..6309437,6310457..6310579,6311252..6311434,
FT                   6311974..6312387)
FT                   /codon_start=1
FT                   /gene="Pde4d"
FT                   /locus_tag="mCG_142316"
FT                   /product="phosphodiesterase 4D, cAMP specific, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG142316.0 transcript_id=mCT180599.0
FT                   protein_id=mCP103521.0 isoform=CRA_b"
FT                   /db_xref="GOA:A2RSH1"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="MGI:MGI:99555"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSH1"
FT                   /protein_id="EDL18441.1"
FT                   /translation="MERDTCDVLSRSKSASEETLHSCNEEEDPFRGMEPYLVRRLSSRS
FT                   IQLPPLAFRQLEQADLRSESENIPRPTSLPLKILPLIAVTSADSSGFDVDNGTSAGRSP
FT                   LDPMTSPGSGLILQANFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVT
FT                   PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEE
FT                   LDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQH
FT                   EVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLTNSCIPRFGVKTEQEDVLAKELEDV
FT                   NKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVA
FT                   YHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNS
FT                   ELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKH
FT                   MNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDR
FT                   IMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQD
FT                   ILDTLEDNREWYQSTIPQSPSPAPDDQEEGRQGQTEKFQFELTLEEDCESDTEKDSGSQ
FT                   VEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVAEEESQPETCVPDDCCPDT"
FT   assembly_gap    5230556..5230594
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    5239106..5239130
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    5242208..5242259
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    5267063..5268068
FT                   /estimated_length=1006
FT                   /gap_type="unknown"
FT   assembly_gap    5269344..5269368
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    5271071..5271090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5285278..5285361
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    5294603..5294957
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    5335559..5336002
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    5345242..5345261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5367530..5367682
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    5376375..5376394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5432981..5433000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5449729..5449748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5455812..5455831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5457531..5457550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5476274..5476293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5551603..5551622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5553827..5553846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5562541..5562560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5563931..5564272
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    5569309..5569498
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    5578495..5579172
FT                   /estimated_length=678
FT                   /gap_type="unknown"
FT   mRNA            join(<5611417..5611550,6095076..6095267,6112266..6112302,
FT                   6124198..6124271,6127295..6127344,6262597..6262709,
FT                   6294985..6295078,6296423..6296595,6297684..6297782,
FT                   6298974..6299138,6300269..6300368,6309283..6309437,
FT                   6310457..6310579,6311252..6311434,6311974..6314505)
FT                   /gene="Pde4d"
FT                   /locus_tag="mCG_142316"
FT                   /product="phosphodiesterase 4D, cAMP specific, transcript
FT                   variant mCT179906"
FT                   /note="gene_id=mCG142316.0 transcript_id=mCT179906.0
FT                   created on 20-FEB-2003"
FT   CDS             join(<5611417..5611550,6095076..6095267,6112266..6112302,
FT                   6124198..6124271,6127295..6127344,6262597..6262709,
FT                   6294985..6295078,6296423..6296595,6297684..6297782,
FT                   6298974..6299138,6300269..6300368,6309283..6309437,
FT                   6310457..6310579,6311252..6311434,6311974..6312387)
FT                   /codon_start=1
FT                   /gene="Pde4d"
FT                   /locus_tag="mCG_142316"
FT                   /product="phosphodiesterase 4D, cAMP specific, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG142316.0 transcript_id=mCT179906.0
FT                   protein_id=mCP102828.0 isoform=CRA_c"
FT                   /protein_id="EDL18442.1"
FT                   /translation="KTARKSVSPKLSPVISPRNSPRLLRRMLLSSNIPKQRRFTVAHTC
FT                   FDVDNGTSAGRSPLDPMTSPGSGLILQANFVHSQRRESFLYRSDSDYDLSPKSMSRNSS
FT                   IASDIHGDDLIVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITE
FT                   EAYQKLASETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQV
FT                   SEYISNTFLDKQHEVEIPSPTQKEKEKKKRPMSQISGVKKLMHSSSLTNSCIPRFGVKT
FT                   EQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITY
FT                   LMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDH
FT                   PGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKM
FT                   VIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNP
FT                   TKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLW
FT                   ETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPDDQEEGRQGQTEKFQFELTLEE
FT                   DCESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVAEEESQPETCVP
FT                   DDCCPDT"
FT   assembly_gap    5615701..5615819
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    5640082..5640101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5710976..5711040
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    5716765..5719179
FT                   /estimated_length=2415
FT                   /gap_type="unknown"
FT   assembly_gap    5761430..5765795
FT                   /estimated_length=4366
FT                   /gap_type="unknown"
FT   assembly_gap    5842147..5842273
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    5854237..5854256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5859775..5859794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5864662..5864767
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    5903674..5903693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5906210..5908070
FT                   /estimated_length=1861
FT                   /gap_type="unknown"
FT   assembly_gap    5938484..5938503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5948449..5948468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5961430..5961449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5973324..5973349
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    5994352..5994461
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    6026814..6027119
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    6030361..6030380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<6040882..6040927,6095076..6095267,6112266..6112302,
FT                   6124198..6124271,6127295..6127344,6262597..6262709,
FT                   6294985..6295078,6296423..6296595,6297684..6297782,
FT                   6298974..6299138,6300269..6300368,6309283..6309437,
FT                   6310457..6310579,6311252..6311434,6311974..6314505)
FT                   /gene="Pde4d"
FT                   /locus_tag="mCG_142316"
FT                   /product="phosphodiesterase 4D, cAMP specific, transcript
FT                   variant mCT179905"
FT                   /note="gene_id=mCG142316.0 transcript_id=mCT179905.0
FT                   created on 20-FEB-2003"
FT   CDS             join(<6040884..6040927,6095076..6095267,6112266..6112302,
FT                   6124198..6124271,6127295..6127344,6262597..6262709,
FT                   6294985..6295078,6296423..6296595,6297684..6297782,
FT                   6298974..6299138,6300269..6300368,6309283..6309437,
FT                   6310457..6310579,6311252..6311434,6311974..6312387)
FT                   /codon_start=1
FT                   /gene="Pde4d"
FT                   /locus_tag="mCG_142316"
FT                   /product="phosphodiesterase 4D, cAMP specific, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG142316.0 transcript_id=mCT179905.0
FT                   protein_id=mCP102827.0 isoform=CRA_a"
FT                   /protein_id="EDL18439.1"
FT                   /translation="RSRSTSSLRTTEAVCFDVDNGTSAGRSPLDPMTSPGSGLILQANF
FT                   VHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNFA
FT                   ALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
FT                   SEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQHEVEIPSPTQKEKEKKKR
FT                   PMSQISGVKKLMHSSSLTNSCIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNR
FT                   PLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVL
FT                   LSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHL
FT                   AVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVT
FT                   SSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGM
FT                   EISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIP
FT                   QSPSPAPDDQEEGRQGQTEKFQFELTLEEDCESDTEKDSGSQVEEDTSCSDSKTLCTQD
FT                   SESTEIPLDEQVEEEAVAEEESQPETCVPDDCCPDT"
FT   assembly_gap    6116718..6117669
FT                   /estimated_length=952
FT                   /gap_type="unknown"
FT   assembly_gap    6142548..6142567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6161383..6161571
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    6163843..6163862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6177648..6178011
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    6186574..6186593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6201448..6205215
FT                   /estimated_length=3768
FT                   /gap_type="unknown"
FT   assembly_gap    6207341..6207360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6208475..6208494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6209614..6209633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6213581..6213600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6214804..6214823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6218006..6218025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6222277..6222546
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    6233824..6234890
FT                   /estimated_length=1067
FT                   /gap_type="unknown"
FT   assembly_gap    6245149..6245168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6246431..6246450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6251697..6252335
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   assembly_gap    6254066..6254085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6255843..6255862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6270544..6270563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6278933..6278952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6291892..6291911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6293573..6293592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6296677..6296696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6302823..6302855
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    6341320..6341951
FT                   /estimated_length=632
FT                   /gap_type="unknown"
FT   assembly_gap    6360924..6360943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6396163..6396182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6409010..6409252
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    6417917..6417936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6422305..6422369
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            complement(6422370..6641595)
FT                   /gene="Rab3c"
FT                   /locus_tag="mCG_117475"
FT                   /note="gene_id=mCG117475.1"
FT   mRNA            complement(join(6422370..6423020,6445147..6445271,
FT                   6541994..6542112,6621058..6621285,6640593..6640783))
FT                   /gene="Rab3c"
FT                   /locus_tag="mCG_117475"
FT                   /product="RAB3C, member RAS oncogene family, transcript
FT                   variant mCT118616"
FT                   /note="gene_id=mCG117475.1 transcript_id=mCT118616.1
FT                   created on 13-NOV-2002"
FT   mRNA            complement(join(<6422833..6423020,6445147..6445271,
FT                   6541994..6542112,6621058..6621287,6640599..>6640616))
FT                   /gene="Rab3c"
FT                   /locus_tag="mCG_117475"
FT                   /product="RAB3C, member RAS oncogene family, transcript
FT                   variant mCT191186"
FT                   /note="gene_id=mCG117475.1 transcript_id=mCT191186.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(6422833..6423020,6445147..6445271,
FT                   6541994..6542112,6621058..6621285,6640593..6640616))
FT                   /codon_start=1
FT                   /gene="Rab3c"
FT                   /locus_tag="mCG_117475"
FT                   /product="RAB3C, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG117475.1 transcript_id=mCT118616.1
FT                   protein_id=mCP83881.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q542T7"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1914545"
FT                   /db_xref="UniProtKB/TrEMBL:Q542T7"
FT                   /protein_id="EDL18435.1"
FT                   /translation="MRHEAPMQMASAQDARFGQKDSSDQNFDYMFKLLIIGNSSVGKTS
FT                   FLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAM
FT                   GFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILAGNKCDMEDERVVSTERGQRLGE
FT                   QLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQSTRLKETPPPPQ
FT                   PNCGC"
FT   CDS             complement(join(6422833..6423020,6445147..6445271,
FT                   6541994..6542112,6621058..6621287,6640599..>6640614))
FT                   /codon_start=1
FT                   /gene="Rab3c"
FT                   /locus_tag="mCG_117475"
FT                   /product="RAB3C, member RAS oncogene family, isoform CRA_c"
FT                   /note="gene_id=mCG117475.1 transcript_id=mCT191186.0
FT                   protein_id=mCP112158.0 isoform=CRA_c"
FT                   /protein_id="EDL18437.1"
FT                   /translation="ETRGAQMASAQDARFGQKDSSDQNFDYMFKLLIIGNSSVGKTSFL
FT                   FRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGF
FT                   ILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILAGNKCDMEDERVVSTERGQRLGEQL
FT                   GFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQSTRLKETPPPPQPN
FT                   CGC"
FT   assembly_gap    6431036..6431109
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   mRNA            complement(join(6434145..6434448,6445147..6445271,
FT                   6541994..6542112,6621058..6621285,6640593..6640783))
FT                   /gene="Rab3c"
FT                   /locus_tag="mCG_117475"
FT                   /product="RAB3C, member RAS oncogene family, transcript
FT                   variant mCT175609"
FT                   /note="gene_id=mCG117475.1 transcript_id=mCT175609.0
FT                   created on 13-NOV-2002"
FT   CDS             complement(join(6434435..6434448,6445147..6445271,
FT                   6541994..6542112,6621058..6621285,6640593..6640616))
FT                   /codon_start=1
FT                   /gene="Rab3c"
FT                   /locus_tag="mCG_117475"
FT                   /product="RAB3C, member RAS oncogene family, isoform CRA_d"
FT                   /note="gene_id=mCG117475.1 transcript_id=mCT175609.0
FT                   protein_id=mCP98531.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q9CXS2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1914545"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CXS2"
FT                   /protein_id="EDL18438.1"
FT                   /translation="MRHEAPMQMASAQDARFGQKDSSDQNFDYMFKLLIIGNSSVGKTS
FT                   FLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAM
FT                   GFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILAGNKCDMEDERVVSTERGQRLGE
FT                   QLGDFL"
FT   mRNA            complement(join(6533771..6534142,6541994..6542112,
FT                   6621058..6621285,6641391..6641595))
FT                   /gene="Rab3c"
FT                   /locus_tag="mCG_117475"
FT                   /product="RAB3C, member RAS oncogene family, transcript
FT                   variant mCT175610"
FT                   /note="gene_id=mCG117475.1 transcript_id=mCT175610.0
FT                   created on 13-NOV-2002"
FT   CDS             complement(join(6534115..6534142,6541994..6542112,
FT                   6621058..6621285,6641391..6641408))
FT                   /codon_start=1
FT                   /gene="Rab3c"
FT                   /locus_tag="mCG_117475"
FT                   /product="RAB3C, member RAS oncogene family, isoform CRA_b"
FT                   /note="gene_id=mCG117475.1 transcript_id=mCT175610.0
FT                   protein_id=mCP98532.0 isoform=CRA_b"
FT                   /protein_id="EDL18436.1"
FT                   /translation="MELYGKMASAQDARFGQKDSSDQNFDYMFKLLIIGNSSVGKTSFL
FT                   FRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGF
FT                   ILMYDITNEESFNAVQDWAAQTQKQA"
FT   assembly_gap    6574809..6575588
FT                   /estimated_length=780
FT                   /gap_type="unknown"
FT   assembly_gap    6577746..6578214
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   assembly_gap    6579331..6579513
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    6581408..6581672
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    6583051..6583070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6587396..6587415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6624418..6624887
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    6644360..6644379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6661531..6661550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6666094..6666472
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   gene            complement(6666476..>6667622)
FT                   /locus_tag="mCG_49489"
FT                   /note="gene_id=mCG49489.2"
FT   mRNA            complement(6666476..>6667622)
FT                   /locus_tag="mCG_49489"
FT                   /product="mCG49489"
FT                   /note="gene_id=mCG49489.2 transcript_id=mCT49672.2 created
FT                   on 26-NOV-2002"
FT   CDS             complement(6666807..>6667607)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49489"
FT                   /product="mCG49489"
FT                   /note="gene_id=mCG49489.2 transcript_id=mCT49672.2
FT                   protein_id=mCP32466.2"
FT                   /protein_id="EDL18434.1"
FT                   /translation="VDCCPLPEICQLRAHEFPLGLLQSEITAMASNWRASASWYSYPVY
FT                   ARYWQHYHHAMLWMQSHQNAYRKFSDSYFTSPWLFPHGALPWNSPAYEAGHPWDSQGQH
FT                   MARQESPYRVSHPKSPGQPLRNSSRTQASTRGNEARCEEEELESDSDDEVECDLSNMEI
FT                   TEELRQYFAQTERHREERRRQQQLDAERLNDYVNADHGLYFNHRRSLEPPSEKPWERRQ
FT                   AEMKRLYGNSAPKILAMETAVQLSFDKHCDRKQPKYWPVIPLKF"
FT   assembly_gap    6672672..6673628
FT                   /estimated_length=957
FT                   /gap_type="unknown"
FT   assembly_gap    6674997..6675016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6677847..6678250
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    6692947..6693078
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    6698495..6698514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6714341..6718984)
FT                   /gene="9830130M13Rik"
FT                   /locus_tag="mCG_1033054"
FT                   /note="gene_id=mCG1033054.2"
FT   mRNA            complement(join(6714341..6716326,6716750..6716814,
FT                   6718895..6718984))
FT                   /gene="9830130M13Rik"
FT                   /locus_tag="mCG_1033054"
FT                   /product="RIKEN cDNA 9830130M13"
FT                   /note="gene_id=mCG1033054.2 transcript_id=mCT150758.2
FT                   created on 13-JUN-2003"
FT   CDS             complement(6715464..6715937)
FT                   /codon_start=1
FT                   /gene="9830130M13Rik"
FT                   /locus_tag="mCG_1033054"
FT                   /product="RIKEN cDNA 9830130M13"
FT                   /note="gene_id=mCG1033054.2 transcript_id=mCT150758.2
FT                   protein_id=mCP83780.2"
FT                   /protein_id="EDL18433.1"
FT                   /translation="MLECFESSPVAVAVGVSLLVLLLLCGIGCAWHWNRRESTPFTLPK
FT                   FMQRRSSRQKDVTKTVSSSAYVISPSMKASVESKGHKSTAKRNKMHGNYENVEVCPPCT
FT                   EGTTEKALYENTQPSNLEEHVYGNQTDPLYYNFQKPSPPPPQDDDIYILPDCD"
FT   assembly_gap    6721054..6721073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6729574..6729842
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    6746460..6746574
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   gene            6756543..6762293
FT                   /gene="Plk2"
FT                   /locus_tag="mCG_15727"
FT                   /note="gene_id=mCG15727.1"
FT   mRNA            join(6756543..6756920,6757498..6757605,6757759..6757875,
FT                   6758074..6758203,6758357..6758444,6758921..6759016,
FT                   6759138..6759336,6759424..6759571,6759823..6759920,
FT                   6760129..6760258,6760471..6760711,6760830..6760959,
FT                   6761210..6761320,6761480..6762293)
FT                   /gene="Plk2"
FT                   /locus_tag="mCG_15727"
FT                   /product="polo-like kinase 2 (Drosophila)"
FT                   /note="gene_id=mCG15727.1 transcript_id=mCT19759.1 created
FT                   on 26-NOV-2002"
FT   CDS             join(6756660..6756920,6757498..6757605,6757759..6757875,
FT                   6758074..6758203,6758357..6758444,6758921..6759016,
FT                   6759138..6759336,6759424..6759571,6759823..6759920,
FT                   6760129..6760258,6760471..6760711,6760830..6760959,
FT                   6761210..6761320,6761480..6761671)
FT                   /codon_start=1
FT                   /gene="Plk2"
FT                   /locus_tag="mCG_15727"
FT                   /product="polo-like kinase 2 (Drosophila)"
FT                   /note="gene_id=mCG15727.1 transcript_id=mCT19759.1
FT                   protein_id=mCP10630.1"
FT                   /db_xref="GOA:Q548A9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000959"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1099790"
FT                   /db_xref="UniProtKB/TrEMBL:Q548A9"
FT                   /protein_id="EDL18432.1"
FT                   /translation="MELLRTITYQPAAGTKMCEQALGKACGGDSKKKRPQQPSEDGQPQ
FT                   AQVTPAAPHHHHHHSHSGPEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKV
FT                   YAAKIIPHSRVAKPHQREKIDKEIELHRLLHHKHVVQFYHYFEDKENIYILLEYCSRRS
FT                   MAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFG
FT                   LAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTN
FT                   LKETYRCIREARYTMPSSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRL
FT                   SSSCCHTVPDFHLSSPAKNFFKKAAAALFGGKKDKARYNDTHNKVSKEDEDIYKLRHDL
FT                   KKVSITQQPSKHRADEEPQPPPTTVARSGTSAVENKQQIGDAIRMIVRGTLGSCSSSSE
FT                   CLEDSTMGSVADTVARVLRGCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQL
FT                   SDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYM
FT                   EENLMDGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICNQS
FT                   EEYLLTYINEDRISTTFRLTTLLMSGCSLELKNRMEYALNMLLQRCN"
FT   assembly_gap    6758222..6758241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6778909..6778928
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6800390..6800409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6830649..6831893
FT                   /estimated_length=1245
FT                   /gap_type="unknown"
FT   assembly_gap    6851091..6851188
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    6859137..6859189
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    6870115..6870134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6915970..6915989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6919180..6919209
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    6944101..6944120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6966135..6966154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6971244..6971475
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    6973065..6973084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6974363..6979354
FT                   /estimated_length=4992
FT                   /gap_type="unknown"
FT   gene            <6979759..6995271
FT                   /locus_tag="mCG_60235"
FT                   /note="gene_id=mCG60235.2"
FT   mRNA            join(<6979759..6979869,6982507..6982708,6995047..6995271)
FT                   /locus_tag="mCG_60235"
FT                   /product="mCG60235"
FT                   /note="gene_id=mCG60235.2 transcript_id=mCT60418.2 created
FT                   on 13-FEB-2003"
FT   assembly_gap    6980691..6980710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6981748..6981767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<6982585..6982708,6995047..6995141)
FT                   /codon_start=1
FT                   /locus_tag="mCG_60235"
FT                   /product="mCG60235"
FT                   /note="gene_id=mCG60235.2 transcript_id=mCT60418.2
FT                   protein_id=mCP32456.2"
FT                   /protein_id="EDL18431.1"
FT                   /translation="ALDTCLLPSHTAKTEDVTQGPASCVTSLQQKVPECVSMWWTGLVI
FT                   QGDDLSMEIRGQLMDFWPLAAGKVGLK"
FT   assembly_gap    6982982..6983001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6989527..6990082
FT                   /estimated_length=556
FT                   /gap_type="unknown"
FT   assembly_gap    6991320..6991339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6992860..6992879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6998151..6998274
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    7036068..7036087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7053691..7053710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7074190..7074271
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    7075834..7076569
FT                   /estimated_length=736
FT                   /gap_type="unknown"
FT   assembly_gap    7086342..7086477
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    7094142..7094290
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    7097703..7098029
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    7104661..7104731
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    7116780..7117483
FT                   /estimated_length=704
FT                   /gap_type="unknown"
FT   assembly_gap    7162492..7162512
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    7169498..7170759
FT                   /estimated_length=1262
FT                   /gap_type="unknown"
FT   assembly_gap    7172321..7172529
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    7173597..7173616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7174750..7176983
FT                   /estimated_length=2234
FT                   /gap_type="unknown"
FT   assembly_gap    7199864..7200697
FT                   /estimated_length=834
FT                   /gap_type="unknown"
FT   assembly_gap    7215454..7215924
FT                   /estimated_length=471
FT                   /gap_type="unknown"
FT   assembly_gap    7218887..7218906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7234960..>7256386)
FT                   /locus_tag="mCG_146206"
FT                   /note="gene_id=mCG146206.0"
FT   mRNA            complement(join(7234960..7235565,7250416..7250513,
FT                   7255908..>7256386))
FT                   /locus_tag="mCG_146206"
FT                   /product="mCG146206"
FT                   /note="gene_id=mCG146206.0 transcript_id=mCT186309.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(7250492..7250513,7255908..>7256095))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146206"
FT                   /product="mCG146206"
FT                   /note="gene_id=mCG146206.0 transcript_id=mCT186309.0
FT                   protein_id=mCP107790.0"
FT                   /protein_id="EDL18430.1"
FT                   /translation="DAKQKTRPLTLAVAGSYNQRWAVWTKRGSSVSTAKGGIPGLQPGL
FT                   EHACTEAAEAKEEIQLLLIIACTS"
FT   assembly_gap    7259191..7259921
FT                   /estimated_length=731
FT                   /gap_type="unknown"
FT   assembly_gap    7293178..7293250
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    7310163..7310201
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    7311949..7311968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7313026..7313174
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    7316061..7316319
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    7330441..7330460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7341481..7341534
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    7348968..7349073
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    7381478..7381497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7419081..7419100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7422277..7422330
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    7453343..7454115
FT                   /estimated_length=773
FT                   /gap_type="unknown"
FT   assembly_gap    7471458..7471477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7487557..7487600
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    7491343..7491370
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    7518737..7518992
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    7522570..7522589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7530651..7530670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7533469..7533548
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    7534745..7535627
FT                   /estimated_length=883
FT                   /gap_type="unknown"
FT   gene            complement(7557647..7575452)
FT                   /locus_tag="mCG_1033053"
FT                   /note="gene_id=mCG1033053.0"
FT   mRNA            complement(join(7557647..7558004,7562747..7562838,
FT                   7574963..7575452))
FT                   /locus_tag="mCG_1033053"
FT                   /product="mCG1033053"
FT                   /note="gene_id=mCG1033053.0 transcript_id=mCT150757.0
FT                   created on 20-NOV-2002"
FT   CDS             complement(7557673..7557879)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033053"
FT                   /product="mCG1033053"
FT                   /note="gene_id=mCG1033053.0 transcript_id=mCT150757.0
FT                   protein_id=mCP83774.1"
FT                   /protein_id="EDL18429.1"
FT                   /translation="MVDAGNVKLRRNPWKARLLSLDSHQGSRRQADTGARIAAEAKLYF
FT                   PLFGKGKEGLGVSLDKEISSFLI"
FT   assembly_gap    7568662..7568804
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    7572215..7572275
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    7598215..7598404
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   gene            7600996..7603733
FT                   /pseudo
FT                   /gene="4732495G21Rik"
FT                   /locus_tag="mCG_49936"
FT                   /note="gene_id=mCG49936.2"
FT   mRNA            7600996..7603733
FT                   /pseudo
FT                   /gene="4732495G21Rik"
FT                   /locus_tag="mCG_49936"
FT                   /note="gene_id=mCG49936.2 transcript_id=mCT50119.2 created
FT                   on 16-JUL-2003"
FT   assembly_gap    7605409..7605686
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    7607602..7607621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7614876..7615077
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    7619224..7619321
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    7638333..7638354
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    7642578..7642775
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    7654539..7655232
FT                   /estimated_length=694
FT                   /gap_type="unknown"
FT   assembly_gap    7675810..7675864
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    7679294..7679401
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    7698399..7698505
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    7709385..7709404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7720108..7725044
FT                   /estimated_length=4937
FT                   /gap_type="unknown"
FT   assembly_gap    7726960..7727738
FT                   /estimated_length=779
FT                   /gap_type="unknown"
FT   assembly_gap    7735120..7735139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7747575..7747594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7758890..7759092
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    7762965..7763191
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   gene            complement(7765631..7829947)
FT                   /gene="Gpbp1"
FT                   /locus_tag="mCG_20634"
FT                   /note="gene_id=mCG20634.2"
FT   mRNA            complement(join(7765631..7766599,7773498..7773600,
FT                   7776347..7776534,7777907..7778074,7779054..7779194,
FT                   7780582..7780766,7787846..7787905,7788883..7788949,
FT                   7792974..7793197,7793323..7793446,7806802..7806921,
FT                   7827374..7828321,7829607..7829947))
FT                   /gene="Gpbp1"
FT                   /locus_tag="mCG_20634"
FT                   /product="GC-rich promoter binding protein 1, transcript
FT                   variant mCT22265"
FT                   /note="gene_id=mCG20634.2 transcript_id=mCT22265.2 created
FT                   on 20-NOV-2002"
FT   mRNA            complement(join(7766109..7766599,7773498..7773600,
FT                   7776347..7776534,7777907..7778074,7779054..7779194,
FT                   7780582..7780766,7787846..7787905,7788883..7788949,
FT                   7793323..7793446,7806802..7806921,7827374..>7827663))
FT                   /gene="Gpbp1"
FT                   /locus_tag="mCG_20634"
FT                   /product="GC-rich promoter binding protein 1, transcript
FT                   variant mCT191196"
FT                   /note="gene_id=mCG20634.2 transcript_id=mCT191196.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(7766441..7766599,7773498..7773600,
FT                   7776347..7776534,7777907..7778074,7779054..7779194,
FT                   7780582..7780766,7787846..7787905,7788883..7788949,
FT                   7792974..7793197,7793323..7793446,7806802..7806864))
FT                   /codon_start=1
FT                   /gene="Gpbp1"
FT                   /locus_tag="mCG_20634"
FT                   /product="GC-rich promoter binding protein 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG20634.2 transcript_id=mCT22265.2
FT                   protein_id=mCP10646.2 isoform=CRA_c"
FT                   /protein_id="EDL18428.1"
FT                   /translation="MAQHDFAPAWLNFPTPPSSTKSSLNFEKHSENFSWTENRYDVSRR
FT                   RHNSSDGFDSGIGRPNGGNFGRKEKNGWRTHGRNGTENINHRGGYHGGNSRSRSSIFHS
FT                   GKSQGLHENSIPDNETGRKEDKRERRQFEAEDFPSLNPEYEREPNQNKSLAAGVWGLHA
FT                   QTHTYPTKKISQAPLLDYPPNPKSRTPRMLVIKKGNTKDLQLSGFPVAGNLQSQPVKNG
FT                   TGPSVYKGLVPKPAVPPTKPTQWKSQTKENKVGTSFSHESTYGVGNFNTFKSTAKNISP
FT                   STNSVKECNRSNSSSPVDKLNQQPRLTKLTRMRSDKKSEFLKALKRDRVEEEHEDESHA
FT                   GSEKDDDSFNLHNSNTTHQERDINRNFDENEIPQENGNASMISQQIIRSSTFPQTDVLS
FT                   SSLEAEHRLLKEMGWQEDSENDETCAPLTEDEMREFQVISEQLQKNGLRKNGILKNGLI
FT                   CDFKFGPWKNSTFKPTIENDDTETSSSDTSDDDDV"
FT   CDS             complement(join(7766441..7766599,7773498..7773600,
FT                   7776347..7776534,7777907..7778074,7779054..7779194,
FT                   7780582..7780766,7787846..7787905,7788883..7788949,
FT                   7793323..>7793382))
FT                   /codon_start=1
FT                   /gene="Gpbp1"
FT                   /locus_tag="mCG_20634"
FT                   /product="GC-rich promoter binding protein 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG20634.2 transcript_id=mCT191196.0
FT                   protein_id=mCP112168.0 isoform=CRA_b"
FT                   /protein_id="EDL18427.1"
FT                   /translation="VVDDTILQMALILVLDVLMEPSLNPEYEREPNQNKSLAAGVWGLH
FT                   AQTHTYPTKKISQAPLLDYPPNPKSRTPRMLVIKKGNTKDLQLSGFPVAGNLQSQPVKN
FT                   GTGPSVYKGLVPKPAVPPTKPTQWKSQTKENKVGTSFSHESTYGVGNFNTFKSTAKNIS
FT                   PSTNSVKECNRSNSSSPVDKLNQQPRLTKLTRMRSDKKSEFLKALKRDRVEEEHEDESH
FT                   AGSEKDDDSFNLHNSNTTHQERDINRNFDENEIPQENGNASMISQQIIRSSTFPQTDVL
FT                   SSSLEAEHRLLKEMGWQEDSENDETCAPLTEDEMREFQVISEQLQKNGLRKNGILKNGL
FT                   ICDFKFGPWKNSTFKPTIENDDTETSSSDTSDDDDV"
FT   mRNA            complement(join(<7776492..7776534,7777907..7778074,
FT                   7779054..7779194,7780582..7780766,7788883..7788949,
FT                   7792974..7793197,7793323..7793446,7806802..7806921,
FT                   7827374..7828321,7829607..7829748))
FT                   /gene="Gpbp1"
FT                   /locus_tag="mCG_20634"
FT                   /product="GC-rich promoter binding protein 1, transcript
FT                   variant mCT191195"
FT                   /note="gene_id=mCG20634.2 transcript_id=mCT191195.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<7776492..7776534,7777907..7778074,
FT                   7779054..7779194,7780582..7780766,7788883..7788949,
FT                   7792974..7793197,7793323..7793446,7806802..7806864))
FT                   /codon_start=1
FT                   /gene="Gpbp1"
FT                   /locus_tag="mCG_20634"
FT                   /product="GC-rich promoter binding protein 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG20634.2 transcript_id=mCT191195.0
FT                   protein_id=mCP112167.0 isoform=CRA_a"
FT                   /protein_id="EDL18426.1"
FT                   /translation="MAQHDFAPAWLNFPTPPSSTKSSLNFEKHSENFSWTENRYDVSRR
FT                   RHNSSDGFDSGIGRPNGGNFGRKEKNGWRTHGRNGTENINHRGGYHGGNSRSRSSIFHS
FT                   GKSQGLHENSIPDNETGRKEDKRERRQFEAEDFPSLNPEYEREPNQNKSLAAGVWDYPP
FT                   NPKSRTPRMLVIKKGNTKDLQLSGFPVAGNLQSQPVKNGTGPSVYKGLVPKPAVPPTKP
FT                   TQWKSQTKENKVGTSFSHESTYGVGNFNTFKSTAKNISPSTNSVKECNRSNSSSPVDKL
FT                   NQQPRLTKLTRMRSDKKSEFLKALKRDRVEEEHEDESHAGSEKDDDSFNLHNSNTTH"
FT   assembly_gap    7829032..7829353
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    7830089..7830355
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    7845932..7845951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7852237..7852256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7855096..7856204
FT                   /estimated_length=1109
FT                   /gap_type="unknown"
FT   gene            complement(7862496..>7890057)
FT                   /locus_tag="mCG_1033051"
FT                   /note="gene_id=mCG1033051.1"
FT   mRNA            complement(join(7862496..7862770,7889758..>7890057))
FT                   /locus_tag="mCG_1033051"
FT                   /product="mCG1033051"
FT                   /note="gene_id=mCG1033051.1 transcript_id=mCT150755.1
FT                   created on 12-FEB-2003"
FT   CDS             complement(join(7862672..7862770,7889758..>7889931))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033051"
FT                   /product="mCG1033051"
FT                   /note="gene_id=mCG1033051.1 transcript_id=mCT150755.1
FT                   protein_id=mCP83770.0"
FT                   /protein_id="EDL18425.1"
FT                   /translation="LCCKTLASLNFPEETPSPPTPSEQRRAGNRCRSKRNFIVPASWGR
FT                   PAHEGERECTACSVSTLLRQKEDRSVPAFGCLRSPDPLPERLELS"
FT   assembly_gap    7869988..7870007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7874311..7874377
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    7888911..7889675
FT                   /estimated_length=765
FT                   /gap_type="unknown"
FT   assembly_gap    7896130..7896716
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    7902837..7902856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7907941..7907960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7929063..7929534
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    7932649..7932855
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    7938620..7939272
FT                   /estimated_length=653
FT                   /gap_type="unknown"
FT   assembly_gap    7952977..7953159
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    7966954..7967021
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    7990552..7990727
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    8014232..8014614
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    8016058..8016357
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   gene            <8021422..8051343
FT                   /gene="Mier3"
FT                   /locus_tag="mCG_112996"
FT                   /note="gene_id=mCG112996.1"
FT   mRNA            join(<8021422..8021582,8036693..8036827,8038286..8038406,
FT                   8039062..8039147,8039698..8039773,8041278..8041429,
FT                   8042771..8042852,8044728..8044822,8047277..8047404,
FT                   8047481..8047623,8047720..8051343)
FT                   /gene="Mier3"
FT                   /locus_tag="mCG_112996"
FT                   /product="mesoderm induction early response 1, family
FT                   member 3, transcript variant mCT179902"
FT                   /note="gene_id=mCG112996.1 transcript_id=mCT179902.0
FT                   created on 12-FEB-2003"
FT   mRNA            join(<8021422..8021582,8036693..8036827,8038286..8038406,
FT                   8039062..8039147,8039698..8039773,8041278..8041429,
FT                   8042771..8042852,8044731..8044822,8047277..8047404,
FT                   8047481..8047623,8047720..8051343)
FT                   /gene="Mier3"
FT                   /locus_tag="mCG_112996"
FT                   /product="mesoderm induction early response 1, family
FT                   member 3, transcript variant mCT179901"
FT                   /note="gene_id=mCG112996.1 transcript_id=mCT179901.0
FT                   created on 12-FEB-2003"
FT   CDS             join(<8021424..8021582,8036693..8036827,8038286..8038406,
FT                   8039062..8039147,8039698..8039773,8041278..8041429,
FT                   8042771..8042852,8044728..8044822,8047277..8047404,
FT                   8047481..8047623,8047720..8048177)
FT                   /codon_start=1
FT                   /gene="Mier3"
FT                   /locus_tag="mCG_112996"
FT                   /product="mesoderm induction early response 1, family
FT                   member 3, isoform CRA_c"
FT                   /note="gene_id=mCG112996.1 transcript_id=mCT179902.0
FT                   protein_id=mCP102823.0 isoform=CRA_c"
FT                   /protein_id="EDL18423.1"
FT                   /translation="ALTCQHVCWKLLLQDSSYTETSYNTEPGGTEQFLDSRNCHSQLPV
FT                   IGLVRLQKEGNMPLEDLLAFYGYESTIPAVANSSANSSPSELADELPDMTLDKEEIAKD
FT                   LLSGDDEETQSSADDLTPSVTSHETSEFFPRPLRSNTTCDGDKESEIEDVETDSGNSPE
FT                   DLRREIMIGLEYQAEIPPYLGEYNGDDEKAYENEDQLLWHPGVLLESKVKEYLVETSLR
FT                   TGNEKVLDRISSGTHTRDNEQALYELLKCNHNIKEAIERYCCNGKASQEGMTAWTEEEC
FT                   RSFEHALMLHGKDFHLIQKDKVRSRTVAECVAFYYMWKKSERYDYFAQQTKFGKKRYNH
FT                   HPGVTDYMDRLVDETESLGGTVSSSALTCNRPEPVPDQPLNILSSFTASDLTALTNSVA
FT                   TVCNPTAVNCLDDSFPPLANTPRGHVNHVPVVTEELLTLPSNGESDCFNLFETGFYHSE
FT                   LNPMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFG
FT                   SLSANETNGFINAHSLHQHQHAALHSE"
FT   CDS             join(<8021424..8021582,8036693..8036827,8038286..8038406,
FT                   8039062..8039147,8039698..8039773,8041278..8041429,
FT                   8042771..8042852,8044731..8044822,8047277..8047404,
FT                   8047481..8047623,8047720..8048177)
FT                   /codon_start=1
FT                   /gene="Mier3"
FT                   /locus_tag="mCG_112996"
FT                   /product="mesoderm induction early response 1, family
FT                   member 3, isoform CRA_b"
FT                   /note="gene_id=mCG112996.1 transcript_id=mCT179901.0
FT                   protein_id=mCP102824.0 isoform=CRA_b"
FT                   /protein_id="EDL18422.1"
FT                   /translation="ALTCQHVCWKLLLQDSSYTETSYNTEPGGTEQFLDSRNCHSQLPV
FT                   IGLVRLQKEGNMPLEDLLAFYGYESTIPAVANSSANSSPSELADELPDMTLDKEEIAKD
FT                   LLSGDDEETQSSADDLTPSVTSHETSEFFPRPLRSNTTCDGDKESEIEDVETDSGNSPE
FT                   DLRREIMIGLEYQAEIPPYLGEYNGDDEKAYENEDQLLWHPGVLLESKVKEYLVETSLR
FT                   TGNEKVLDRISSGTHTRDNEQALYELLKCNHNIKEAIERYCCNGKASQGMTAWTEEECR
FT                   SFEHALMLHGKDFHLIQKDKVRSRTVAECVAFYYMWKKSERYDYFAQQTKFGKKRYNHH
FT                   PGVTDYMDRLVDETESLGGTVSSSALTCNRPEPVPDQPLNILSSFTASDLTALTNSVAT
FT                   VCNPTAVNCLDDSFPPLANTPRGHVNHVPVVTEELLTLPSNGESDCFNLFETGFYHSEL
FT                   NPMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGS
FT                   LSANETNGFINAHSLHQHQHAALHSE"
FT   assembly_gap    8023595..8023614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8024692..8033090
FT                   /estimated_length=8399
FT                   /gap_type="unknown"
FT   mRNA            join(8033842..8033906,8036693..8036827,8038286..8038406,
FT                   8039062..8039147,8039698..8039773,8041278..8041429,
FT                   8042771..8042852,8044728..8044822,8047277..8047404,
FT                   8047481..8047623,8047720..8051343)
FT                   /gene="Mier3"
FT                   /locus_tag="mCG_112996"
FT                   /product="mesoderm induction early response 1, family
FT                   member 3, transcript variant mCT114073"
FT                   /note="gene_id=mCG112996.1 transcript_id=mCT114073.1
FT                   created on 12-FEB-2003"
FT   mRNA            join(8033842..8033906,8036693..8036827,8038286..8038406,
FT                   8039062..8039147,8039698..8039773,8041278..8041429,
FT                   8042771..8042852,8044731..8044822,8047277..8047404,
FT                   8047481..8047623,8047720..8051343)
FT                   /gene="Mier3"
FT                   /locus_tag="mCG_112996"
FT                   /product="mesoderm induction early response 1, family
FT                   member 3, transcript variant mCT179903"
FT                   /note="gene_id=mCG112996.1 transcript_id=mCT179903.0
FT                   created on 12-FEB-2003"
FT   CDS             join(8036702..8036827,8038286..8038406,8039062..8039147,
FT                   8039698..8039773,8041278..8041429,8042771..8042852,
FT                   8044728..8044822,8047277..8047404,8047481..8047623,
FT                   8047720..8048177)
FT                   /codon_start=1
FT                   /gene="Mier3"
FT                   /locus_tag="mCG_112996"
FT                   /product="mesoderm induction early response 1, family
FT                   member 3, isoform CRA_a"
FT                   /note="gene_id=mCG112996.1 transcript_id=mCT114073.1
FT                   protein_id=mCP83868.1 isoform=CRA_a"
FT                   /protein_id="EDL18421.1"
FT                   /translation="MPLEDLLAFYGYESTIPAVANSSANSSPSELADELPDMTLDKEEI
FT                   AKDLLSGDDEETQSSADDLTPSVTSHETSEFFPRPLRSNTTCDGDKESEIEDVETDSGN
FT                   SPEDLRREIMIGLEYQAEIPPYLGEYNGDDEKAYENEDQLLWHPGVLLESKVKEYLVET
FT                   SLRTGNEKVLDRISSGTHTRDNEQALYELLKCNHNIKEAIERYCCNGKASQEGMTAWTE
FT                   EECRSFEHALMLHGKDFHLIQKDKVRSRTVAECVAFYYMWKKSERYDYFAQQTKFGKKR
FT                   YNHHPGVTDYMDRLVDETESLGGTVSSSALTCNRPEPVPDQPLNILSSFTASDLTALTN
FT                   SVATVCNPTAVNCLDDSFPPLANTPRGHVNHVPVVTEELLTLPSNGESDCFNLFETGFY
FT                   HSELNPMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVA
FT                   DFGSLSANETNGFINAHSLHQHQHAALHSE"
FT   CDS             join(8036702..8036827,8038286..8038406,8039062..8039147,
FT                   8039698..8039773,8041278..8041429,8042771..8042852,
FT                   8044731..8044822,8047277..8047404,8047481..8047623,
FT                   8047720..8048177)
FT                   /codon_start=1
FT                   /gene="Mier3"
FT                   /locus_tag="mCG_112996"
FT                   /product="mesoderm induction early response 1, family
FT                   member 3, isoform CRA_d"
FT                   /note="gene_id=mCG112996.1 transcript_id=mCT179903.0
FT                   protein_id=mCP102825.0 isoform=CRA_d"
FT                   /protein_id="EDL18424.1"
FT                   /translation="MPLEDLLAFYGYESTIPAVANSSANSSPSELADELPDMTLDKEEI
FT                   AKDLLSGDDEETQSSADDLTPSVTSHETSEFFPRPLRSNTTCDGDKESEIEDVETDSGN
FT                   SPEDLRREIMIGLEYQAEIPPYLGEYNGDDEKAYENEDQLLWHPGVLLESKVKEYLVET
FT                   SLRTGNEKVLDRISSGTHTRDNEQALYELLKCNHNIKEAIERYCCNGKASQGMTAWTEE
FT                   ECRSFEHALMLHGKDFHLIQKDKVRSRTVAECVAFYYMWKKSERYDYFAQQTKFGKKRY
FT                   NHHPGVTDYMDRLVDETESLGGTVSSSALTCNRPEPVPDQPLNILSSFTASDLTALTNS
FT                   VATVCNPTAVNCLDDSFPPLANTPRGHVNHVPVVTEELLTLPSNGESDCFNLFETGFYH
FT                   SELNPMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVAD
FT                   FGSLSANETNGFINAHSLHQHQHAALHSE"
FT   assembly_gap    8062188..8064976
FT                   /estimated_length=2789
FT                   /gap_type="unknown"
FT   assembly_gap    8069330..8069446
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            complement(8070317..>8135419)
FT                   /gene="Map3k1"
FT                   /locus_tag="mCG_20636"
FT                   /note="gene_id=mCG20636.2"
FT   mRNA            complement(join(8070317..8070738,8072267..8072735,
FT                   8074127..8074258,8074905..8075047,8076063..8076194,
FT                   8077437..8077599,8078340..8078492,8078808..8080059,
FT                   8080310..8080499,8080791..8080882,8081763..8081884,
FT                   8083649..8083927,8086747..8086930,8087192..8087273,
FT                   8087775..8087896,8091662..8091810,8092563..8092679,
FT                   8093413..8093613,8100423..8100623,8103155..8103305,
FT                   8135351..>8135419))
FT                   /gene="Map3k1"
FT                   /locus_tag="mCG_20636"
FT                   /product="mitogen activated protein kinase kinase kinase 1,
FT                   transcript variant mCT22267"
FT                   /note="gene_id=mCG20636.2 transcript_id=mCT22267.2 created
FT                   on 12-FEB-2003"
FT   mRNA            complement(join(8070317..8070738,8072267..8072735,
FT                   8074127..8074258,8074905..8075047,8076063..8076194,
FT                   8077437..8077599,8078340..8078492,8078808..8080059,
FT                   8080310..8080499,8080791..8080882,8081763..8081884,
FT                   8083649..8083927,8086747..8086930,8087192..8087273,
FT                   8087775..8087896,8091662..8091810,8092176..8092294,
FT                   8093413..8093613,8100423..8100623,8103155..>8103311))
FT                   /gene="Map3k1"
FT                   /locus_tag="mCG_20636"
FT                   /product="mitogen activated protein kinase kinase kinase 1,
FT                   transcript variant mCT179907"
FT                   /note="gene_id=mCG20636.2 transcript_id=mCT179907.0 created
FT                   on 12-FEB-2003"
FT   CDS             complement(join(8072586..8072735,8074127..8074258,
FT                   8074905..8075047,8076063..8076194,8077437..8077599,
FT                   8078340..8078492,8078808..8080059,8080310..8080499,
FT                   8080791..8080882,8081763..8081884,8083649..8083927,
FT                   8086747..8086930,8087192..8087273,8087775..8087896,
FT                   8091662..8091810,8092563..8092679,8093413..8093613,
FT                   8100423..8100623,8103155..>8103304))
FT                   /codon_start=1
FT                   /gene="Map3k1"
FT                   /locus_tag="mCG_20636"
FT                   /product="mitogen activated protein kinase kinase kinase 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG20636.2 transcript_id=mCT22267.2
FT                   protein_id=mCP10627.2 isoform=CRA_a"
FT                   /protein_id="EDL18419.1"
FT                   /translation="REMENKETLKGLHKMEDRPEERMIREKLKATCMPAWKHEWLERRN
FT                   RRGPVVVKPIPIKGDGSEMNNLAAEPQGEGQAGSAAPAPKGRRSPSPGSSPSGRSVKPE
FT                   SPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYSPEETSRRVNKVMRARLYLLQQIGP
FT                   NSFLIGGDSPDNKYRVFIGPQNCSCGRGAFCIHLLFVMLRVFQLEPSDPMLWRKTLKNF
FT                   EVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNCHTLSSSSTSTSSSENSIKDEEEQM
FT                   CPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNREPLICPLCRSKWRSHDFY
FT                   SHELSSPVESPTSLRAVQQPSSPQQPVAGSQRRNQESSFNLTHFGTQQIPSAYKDLAEP
FT                   WIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANGESTGNSGGGSGGSLSAGA
FT                   ASGSSQPSISGDVVEACCSVLSIVCADPVYKVYVAALKTLRAMLVYTPCHSLAERIKLQ
FT                   RLLRPVVDTILVKCADANSRTSQLSISTVLELCKGQAGELAVGREILKAGSIGVGGVDY
FT                   VLSCILGNQAESNNWQELLGRLCLIDRLLLEFPAEFYPHIVSTDVSQAEPVEIRYKKLL
FT                   SLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTAVPAVFSKLVTMLNASGSTHFTRMRR
FT                   RLMAIADEVEIAEVIQLGVEDTVDGHQDSLQVLAPASCLENSSLEHTVHREKTGKGLSA
FT                   TRLSASSEDISDRLAGVSVGLPSSTTTEQPKPAVQTKGRPHSQCLNSSPLSHAQLMFPA
FT                   PSAPCSSAPSVPDISKHRPQAFVPCKIPSASPQTQRKFSLQFQRNCSEHRDSDQLSPVF
FT                   TQSRPPPSSNIHRPKPSRPVPGSTSKLGDATKSSMTLDLGSASRCDDSFGGGGNSGNAV
FT                   IPSEETVFTPVEDKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAEND
FT                   DTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSASQDALPIVPQLQVENGEDIIIIQQDT
FT                   PETLPGHTKAKQPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSS
FT                   EQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAF
FT                   KESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGT
FT                   GAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLA
FT                   LIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW"
FT   CDS             complement(join(8072586..8072735,8074127..8074258,
FT                   8074905..8075047,8076063..8076194,8077437..8077599,
FT                   8078340..8078492,8078808..8080059,8080310..8080499,
FT                   8080791..8080882,8081763..8081884,8083649..8083927,
FT                   8086747..8086930,8087192..8087273,8087775..8087896,
FT                   8091662..8091810,8092176..>8092223))
FT                   /codon_start=1
FT                   /gene="Map3k1"
FT                   /locus_tag="mCG_20636"
FT                   /product="mitogen activated protein kinase kinase kinase 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG20636.2 transcript_id=mCT179907.0
FT                   protein_id=mCP102829.0 isoform=CRA_b"
FT                   /protein_id="EDL18420.1"
FT                   /translation="RPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVS
FT                   RMSNCHTLSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCM
FT                   SIWAEECRRNREPLICPLCRSKWRSHDFYSHELSSPVESPTSLRAVQQPSSPQQPVAGS
FT                   QRRNQESSFNLTHFGTQQIPSAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSH
FT                   DVSGALLLANGESTGNSGGGSGGSLSAGAASGSSQPSISGDVVEACCSVLSIVCADPVY
FT                   KVYVAALKTLRAMLVYTPCHSLAERIKLQRLLRPVVDTILVKCADANSRTSQLSISTVL
FT                   ELCKGQAGELAVGREILKAGSIGVGGVDYVLSCILGNQAESNNWQELLGRLCLIDRLLL
FT                   EFPAEFYPHIVSTDVSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSAR
FT                   MVTAVPAVFSKLVTMLNASGSTHFTRMRRRLMAIADEVEIAEVIQLGVEDTVDGHQDSL
FT                   QVLAPASCLENSSLEHTVHREKTGKGLSATRLSASSEDISDRLAGVSVGLPSSTTTEQP
FT                   KPAVQTKGRPHSQCLNSSPLSHAQLMFPAPSAPCSSAPSVPDISKHRPQAFVPCKIPSA
FT                   SPQTQRKFSLQFQRNCSEHRDSDQLSPVFTQSRPPPSSNIHRPKPSRPVPGSTSKLGDA
FT                   TKSSMTLDLGSASRCDDSFGGGGNSGNAVIPSEETVFTPVEDKCRLDVNTELNSSIEDL
FT                   LEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIAMA
FT                   MSASQDALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDAEWLKGQQIGLGA
FT                   FSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGA
FT                   TCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVK
FT                   GANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSC
FT                   DVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCL
FT                   ELQPQDRPPSRELLKHPVFRTTW"
FT   assembly_gap    8092308..8092327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8096562..8098820
FT                   /estimated_length=2259
FT                   /gap_type="unknown"
FT   assembly_gap    8100036..8100055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8101810..8103008
FT                   /estimated_length=1199
FT                   /gap_type="unknown"
FT   assembly_gap    8104961..8108493
FT                   /estimated_length=3533
FT                   /gap_type="unknown"
FT   assembly_gap    8135465..8136027
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    8145571..8145590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8154794..8155274
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    8161540..8165626
FT                   /estimated_length=4087
FT                   /gap_type="unknown"
FT   assembly_gap    8171413..8171712
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    8178784..8179337
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    8181054..8181073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8183040..8183059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <8186304..>8187813
FT                   /locus_tag="mCG_1033049"
FT                   /note="gene_id=mCG1033049.1"
FT   mRNA            join(<8186304..8186587,8187743..>8187813)
FT                   /locus_tag="mCG_1033049"
FT                   /product="mCG1033049"
FT                   /note="gene_id=mCG1033049.1 transcript_id=mCT150753.1
FT                   created on 12-FEB-2003"
FT   CDS             join(<8186355..8186587,8187743..>8187813)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033049"
FT                   /product="mCG1033049"
FT                   /note="gene_id=mCG1033049.1 transcript_id=mCT150753.1
FT                   protein_id=mCP84008.1"
FT                   /protein_id="EDL18418.1"
FT                   /translation="GWVKGSGIRAEATQLDHLLSCCSAHPQESLTPECLEWLPCRAYQA
FT                   AFWVYFHLTIASLFSRSCWEMFNLRIRTLATELSLHVTFRNYESQTSGRRRLFIIY"
FT   assembly_gap    8194881..8195037
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    8196521..8196779
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    8198355..8198378
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            complement(8211837..8213904)
FT                   /pseudo
FT                   /locus_tag="mCG_112993"
FT                   /note="gene_id=mCG112993.1"
FT   mRNA            complement(8211837..8213904)
FT                   /pseudo
FT                   /locus_tag="mCG_112993"
FT                   /note="gene_id=mCG112993.1 transcript_id=mCT114070.1
FT                   created on 12-FEB-2003"
FT   assembly_gap    8215426..8215445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8217038..8217603
FT                   /estimated_length=566
FT                   /gap_type="unknown"
FT   assembly_gap    8218721..8219649
FT                   /estimated_length=929
FT                   /gap_type="unknown"
FT   assembly_gap    8221352..8222671
FT                   /estimated_length=1320
FT                   /gap_type="unknown"
FT   assembly_gap    8224449..8224468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8233803..8233835
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    8235518..8236091
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   assembly_gap    8247306..8247596
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    8268420..8268439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8278276..8278355
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    8284944..8285023
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    8293288..8293307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8302577..8302596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8303954..8303973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8305119..8305138
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8316190..8316209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8324220..8324276
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    8325095..8325600
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    8332695..8332957
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    8340613..8342007
FT                   /estimated_length=1395
FT                   /gap_type="unknown"
FT   assembly_gap    8345457..8346447
FT                   /estimated_length=991
FT                   /gap_type="unknown"
FT   assembly_gap    8349013..8349248
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    8350316..8350397
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    8352224..8352331
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    8355312..8367319
FT                   /estimated_length=12008
FT                   /gap_type="unknown"
FT   assembly_gap    8368924..8369485
FT                   /estimated_length=562
FT                   /gap_type="unknown"
FT   assembly_gap    8373617..8373643
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    8387372..8387391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8388765..8388784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8392283..8392861
FT                   /estimated_length=579
FT                   /gap_type="unknown"
FT   assembly_gap    8399050..8399347
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    8407779..8408015
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    8430199..8431441
FT                   /estimated_length=1243
FT                   /gap_type="unknown"
FT   assembly_gap    8443094..8443113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8444525..8444544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8461135..8461310
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    8465675..8469206
FT                   /estimated_length=3532
FT                   /gap_type="unknown"
FT   assembly_gap    8470453..8478170
FT                   /estimated_length=7718
FT                   /gap_type="unknown"
FT   assembly_gap    8479768..8482451
FT                   /estimated_length=2684
FT                   /gap_type="unknown"
FT   assembly_gap    8483207..8483408
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   gene            complement(8494655..>8501347)
FT                   /locus_tag="mCG_1033044"
FT                   /note="gene_id=mCG1033044.1"
FT   mRNA            complement(join(8494655..8495747,8501305..>8501347))
FT                   /locus_tag="mCG_1033044"
FT                   /product="mCG1033044"
FT                   /note="gene_id=mCG1033044.1 transcript_id=mCT150748.1
FT                   created on 12-FEB-2003"
FT   CDS             complement(8495525..>8495707)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033044"
FT                   /product="mCG1033044"
FT                   /note="gene_id=mCG1033044.1 transcript_id=mCT150748.1
FT                   protein_id=mCP83918.1"
FT                   /protein_id="EDL18417.1"
FT                   /translation="DAVSWKGAILLWSRPLSSTNFLIMEPFRPSAIGTMMYFKLVAWQS
FT                   VSRPLLFFLYTKWSS"
FT   assembly_gap    8500016..8500035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8514846..8515079
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    8516195..8517623
FT                   /estimated_length=1429
FT                   /gap_type="unknown"
FT   assembly_gap    8533234..8533425
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    8540119..8540138
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8546675..8546694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8557230..8557637
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    8559392..8559608
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    8597195..8597214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8619674..8715337
FT                   /gene="Ankrd55"
FT                   /locus_tag="mCG_11412"
FT                   /note="gene_id=mCG11412.2"
FT   mRNA            join(8619674..8619838,8649361..8649483,8654010..8654140,
FT                   8658073..8658182,8667158..8667218,8679707..8679835,
FT                   8687073..8687257,8694582..8694749,8698897..8699561,
FT                   8711796..8711888,8714086..8714300,8715079..8715337)
FT                   /gene="Ankrd55"
FT                   /locus_tag="mCG_11412"
FT                   /product="ankyrin repeat domain 55, transcript variant
FT                   mCT11619"
FT                   /note="gene_id=mCG11412.2 transcript_id=mCT11619.2 created
FT                   on 20-NOV-2002"
FT   CDS             join(8619784..8619838,8649361..8649483,8654010..8654140,
FT                   8658073..8658182,8667158..8667218,8679707..8679835,
FT                   8687073..8687257,8694582..8694749,8698897..8699561,
FT                   8711796..8711888,8714086..8714246)
FT                   /codon_start=1
FT                   /gene="Ankrd55"
FT                   /locus_tag="mCG_11412"
FT                   /product="ankyrin repeat domain 55, isoform CRA_a"
FT                   /note="gene_id=mCG11412.2 transcript_id=mCT11619.2
FT                   protein_id=mCP16941.2 isoform=CRA_a"
FT                   /protein_id="EDL18414.1"
FT                   /translation="MRQATMDFSTSSVFDQHKGDSSEEVDLAMVYQAASNGDVNSLTSV
FT                   IREDPSILECCDSEGCTPLMHAVSGRQVDTVKLLLKMGANINTQDAYGRTSLCLATYLG
FT                   WLEGCVSLLRNGAKHNIPDKNGRLPLHAATAEPDVRLLIVLLQQSSLSEINHQDTEGMT
FT                   PLHWAAFHNRPQHTQMLLKKGADPTLVDKDFKTALHWAVQSGNRILCSIILSHRQGPSI
FT                   INYDDESGKTCIHIAAASGFGDIINDLAKVPECNLQALDVDDRTPLHWAAASGKAECVQ
FT                   SLLDLGMDSNLRDINESTPLAYALYCGHTACVRLLSREGRAEPARPLPSQNSQPQKKEG
FT                   RFSMLNQIFCKNKKEEQKAHQKDQSRARPKEEETSEVNDIIATFDSVVDTNCQGQPGDQ
FT                   VDMVVFKKRTSENSKYLLPEKKSLARKGLPPIRTQSLPPITLGGHFLTASQGAVSHAGL
FT                   NAGPQHTAQRSQKSRSEQDLLNNRTGCPVSLENPWKGDTRQVFSCKAWTVSSSDKLLDR
FT                   LFAGQPGHQELSGPPHLPHLHNPSSGQALQHLSPNRPKIRDLPFTRNSLAPLPDQKFLS
FT                   GEPLRTNRVLPAIPSQRGHDPSPAGESQRGHDPPRAEESGGSSSPTHDEN"
FT   assembly_gap    8634717..8634850
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    8657872..8657898
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    8659898..8660044
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   mRNA            join(<8666900..8666982,8667158..8667218,8679707..8679835,
FT                   8687073..8687257,8694582..8694749,8698902..8699187)
FT                   /gene="Ankrd55"
FT                   /locus_tag="mCG_11412"
FT                   /product="ankyrin repeat domain 55, transcript variant
FT                   mCT120905"
FT                   /note="gene_id=mCG11412.2 transcript_id=mCT120905.1 created
FT                   on 20-NOV-2002"
FT   CDS             join(<8666900..8666982,8667158..8667218,8679707..8679835,
FT                   8687073..8687257,8694582..8694749,8698902..8698911)
FT                   /codon_start=1
FT                   /gene="Ankrd55"
FT                   /locus_tag="mCG_11412"
FT                   /product="ankyrin repeat domain 55, isoform CRA_b"
FT                   /note="gene_id=mCG11412.2 transcript_id=mCT120905.1
FT                   protein_id=mCP83852.0 isoform=CRA_b"
FT                   /protein_id="EDL18415.1"
FT                   /translation="QRVRLKARCLASPSSPGALEWQEAGVDRLLIVLLQQSSLSEINHQ
FT                   DTEGMTPLHWAAFHNRPQHTQMLLKKGADPTLVDKDFKTALHWAVQSGNRILCSIILSH
FT                   RQGPSIINYDDESGKTCIHIAAASGFGDIINDLAKVPECNLQALDVDDRTPLHWAAASG
FT                   KAECVQSLLDLGMDSNLRDINESTPLAYALYCGHTACVRLLSREGRAC"
FT   assembly_gap    8682379..8682545
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    8686965..8686984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8688092..>8699059)
FT                   /locus_tag="mCG_146205"
FT                   /note="gene_id=mCG146205.0"
FT   mRNA            complement(join(8688092..8688156,8688266..8689595,
FT                   8691759..8691875,8695690..8695916,8697951..>8699059))
FT                   /locus_tag="mCG_146205"
FT                   /product="mCG146205"
FT                   /note="gene_id=mCG146205.0 transcript_id=mCT186308.0
FT                   created on 14-JUL-2003"
FT   assembly_gap    8696090..8696178
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   CDS             complement(8698283..>8698618)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146205"
FT                   /product="mCG146205"
FT                   /note="gene_id=mCG146205.0 transcript_id=mCT186308.0
FT                   protein_id=mCP107789.0"
FT                   /protein_id="EDL18416.1"
FT                   /translation="SLSFRLLSSVLMVMGYPHLSGAGFIPAPHYFVVVVFWQQHTFMYC
FT                   TPIMHGRKSFHPNSALTPLLCLPPPLLPPFSSLCMWRLEIDMVCLPLCLSTLPIYLIFD
FT                   IYLQLCV"
FT   assembly_gap    8705637..8705783
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    8714301..8715078
FT                   /estimated_length=778
FT                   /gap_type="unknown"
FT   assembly_gap    8716971..8718603
FT                   /estimated_length=1633
FT                   /gap_type="unknown"
FT   assembly_gap    8720273..8720292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8729205..8731023
FT                   /estimated_length=1819
FT                   /gap_type="unknown"
FT   assembly_gap    8733404..8733622
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    8737226..8737633
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    8740877..8741146
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    8741502..8741920
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    8743935..8743954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8747814..8747889
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    8754701..8754819
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   gene            complement(8755642..8757761)
FT                   /locus_tag="mCG_147610"
FT                   /note="gene_id=mCG147610.0"
FT   mRNA            complement(join(8755642..8757275,8757554..8757761))
FT                   /locus_tag="mCG_147610"
FT                   /product="mCG147610"
FT                   /note="gene_id=mCG147610.0 transcript_id=mCT187873.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(8756972..8757127)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147610"
FT                   /product="mCG147610"
FT                   /note="gene_id=mCG147610.0 transcript_id=mCT187873.0
FT                   protein_id=mCP108834.0"
FT                   /protein_id="EDL18413.1"
FT                   /translation="MIFNENNRTVSEAVKDTTKPRTASVTDQGSCLYSTKLWFPSSPAH
FT                   VSCHSG"
FT   assembly_gap    8758179..8758916
FT                   /estimated_length=738
FT                   /gap_type="unknown"
FT   assembly_gap    8760477..8762515
FT                   /estimated_length=2039
FT                   /gap_type="unknown"
FT   assembly_gap    8772312..8772371
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    8780401..8780420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8781953..8782305
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    8783666..8783685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8787087..8787106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8788186..8788205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8795098..8839609
FT                   /gene="Il6st"
FT                   /locus_tag="mCG_11419"
FT                   /note="gene_id=mCG11419.2"
FT   mRNA            join(8795098..8795212,8803550..8803636,8805892..8805970,
FT                   8810846..8811151,8812272..8812392,8818557..8818717,
FT                   8819352..8819506,8821331..8821490,8824437..8824519,
FT                   8825427..8825637,8826038..8826220,8828133..8828234,
FT                   8828570..8828716,8829593..8829733,8831957..8832053,
FT                   8833621..8833702,8834535..8839609)
FT                   /gene="Il6st"
FT                   /locus_tag="mCG_11419"
FT                   /product="interleukin 6 signal transducer"
FT                   /note="gene_id=mCG11419.2 transcript_id=mCT11626.2 created
FT                   on 13-NOV-2002"
FT   CDS             join(8805907..8805970,8810846..8811151,8812272..8812392,
FT                   8818557..8818717,8819352..8819506,8821331..8821490,
FT                   8824437..8824519,8825427..8825637,8826038..8826220,
FT                   8828133..8828234,8828570..8828716,8829593..8829733,
FT                   8831957..8832053,8833621..8833702,8834535..8835275)
FT                   /codon_start=1
FT                   /gene="Il6st"
FT                   /locus_tag="mCG_11419"
FT                   /product="interleukin 6 signal transducer"
FT                   /note="gene_id=mCG11419.2 transcript_id=mCT11626.2
FT                   protein_id=mCP16944.2"
FT                   /db_xref="GOA:Q00560"
FT                   /db_xref="InterPro:IPR003529"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR010457"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015321"
FT                   /db_xref="MGI:MGI:96560"
FT                   /db_xref="PDB:2BBU"
FT                   /db_xref="PDB:2HMH"
FT                   /db_xref="PDB:4GL9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00560"
FT                   /protein_id="EDL18412.1"
FT                   /translation="MSAPRIWLAQALLFFLTTESIGQLLEPCGYIYPEFPVVQRGSNFT
FT                   AICVLKEACLQHYYVNASYIVWKTNHAAVPREQVTVINRTTSSVTFTDVVLPSVQLTCN
FT                   ILSFGQIEQNVYGVTMLSGFPPDKPTNLTCIVNEGKNMLCQWDPGRETYLETNYTLKSE
FT                   WATEKFPDCQSKHGTSCMVSYMPTYYVNIEVWVEAENALGKVSSESINFDPVDKVKPTP
FT                   PYNLSVTNSEELSSILKLSWVSSGLGGLLDLKSDIQYRTKDASTWIQVPLEDTMSPRTS
FT                   FTVQDLKPFTEYVFRIRSIKDSGKGYWSDWSEEASGTTYEDRPSRPPSFWYKTNPSHGQ
FT                   EYRSVRLIWKALPLSEANGKILDYEVILTQSKSVSQTYTVTGTELTVNLTNDRYVASLA
FT                   ARNKVGKSAAAVLTIPSPHVTAAYSVVNLKAFPKDNLLWVEWTPPPKPVSKYILEWCVL
FT                   SENAPCVEDWQQEDATVNRTHLRGRLLESKCYQITVTPVFATGPGGSESLKAYLKQAAP
FT                   ARGPTVRTKKVGKNEAVLAWDQIPVDDQNGFIRNYSISYRTSVGKEMVVHVDSSHTEYT
FT                   LSSLSSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGV
FT                   LFCFNKRDLIKKHIWPNVPDPSKSHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEI
FT                   EANNKKPCPDDLKSVDLFKKEKVSTEGHSSGIGGSSCMSSSRPSISSNEENESAQSTAS
FT                   TVQYSTVVHSGYRHQVPSVQVFSRSESTQPLLDSEERPEDLQLVDSVDGGDEILPRQPY
FT                   FKQNCSQPEACPEISHFERSNQVLSGNEEDFVRLKQQQVSDHISQPYGSEQRRLFQEGS
FT                   TADALGTGADGQMERFESVGMETTIDEEIPKSYLPQTVRQGGYMPQ"
FT   assembly_gap    8844414..8844433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8853782..8910518)
FT                   /gene="Il31ra"
FT                   /locus_tag="mCG_141550"
FT                   /note="gene_id=mCG141550.0"
FT   mRNA            complement(join(8853782..8855342,8856806..8856887,
FT                   8858432..8858525,8861249..8861389,8862638..8862784,
FT                   8863881..8863982,8864706..8864891,8871156..8871372,
FT                   8873976..8874055,8876269..8876422,8877446..8877588,
FT                   8879506..8879669,8881958..8882075,8889255..8889333,
FT                   8891958..8892165,8895991..8896154,8910494..8910518))
FT                   /gene="Il31ra"
FT                   /locus_tag="mCG_141550"
FT                   /product="interleukin 31 receptor A, transcript variant
FT                   mCT175932"
FT                   /note="gene_id=mCG141550.0 transcript_id=mCT175932.0
FT                   created on 20-NOV-2002"
FT   mRNA            complement(join(8853782..8855342,8856806..8856887,
FT                   8858432..8858525,8861249..8861389,8862638..8862784,
FT                   8863107..>8863315))
FT                   /gene="Il31ra"
FT                   /locus_tag="mCG_141550"
FT                   /product="interleukin 31 receptor A, transcript variant
FT                   mCT175931"
FT                   /note="gene_id=mCG141550.0 transcript_id=mCT175931.0
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(8854875..8855342,8856806..8856887,
FT                   8858432..8858525,8861249..8861389,8862638..8862784,
FT                   8863881..8863982,8864706..8864891,8871156..8871372,
FT                   8873976..8874055,8876269..8876422,8877446..8877588,
FT                   8879506..8879669,8881958..8882075,8889255..8889309))
FT                   /codon_start=1
FT                   /gene="Il31ra"
FT                   /locus_tag="mCG_141550"
FT                   /product="interleukin 31 receptor A, isoform CRA_a"
FT                   /note="gene_id=mCG141550.0 transcript_id=mCT175932.0
FT                   protein_id=mCP98853.0 isoform=CRA_a"
FT                   /protein_id="EDL18410.1"
FT                   /translation="MWTLALWAFSFLCKFSLAVLPTKPENISCVFYFDRNLTCTWRPEK
FT                   ETNDTSYIVTLTYSYGKSNYSDNATEASYSFPRSCAMPPDICSVEVQAQNGDGKVKSDI
FT                   TYWHLISIAKTEPPIILSVNPICNRMFQIQWKPREKTRGFPLVCMLRFRTVNSSRWTEV
FT                   NFENCKQVCNLTGLQAFTEYVLALRFRFNDSRYWSKWSKEETRVTMEEVPHVLDLWRIL
FT                   EPADMNGDRKVRLLWKKARGAPVLEKTFGYHIQYFAENSTNLTEINNITTQQYELLLMS
FT                   QAHSVSVTSFNSLGKSQETILRIPDVHEKTFQYIKSMKAYIAEPLLVVNWQSSIPAVDT
FT                   WIVEWLPEAAMSKFPALSWESVSQVTNWTIEQDKLKPFTCYNISVYPVLGHRVGEPYSI
FT                   QAYAKEGTPLKGPETRVENIGLRTATITWKEIPKSARNGFINNYTVFYQAEGGKELSKT
FT                   VNSHALQCDLESLTRRTSYTVWVMASTRAGGTNGVRINFKTLSISVFEIVLLTSLVGGG
FT                   LLLLSIKTVTFGLRKPNRLTPLCCPDVPNPAESSLATWLGDGFKKSNMKETGNSGDTED
FT                   VVLKPCPVPADLIDKLVVNFENFLEVVLTEEAGKGQASILGGEANEYVTSPSRPDGPPG
FT                   KSFKEPSVLTEVASEDSHSTCSRMADEAYSELARQPSSSCQSPGLSPPREDQAQNPYLK
FT                   NSVTTREFLVHENIPEHSKGEV"
FT   CDS             complement(join(8854875..8855342,8856806..8856887,
FT                   8858432..8858525,8861249..8861389,8862638..8862784,
FT                   8863107..>8863152))
FT                   /codon_start=1
FT                   /gene="Il31ra"
FT                   /locus_tag="mCG_141550"
FT                   /product="interleukin 31 receptor A, isoform CRA_b"
FT                   /note="gene_id=mCG141550.0 transcript_id=mCT175931.0
FT                   protein_id=mCP98854.0 isoform=CRA_b"
FT                   /protein_id="EDL18411.1"
FT                   /translation="ASSRFNTGKRLLLYKAPLKGPETRVENIGLRTATITWKEIPKSAR
FT                   NGFINNYTVFYQAEGGKELSKTVNSHALQCDLESLTRRTSYTVWVMASTRAGGTNGVRI
FT                   NFKTLSISVFEIVLLTSLVGGGLLLLSIKTVTFGLRKPNRLTPLCCPDVPNPAESSLAT
FT                   WLGDGFKKSNMKETGNSGDTEDVVLKPCPVPADLIDKLVVNFENFLEVVLTEEAGKGQA
FT                   SILGGEANEYVTSPSRPDGPPGKSFKEPSVLTEVASEDSHSTCSRMADEAYSELARQPS
FT                   SSCQSPGLSPPREDQAQNPYLKNSVTTREFLVHENIPEHSKGEV"
FT   assembly_gap    8870440..8870459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8895230..8895589
FT                   /estimated_length=360
FT                   /gap_type="unknown"
FT   assembly_gap    8896740..8896759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8903662..8904920
FT                   /estimated_length=1259
FT                   /gap_type="unknown"
FT   assembly_gap    8921529..8921548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8922941..8922960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8924224..8924243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8926022..8927618)
FT                   /pseudo
FT                   /locus_tag="mCG_119725"
FT                   /note="gene_id=mCG119725.1"
FT   mRNA            complement(8926022..8927618)
FT                   /pseudo
FT                   /locus_tag="mCG_119725"
FT                   /note="gene_id=mCG119725.1 transcript_id=mCT120898.1
FT                   created on 20-NOV-2002"
FT   gene            complement(8930762..>8987889)
FT                   /gene="Ddx4"
FT                   /locus_tag="mCG_119726"
FT                   /note="gene_id=mCG119726.1"
FT   mRNA            complement(join(8930762..8931456,8932043..8932159,
FT                   8932277..8932547,8935875..8935974,8939090..8939235,
FT                   8946585..8946751,8948310..8948439,8956317..8956471,
FT                   8956909..8957061,8957866..8958008,8958358..8958405,
FT                   8958499..8958546,8960481..8960522,8961042..8961122,
FT                   8962009..8962110,8964519..8964578,8969542..8969592,
FT                   8971625..8971702,8980195..8980252,8986912..8986998,
FT                   8987864..>8987889))
FT                   /gene="Ddx4"
FT                   /locus_tag="mCG_119726"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 4"
FT                   /note="gene_id=mCG119726.1 transcript_id=mCT120899.1
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(8931370..8931456,8932043..8932159,
FT                   8932277..8932547,8935875..8935974,8939090..8939235,
FT                   8946585..8946751,8948310..8948439,8956317..8956471,
FT                   8956909..8957061,8957866..8958008,8958358..8958405,
FT                   8958499..8958546,8960481..8960522,8961042..8961122,
FT                   8962009..8962110,8964519..8964578,8969542..8969592,
FT                   8971625..8971702,8980195..8980252,8986912..8986998,
FT                   8987864..>8987887))
FT                   /codon_start=1
FT                   /gene="Ddx4"
FT                   /locus_tag="mCG_119726"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 4"
FT                   /note="gene_id=mCG119726.1 transcript_id=mCT120899.1
FT                   protein_id=mCP83975.1"
FT                   /protein_id="EDL18409.1"
FT                   /translation="ARGAWRGEEPEAIMGDEDWEAEILKPHVSSYVPVFEKDKYSSGAN
FT                   GDTFNRTSASSDIGESSKKENTSTTGGFGRGKGFGNRGFLNNKFEEGDSSGFWKESNND
FT                   CEDNQTRSRGFSKRGGCQDGNDSEASGPFRRGGRGSFRGCRGGFGLGRPNSESDQDQGT
FT                   QRGGGLFGSRKPAASDSGNGDTYQSRSGSGRGGYKGLNEEVVTGSGKNSWKSETEGGES
FT                   SDSQGPKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSGHDAPPAILTFEEANL
FT                   CQTLNNNIAKAGYTKLTPVQKYSIPIVLAGRDLMACAQTGSGKTAAFLLPILAHMMRDG
FT                   ITASRFKELQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVIYGGTQFGHSVRQIV
FT                   QGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDEADRMLDMGFGPEMKKLISCPGMPSK
FT                   EQRQTLLFSATFPEEIQRLAGDFLKSSYLFVAVGQVGGACRDVQQTILQVGQYSKREKL
FT                   VEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGK
FT                   CPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDTDSD
FT                   NHLAQPLVKVLSDAQQDVPAWLEEIAFSTYVPPSFSSSTRGGAVFASVDTRKNYQGKHT
FT                   LNTAGISSSQAPNPVDDESWD"
FT   assembly_gap    8932903..8932922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8934644..8934663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8936493..8936512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8953058..8953077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8979115..8979134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8989824..8993796
FT                   /estimated_length=3973
FT                   /gap_type="unknown"
FT   gene            8996461..9072692
FT                   /gene="9130023D20Rik"
FT                   /locus_tag="mCG_119722"
FT                   /note="gene_id=mCG119722.1"
FT   mRNA            join(8996461..8996557,9008624..9008768,9025088..9025220,
FT                   9028285..9028406,9028534..9028597,9029171..9029264,
FT                   9034265..9034435,9037414..9037473,9040969..9041163,
FT                   9043050..9043157,9053688..9053794,9063050..9063163,
FT                   9065496..9065644,9068650..9068739,9071152..9072692)
FT                   /gene="9130023D20Rik"
FT                   /locus_tag="mCG_119722"
FT                   /product="RIKEN cDNA 9130023D20, transcript variant
FT                   mCT120902"
FT                   /note="gene_id=mCG119722.1 transcript_id=mCT120902.1
FT                   created on 04-APR-2003"
FT   mRNA            join(<8996465..8996557,9008624..9008768,9023087..9023171,
FT                   9025088..9025220,9028285..9028406,9028534..9028597,
FT                   9029171..9029264,9034265..9034435,9037414..9037473,
FT                   9040969..9041163,9043050..9043157,9053688..9053794,
FT                   9063050..9063163,9065496..9065644,9068650..9068739,
FT                   9071152..9072692)
FT                   /gene="9130023D20Rik"
FT                   /locus_tag="mCG_119722"
FT                   /product="RIKEN cDNA 9130023D20, transcript variant
FT                   mCT120903"
FT                   /note="gene_id=mCG119722.1 transcript_id=mCT120903.1
FT                   created on 04-APR-2003"
FT   assembly_gap    9003545..9003564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9004899..9004918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(9008659..9008768,9025088..9025220,9028285..9028406,
FT                   9028534..9028597,9029171..9029264,9034265..9034435,
FT                   9037414..9037473,9040969..9041163,9043050..9043157,
FT                   9053688..9053794,9063050..9063163,9065496..9065644,
FT                   9068650..9068739,9071152..9071317)
FT                   /codon_start=1
FT                   /gene="9130023D20Rik"
FT                   /locus_tag="mCG_119722"
FT                   /product="RIKEN cDNA 9130023D20, isoform CRA_a"
FT                   /note="gene_id=mCG119722.1 transcript_id=mCT120902.1
FT                   protein_id=mCP83978.1 isoform=CRA_a"
FT                   /protein_id="EDL18407.1"
FT                   /translation="MANVDGDSRHLLSEVEHEVSPGPMNIQFDSSDLRSKRPFYIEPTN
FT                   IVNVNDVIQRVSDHAAAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAY
FT                   KLKSYTEGYGKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIVLMGLLTLYC
FT                   CYRVVKSRSTISTSDTSTWEYPDVCKHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNF
FT                   LFNTGKFIFNFIHHINDTDTVLSTNNSNPVICPNAGSGGRPDNSSMIFYNNNTEVQLFE
FT                   KWWDKSRTVPFYLIGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFVVTLKAVRLGFHLE
FT                   FHWFVPTEFFVPEIRAQFPQLMGVLTLAFFIHNCIITLLKNNKNQENNVRDLCIAYMLV
FT                   TLTYLYIGILVFASFPSPPLPKDCIEQNFLDNFPSSDILSFIARIFLLFQMMTVYPLLG
FT                   YLARVQLLGHIFGDIYPSIFHVLILNLVIVGAGVTMACFYPNIGGIIRYSGAACGLAFV
FT                   FIYPSLIYIISLHQEERLTWPKLVFHVIIIILGLANLIAQFFM"
FT   CDS             join(<9008759..9008768,9023087..9023171,9025088..9025220,
FT                   9028285..9028406,9028534..9028597,9029171..9029264,
FT                   9034265..9034435,9037414..9037473,9040969..9041163,
FT                   9043050..9043157,9053688..9053794,9063050..9063163,
FT                   9065496..9065644,9068650..9068739,9071152..9071317)
FT                   /codon_start=1
FT                   /gene="9130023D20Rik"
FT                   /locus_tag="mCG_119722"
FT                   /product="RIKEN cDNA 9130023D20, isoform CRA_b"
FT                   /note="gene_id=mCG119722.1 transcript_id=mCT120903.1
FT                   protein_id=mCP83848.1 isoform=CRA_b"
FT                   /protein_id="EDL18408.1"
FT                   /translation="DLKGTQHLDENGWKRKAFKAILFSEYPSQLNWPFYIEPTNIVNVN
FT                   DVIQRVSDHAAAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLKSY
FT                   TEGYGKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIVLMGLLTLYCCYRVV
FT                   KSRSTISTSDTSTWEYPDVCKHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTG
FT                   KFIFNFIHHINDTDTVLSTNNSNPVICPNAGSGGRPDNSSMIFYNNNTEVQLFEKWWDK
FT                   SRTVPFYLIGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFVVTLKAVRLGFHLEFHWFV
FT                   PTEFFVPEIRAQFPQLMGVLTLAFFIHNCIITLLKNNKNQENNVRDLCIAYMLVTLTYL
FT                   YIGILVFASFPSPPLPKDCIEQNFLDNFPSSDILSFIARIFLLFQMMTVYPLLGYLARV
FT                   QLLGHIFGDIYPSIFHVLILNLVIVGAGVTMACFYPNIGGIIRYSGAACGLAFVFIYPS
FT                   LIYIISLHQEERLTWPKLVFHVIIIILGLANLIAQFFM"
FT   assembly_gap    9035062..9035081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9057712..9057731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9069342..9069791
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    9084578..9084804
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    9086418..9086537
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    9092279..9092550
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    9100566..9100592
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    9131634..9132631
FT                   /estimated_length=998
FT                   /gap_type="unknown"
FT   assembly_gap    9133807..9133912
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    9139513..9139532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9141575..9210157
FT                   /gene="Ppap2a"
FT                   /locus_tag="mCG_11416"
FT                   /note="gene_id=mCG11416.2"
FT   mRNA            join(9141575..9142065,9191691..9191842,9197596..9197876,
FT                   9200472..9200529,9209077..9209253,9209724..9210157)
FT                   /gene="Ppap2a"
FT                   /locus_tag="mCG_11416"
FT                   /product="phosphatidic acid phosphatase 2a, transcript
FT                   variant mCT11623"
FT                   /note="gene_id=mCG11416.2 transcript_id=mCT11623.1 created
FT                   on 13-NOV-2002"
FT   mRNA            join(<9141691..9142065,9175847..9176001,9197596..9197876,
FT                   9200472..9200529,9209077..9209253,9209724..9210150)
FT                   /gene="Ppap2a"
FT                   /locus_tag="mCG_11416"
FT                   /product="phosphatidic acid phosphatase 2a, transcript
FT                   variant mCT191184"
FT                   /note="gene_id=mCG11416.2 transcript_id=mCT191184.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<9141798..9142065,9175847..9176001,9197596..9197876,
FT                   9200472..9200529,9209077..9209253,9209724..9209849)
FT                   /codon_start=1
FT                   /gene="Ppap2a"
FT                   /locus_tag="mCG_11416"
FT                   /product="phosphatidic acid phosphatase 2a, isoform CRA_b"
FT                   /note="gene_id=mCG11416.2 transcript_id=mCT191184.0
FT                   protein_id=mCP112156.0 isoform=CRA_b"
FT                   /protein_id="EDL18406.1"
FT                   /translation="REKSGTRLPSVAGRPNPNCPGPCSRQSKRLAVAWGGRHPEGGALG
FT                   IGYLDRRGLFLPPLAPGGDTIQPVTMFDKTRLPYVALDVICVLLAAMPMTILKLGKVYP
FT                   FQRGFFCTDNSVKYPYHDSTIPSRILAILGLGLPIFSMSIGESLSVYFNVLHSNSFVGN
FT                   PYIATIYKAVGAFLFGVSASQSLTDIAKYTIGSLRPHFLAICNPDWSKINCSDGYIEDY
FT                   ICQGNEEKVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPMLQFGLIAFS
FT                   IYVGLSRVSDYKHHWSDVTVGLIQGAAMAILVALYVSDFFKDTHSYKERKEEDPHTTLH
FT                   ETASSRNYSTNHEP"
FT   CDS             join(9142008..9142065,9191691..9191842,9197596..9197876,
FT                   9200472..9200529,9209077..9209253,9209724..9209849)
FT                   /codon_start=1
FT                   /gene="Ppap2a"
FT                   /locus_tag="mCG_11416"
FT                   /product="phosphatidic acid phosphatase 2a, isoform CRA_a"
FT                   /note="gene_id=mCG11416.2 transcript_id=mCT11623.1
FT                   protein_id=mCP16943.1 isoform=CRA_a"
FT                   /protein_id="EDL18405.1"
FT                   /translation="MFDKTRLPYVALDVICVLLAGLPFAILTSRHTPFQRGIFCNDDSI
FT                   KYPYKEDTIPYALLGGIVIPFCIIVMSIGESLSVYFNVLHSNSFVGNPYIATIYKAVGA
FT                   FLFGVSASQSLTDIAKYTIGSLRPHFLAICNPDWSKINCSDGYIEDYICQGNEEKVKEG
FT                   RLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPMLQFGLIAFSIYVGLSRVSDYK
FT                   HHWSDVTVGLIQGAAMAILVALYVSDFFKDTHSYKERKEEDPHTTLHETASSRNYSTNH
FT                   EP"
FT   assembly_gap    9150928..9150949
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    9152452..9153858
FT                   /estimated_length=1407
FT                   /gap_type="unknown"
FT   assembly_gap    9162298..9162737
FT                   /estimated_length=440
FT                   /gap_type="unknown"
FT   assembly_gap    9165098..9165133
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    9205775..9205794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9210049..9270500)
FT                   /gene="Skiv2l2"
FT                   /locus_tag="mCG_118706"
FT                   /note="gene_id=mCG118706.1"
FT   mRNA            complement(join(9210049..9210264,9211280..9211384,
FT                   9216029..9216191,9217723..9217779,9219560..9219665,
FT                   9224093..9224256,9226217..9226405,9229876..9229986,
FT                   9230556..9230684,9234399..9234467,9235008..9235180,
FT                   9238560..9238710,9241899..9242024,9244607..9244708,
FT                   9246533..9246643,9248120..9248199,9250118..9250249,
FT                   9252034..9252136,9252952..9253050,9254046..9254170,
FT                   9256237..9256327,9257494..9257668,9260713..9260825,
FT                   9261692..9261754,9263485..9263551,9264755..9264892,
FT                   9270350..9270500))
FT                   /gene="Skiv2l2"
FT                   /locus_tag="mCG_118706"
FT                   /product="superkiller viralicidic activity 2-like 2 (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG118706.1 transcript_id=mCT119865.1
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(9210212..9210264,9211280..9211384,
FT                   9216029..9216191,9217723..9217779,9219560..9219665,
FT                   9224093..9224256,9226217..9226405,9229876..9229986,
FT                   9230556..9230684,9234399..9234467,9235008..9235180,
FT                   9238560..9238710,9241899..9242024,9244607..9244708,
FT                   9246533..9246643,9248120..9248199,9250118..9250249,
FT                   9252034..9252136,9252952..9253050,9254046..9254170,
FT                   9256237..9256327,9257494..9257668,9260713..9260825,
FT                   9261692..9261754,9263485..9263551,9264755..9264892,
FT                   9270350..9270477))
FT                   /codon_start=1
FT                   /gene="Skiv2l2"
FT                   /locus_tag="mCG_118706"
FT                   /product="superkiller viralicidic activity 2-like 2 (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG118706.1 transcript_id=mCT119865.1
FT                   protein_id=mCP83985.1"
FT                   /protein_id="EDL18404.1"
FT                   /translation="MADAFGDELFSVFEDDSTSAAGAKKDKEKEKWKGPPGSADKAGKR
FT                   LDTKLQSESASGGKNKRDLDVEGTDEPIFGKKPRIEDSINEDLSLADLMPRVKVQSVET
FT                   VEGCTHEVALPADEDYIPLKPRVGKAAKEYPFILDAFQREAIQCVDNNQSVLVSAHTSA
FT                   GKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASC
FT                   LVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLS
FT                   ATIPNARQFAEWICHLHKQPCHVIYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDN
FT                   FNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIMERNFQPVIIFSFSKKDCEA
FT                   YALQMTKLDFNTDEEKKMVEEVFNNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLL
FT                   PILKETIEILFSEGLIKALFATETFAMGINMPARTVLFTNARKYDGKDFRWISSGEYIQ
FT                   MSGRAGRRGMDDRGIVILMVDEKMSPTIGKQLLKGSADPLNSAFHLTYNMVLNLLRVEE
FT                   INPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEENVVIYYKIRQQLAKLG
FT                   KEIEEYIHKPKYCLPFLQPGRLVKVKNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVV
FT                   EVLLRCSKESLKNSATEAAKPAKPDEKGEMQVVPVLVHLLSAISTVRLYIPKDLRPVDN
FT                   RQSVLKSIQEVQRRFPDGVPLLDPIDDMGIQDQGLKKVIQKVEAFEHRMYSHPLHNDPN
FT                   LETVYTLCERKAQIALDIKSAKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEMK
FT                   GRVACEISSADELLLTEMMFNGLFNDLSSEQATALLSCFVFQENSSEMPKLTEQLAGPL
FT                   RQMQECAKRIAKVSAEAKLEIDEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEG
FT                   SIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGITKIKRDIVFAASLYL"
FT   assembly_gap    9213684..9213703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9270575..9313391
FT                   /gene="Dhx29"
FT                   /locus_tag="mCG_11409"
FT                   /note="gene_id=mCG11409.1"
FT   mRNA            join(9270575..9271093,9272722..9272795,9275622..9275751,
FT                   9276199..9276344,9278584..9278712,9283272..9283398,
FT                   9284572..9284730,9287424..9287589,9288001..9288124,
FT                   9289694..9290305,9291117..9291260,9295684..9295860,
FT                   9296528..9296668,9301775..9301863,9302981..9303109,
FT                   9303185..9303260,9303923..9304147,9305183..9305407,
FT                   9306746..9306882,9307275..9307368,9308459..9308752,
FT                   9309227..9309358,9310541..9310637,9313095..9313391)
FT                   /gene="Dhx29"
FT                   /locus_tag="mCG_11409"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 29,
FT                   transcript variant mCT11616"
FT                   /note="gene_id=mCG11409.1 transcript_id=mCT11616.2 created
FT                   on 20-NOV-2002"
FT   mRNA            join(<9270840..9271093,9272722..9272795,9273957..9274070,
FT                   9275622..9275751,9276199..9276344,9278584..9278712,
FT                   9283272..9283398,9284572..9284730,9287424..9287589,
FT                   9288001..9288124,9289694..9290305,9291117..9291260,
FT                   9295684..9295860,9296528..9296668,9298002..9298146,
FT                   9298254..9298371,9299244..9299328,9301775..9301863,
FT                   9302981..9303109,9303185..9303260,9303923..9304147,
FT                   9306746..9306882,9307275..9307368,9308459..9308752,
FT                   9309227..9309358,9310541..9310637,9313095..9313390)
FT                   /gene="Dhx29"
FT                   /locus_tag="mCG_11409"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 29,
FT                   transcript variant mCT191185"
FT                   /note="gene_id=mCG11409.1 transcript_id=mCT191185.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<9270910..9271093,9272722..9272795,9273957..9274070,
FT                   9275622..9275751,9276199..9276344,9278584..9278712,
FT                   9283272..9283398,9284572..9284730,9287424..9287589,
FT                   9288001..9288124,9289694..9290305,9291117..9291260,
FT                   9295684..9295860,9296528..9296668,9298002..9298146,
FT                   9298254..9298371,9299244..9299328,9301775..9301863,
FT                   9302981..9303109,9303185..9303260,9303923..9304147,
FT                   9306746..9306882,9307275..9307368,9308459..9308752,
FT                   9309227..9309358,9310541..9310637,9313095..9313147)
FT                   /codon_start=1
FT                   /gene="Dhx29"
FT                   /locus_tag="mCG_11409"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 29,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11409.1 transcript_id=mCT191185.0
FT                   protein_id=mCP112155.0 isoform=CRA_b"
FT                   /protein_id="EDL18403.1"
FT                   /translation="NMGGKNKKHKAPGAAAMRAAVSASRARSAEAGAVGEAQSKKPVAR
FT                   PAPAVPTGAREPRVKQGPKIYSFNSANDSGGSANLDKSILKVVINNKLEQRIIGVINEH
FT                   KKQNSDRGAISGRLSAKKLQDLYMALQAFSFKTKDIEDAMTNTLLHGGDLHSALDWLCL
FT                   NLSDDALPEGFSQEFEEQQPKSRPKFQSVQIQATLSPPQQTKTKRQEEDPKIKPKKEET
FT                   TVEVNMKEWILRYAEQQDEEEKGEGSKGLEEEEKFDPNQRYLNLAARLLDAKEQAAAFK
FT                   LEKNKQGQKEAQEKIRKFQREMETLEDHPIFNPAIKISHQQNEKKKPAPATEAESALNL
FT                   NLFEKSAAATEEEKGKKKEPHDVRNFDYTARSWTGKSPKQFLIDWVRKNLPKSPNPSFE
FT                   KVAVGRYWKCRVRVVRSEDDVLVVCPTILTEDGMQAQHLGATLALYRLVKGQSVHQLLP
FT                   PTYRDVWLEWSDEEKKREELNKMETNKPRDLFIAKLLNKLKQQQQQQQQQRPESEKGGS
FT                   EDPEESWENLVSDEDLAALSLEPTSAEDLAPVRSLFRRLQSTPKYQRLLKERQQLPVFK
FT                   HRDSIVETLKRHRVVVVAGETGSGKSTQVPHFLLEDLLLDECGARKCNIVCTQPRRISA
FT                   VSLATRVCEELGCESGPGGRNSLCGYQIRMESRASESTRLLYCTTGVLLRKLQEDGLLA
FT                   DVSHVIVDEVHERSVQSDFLLVILKEILQKRSDLHLILMSATVDSDKFSTYFTHCPILR
FT                   ISGRSYPVEVFHLEDIVEETGFVLEKDSEYCQKFLEEEEEITINVTSKAGGVKKYQEYI
FT                   PVQSGASPELNPFYQKYSSRTQHAILYMNPHKINLDLILELLVYLDKSPQFRNIEGAVL
FT                   IFLPGLAHIQQLYDLLSSDRRFYSERYQVIALHSVLSTQDQAAAFMFPPPGVRKIVLAT
FT                   NIAETGITIPDVVFVIDTGRTKENKYHESSQMSSLVETFVSKASALQRQGRAGRVRDGF
FT                   CFRLYTRERFEGFLDYSVPEILRVPLEELCLHIMKCDLGSPEDFLSKALDPPQLQVISN
FT                   AMNLLRKIGACEPNEPKLTPLGQHLAALPVNVKIGKMLIFGAIFGCLEPVATLAAVMTE
FT                   KSPFITPIGRKDEADLAKSSLAVADSDHLTIYNAYLGWKKAQQEGGFRSEISYCQRNFL
FT                   NRTSLLTLEDVKQELMKLVKAAGFSSSPSWEGRKGPQTLSFQDIALLKAVLAAGLYDSV
FT                   GKIMCTKSVDVTEKLACMVETAQGKAQVHPSSVNRDLQTYGWLLYQEKVRYTRVYLRET
FT                   TLITPFPVLLFGGDIEVQHRERLLSVDGWIYFQAPVKIAVIFKQLRVLIDSVLRKKLEN
FT                   PKMSLENDKILQIITELIKTENN"
FT   CDS             join(9270913..9271093,9272722..9272795,9275622..9275751,
FT                   9276199..9276344,9278584..9278712,9283272..9283398,
FT                   9284572..9284730,9287424..9287589,9288001..9288124,
FT                   9289694..9290305,9291117..9291260,9295684..9295860,
FT                   9296528..9296668,9301775..9301863,9302981..9303109,
FT                   9303185..9303260,9303923..9304147,9305183..9305407,
FT                   9306746..9306882,9307275..9307368,9308459..9308752,
FT                   9309227..9309358,9310541..9310637,9313095..9313147)
FT                   /codon_start=1
FT                   /gene="Dhx29"
FT                   /locus_tag="mCG_11409"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 29,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11409.1 transcript_id=mCT11616.2
FT                   protein_id=mCP16940.2 isoform=CRA_a"
FT                   /protein_id="EDL18402.1"
FT                   /translation="MGGKNKKHKAPGAAAMRAAVSASRARSAEAGAVGEAQSKKPVARP
FT                   APAVPTGAREPRVKQGPKIYSFNSANDSGGSANLDKSILKDLYMALQAFSFKTKDIEDA
FT                   MTNTLLHGGDLHSALDWLCLNLSDDALPEGFSQEFEEQQPKSRPKFQSVQIQATLSPPQ
FT                   QTKTKRQEEDPKIKPKKEETTVEVNMKEWILRYAEQQDEEEKGEGSKGLEEEEKFDPNQ
FT                   RYLNLAARLLDAKEQAAAFKLEKNKQGQKEAQEKIRKFQREMETLEDHPIFNPAIKISH
FT                   QQNEKKKPAPATEAESALNLNLFEKSAAATEEEKGKKKEPHDVRNFDYTARSWTGKSPK
FT                   QFLIDWVRKNLPKSPNPSFEKVAVGRYWKCRVRVVRSEDDVLVVCPTILTEDGMQAQHL
FT                   GATLALYRLVKGQSVHQLLPPTYRDVWLEWSDEEKKREELNKMETNKPRDLFIAKLLNK
FT                   LKQQQQQQQQQRPESEKGGSEDPEESWENLVSDEDLAALSLEPTSAEDLAPVRSLFRRL
FT                   QSTPKYQRLLKERQQLPVFKHRDSIVETLKRHRVVVVAGETGSGKSTQVPHFLLEDLLL
FT                   DECGARKCNIVCTQPRRISAVSLATRVCEELGCESGPGGRNSLCGYQIRMESRASESTR
FT                   LLYCTTGVLLRKLQEDGLLADVSHVIVDEVHERSVQSDFLLVILKEILQKRSDLHLILM
FT                   SATVDSDKFSTYFTHCPILRISGRSYPVEVFHLEDIVEETGFVLEKDSEYCQKFLEEEE
FT                   EITINVTSKAGGVKKYQIVLATNIAETGITIPDVVFVIDTGRTKENKYHESSQMSSLVE
FT                   TFVSKASALQRQGRAGRVRDGFCFRLYTRERFEGFLDYSVPEILRVPLEELCLHIMKCD
FT                   LGSPEDFLSKALDPPQLQVISNAMNLLRKIGACEPNEPKLTPLGQHLAALPVNVKIGKM
FT                   LIFGAIFGCLEPVKCDLGSPEDFLSKALDPPQLQVISNAMNLLRKIGACEPNEPKLTPL
FT                   GQHLAALPVNVKIGKMLIFGAIFGCLEPVATLAAVMTEKSPFITPIGRKDEADLAKSSL
FT                   AVADSDHLTIYNAYLGWKKAQQEGGFRSEISYCQRNFLNRTSLLTLEDVKQELMKLVKA
FT                   AGFSSSPSWEGRKGPQTLSFQDIALLKAVLAAGLYDSVGKIMCTKSVDVTEKLACMVET
FT                   AQGKAQVHPSSVNRDLQTYGWLLYQEKVRYTRVYLRETTLITPFPVLLFGGDIEVQHRE
FT                   RLLSVDGWIYFQAPVKIAVIFKQLRVLIDSVLRKKLENPKMSLENDKILQIITELIKTE
FT                   NN"
FT   gene            9280477..9280915
FT                   /pseudo
FT                   /locus_tag="mCG_141549"
FT                   /note="gene_id=mCG141549.0"
FT   mRNA            9280477..9280915
FT                   /pseudo
FT                   /locus_tag="mCG_141549"
FT                   /note="gene_id=mCG141549.0 transcript_id=mCT175930.0
FT                   created on 20-NOV-2002"
FT   assembly_gap    9304955..9304974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <9331608..9334616
FT                   /locus_tag="mCG_11413"
FT                   /note="gene_id=mCG11413.2"
FT   mRNA            join(<9331608..9332881,9333409..9334613)
FT                   /locus_tag="mCG_11413"
FT                   /product="mCG11413, transcript variant mCT179904"
FT                   /note="gene_id=mCG11413.2 transcript_id=mCT179904.0 created
FT                   on 12-FEB-2003"
FT   mRNA            join(9331633..9332089,9332696..9332881,9333409..9334616)
FT                   /locus_tag="mCG_11413"
FT                   /product="mCG11413, transcript variant mCT11620"
FT                   /note="gene_id=mCG11413.2 transcript_id=mCT11620.2 created
FT                   on 12-FEB-2003"
FT   CDS             join(9331703..9332089,9332696..9332881,9333409..9333894)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11413"
FT                   /product="mCG11413, isoform CRA_a"
FT                   /note="gene_id=mCG11413.2 transcript_id=mCT11620.2
FT                   protein_id=mCP16942.1 isoform=CRA_a"
FT                   /db_xref="GOA:B2RWG0"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR028864"
FT                   /db_xref="MGI:MGI:2145534"
FT                   /db_xref="UniProtKB/TrEMBL:B2RWG0"
FT                   /protein_id="EDL18400.1"
FT                   /translation="MVTPCPASPGSPAAGAGRRDSHQNLRAPVKKSRRPCLRRKKPLRP
FT                   LNACSLPGDSGVCDLFESPSSSSDGADSPAVSAARDCSSLLNPAQPLTALDLQTFREYG
FT                   QSCYDFRKAQENLFHPRESLARQPQVTAESRCKLLSWLLQVHRQFGLSFESLCLTVNTL
FT                   DRFLLTTPVAADCFQLLGVTCLLIACKQVEVHPPRLKQLLALCGGAFSRQQLCNLECIV
FT                   LHKLHFSLGAPTINFFLEHFTQWRMEAGQAEVTEALEAQTLARGVAELSLTDYAFTTYT
FT                   PSLMAICCLALADGLLQHQHEMDLRLGEHPEATLQDCLGKLQTLVSINSSSLPRILPPQ
FT                   IWERCSLPQSWQ"
FT   CDS             join(<9332378..9332881,9333409..9333894)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11413"
FT                   /product="mCG11413, isoform CRA_b"
FT                   /note="gene_id=mCG11413.2 transcript_id=mCT179904.0
FT                   protein_id=mCP102826.0 isoform=CRA_b"
FT                   /protein_id="EDL18401.1"
FT                   /translation="ICLHFCLKKKQKLYPPPPTPYSPFDLLRGLDWVVCPNALCTIPGA
FT                   SPNVPRRSGTPGLRQARTSPPPPHVPPIFQSFSVFPFASLPLWIVLFGRALQHTPPLAP
FT                   GQVTAESRCKLLSWLLQVHRQFGLSFESLCLTVNTLDRFLLTTPVAADCFQLLGVTCLL
FT                   IACKQVEVHPPRLKQLLALCGGAFSRQQLCNLECIVLHKLHFSLGAPTINFFLEHFTQW
FT                   RMEAGQAEVTEALEAQTLARGVAELSLTDYAFTTYTPSLMAICCLALADGLLQHQHEMD
FT                   LRLGEHPEATLQDCLGKLQTLVSINSSSLPRILPPQIWERCSLPQSWQ"
FT   assembly_gap    9335660..9335977
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    9336849..9336868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9337683..9343075
FT                   /locus_tag="mCG_51394"
FT                   /note="gene_id=mCG51394.2"
FT   mRNA            join(9337683..9337802,9337902..9337998,9338171..9338262,
FT                   9340666..9340738,9341189..9341403,9342306..9342416,
FT                   9342576..9343075)
FT                   /locus_tag="mCG_51394"
FT                   /product="mCG51394"
FT                   /note="gene_id=mCG51394.2 transcript_id=mCT51577.2 created
FT                   on 12-FEB-2003"
FT   CDS             join(9337686..9337802,9337902..9337998,9338171..9338262,
FT                   9340666..9340738,9341189..9341403,9342306..9342416,
FT                   9342576..9343010)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51394"
FT                   /product="mCG51394"
FT                   /note="gene_id=mCG51394.2 transcript_id=mCT51577.2
FT                   protein_id=mCP37730.2"
FT                   /db_xref="GOA:Q3UZ45"
FT                   /db_xref="InterPro:IPR022786"
FT                   /db_xref="InterPro:IPR029699"
FT                   /db_xref="MGI:MGI:3648807"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3UZ45"
FT                   /protein_id="EDL18399.1"
FT                   /translation="MQACEGSAAGRRAFDSICPNRMLDLSRRTLGKPGKPERKFVPSWK
FT                   SFSGCGGGSPVAVYEDPPDAEPAPLPALTTIDLQDLADCTSLLGTEASPSGDSSASQNP
FT                   SLQTEEDFNLQNFRDAMDDLIADSSSLMSPPLTNSDFPFSPCDVSSFGSCLSPSLDPPA
FT                   LGSPDLPPPPTEQYWKEVADQNQRALGTALIENNQLHVTLTQKQEEIASLRERNVQLKE
FT                   LASRTRHLASVLDKLMITQSPAEPFQIKATTKRSLEELFCAAGQAGQGCAEVDAILRDI
FT                   SQRCEEALHNRDPKRPRLQPEPDSKDCSSRNLHGAFRGLRTDCSASSVNLSHSELEEGG
FT                   SFSTPIRSHSTIRTLAFPQGKAFTIRTVTGGYKFRWVPS"
FT   assembly_gap    9349212..9349312
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    9354562..9354923
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    9357701..9358217
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    9363668..9363687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9365561..9365580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9367530..9367549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9387433..>9391068)
FT                   /gene="2310016C16Rik"
FT                   /locus_tag="mCG_11414"
FT                   /note="gene_id=mCG11414.2"
FT   mRNA            complement(join(9387433..9387979,9390092..9390353,
FT                   9390832..>9391068))
FT                   /gene="2310016C16Rik"
FT                   /locus_tag="mCG_11414"
FT                   /product="RIKEN cDNA 2310016C16"
FT                   /note="gene_id=mCG11414.2 transcript_id=mCT11621.2 created
FT                   on 20-NOV-2002"
FT   CDS             complement(join(9387816..9387979,9390092..9390353,
FT                   9390832..>9391068))
FT                   /codon_start=1
FT                   /gene="2310016C16Rik"
FT                   /locus_tag="mCG_11414"
FT                   /product="RIKEN cDNA 2310016C16"
FT                   /note="gene_id=mCG11414.2 transcript_id=mCT11621.2
FT                   protein_id=mCP16945.2"
FT                   /protein_id="EDL18398.1"
FT                   /translation="SSLLRLPGSSKMEPFAAYPLKCSGPKAKIFAVLLSMVLCTVMLFL
FT                   LQLKFLKPRTNSFYSFEVKDAKGRTVSLEKFKGKASLVVNVASDCRFTDKSYQTLRELH
FT                   KEFGPYHFNVLAFPCNQFGESEPKSSKEVESFARQNYGVTFPIFHKIKILGPEAEPAFR
FT                   FIVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPLEAIRPHVSQMIGQIILKKKEDL"
FT   assembly_gap    9411734..9412636
FT                   /estimated_length=903
FT                   /gap_type="unknown"
FT   assembly_gap    9420984..9421059
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   gene            9422441..>9428488
FT                   /locus_tag="mCG_118708"
FT                   /note="gene_id=mCG118708.1"
FT   mRNA            join(9422441..9423127,9424217..9424311,9425542..9425767,
FT                   9427691..9427816,9428388..>9428488)
FT                   /locus_tag="mCG_118708"
FT                   /product="mCG118708"
FT                   /note="gene_id=mCG118708.1 transcript_id=mCT119867.1
FT                   created on 12-FEB-2003"
FT   CDS             join(9422903..9423127,9424217..9424311,9425542..9425767,
FT                   9427691..9427816,9428388..>9428488)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118708"
FT                   /product="mCG118708"
FT                   /note="gene_id=mCG118708.1 transcript_id=mCT119867.1
FT                   protein_id=mCP83993.1"
FT                   /protein_id="EDL18397.1"
FT                   /translation="MLISVCFLIDLNTLDWSSQNLVAVALGTSVYIWNGQNHSWIENID
FT                   LSVCCHYVSSVTWMREGSCLAVGTSEGEVQLWDAITKKQLRNLHGHLSVVGALSWNHCT
FT                   LSSGSRLGRVHHHDVRVAQHRVGTLYHKEAVCSLKWSPDGRLLSSGCNDGLLTIWPHDP
FT                   GAGVQGLPLKVIPQSTAVKAMEWCPWQSEVLAVGGGVKDGCLHVLDINTGKNIQTPSTQ
FT                   SQICSLIWLPKTKEIVTGQGAPKNDVALWTCPTLF"
FT   assembly_gap    9424648..9424893
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    9425828..9426172
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    9427955..9428058
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    9429082..9429476
FT                   /estimated_length=395
FT                   /gap_type="unknown"
FT   assembly_gap    9431075..9432280
FT                   /estimated_length=1206
FT                   /gap_type="unknown"
FT   assembly_gap    9435962..9435981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<9435982..>9448319)
FT                   /gene="Gzma"
FT                   /locus_tag="mCG_4516"
FT                   /note="gene_id=mCG4516.2"
FT   mRNA            complement(join(<9435982..9436049,9436232..9436370,
FT                   9445577..9445721,9448218..>9448319))
FT                   /gene="Gzma"
FT                   /locus_tag="mCG_4516"
FT                   /product="granzyme A, transcript variant mCT175622"
FT                   /note="gene_id=mCG4516.2 transcript_id=mCT175622.0 created
FT                   on 13-NOV-2002"
FT   CDS             complement(join(<9435982..9436049,9436232..9436370,
FT                   9445577..9445721,9448218..>9448308))
FT                   /codon_start=1
FT                   /gene="Gzma"
FT                   /locus_tag="mCG_4516"
FT                   /product="granzyme A, isoform CRA_a"
FT                   /note="gene_id=mCG4516.2 transcript_id=mCT175622.0
FT                   protein_id=mCP98544.0 isoform=CRA_a"
FT                   /protein_id="EDL18394.1"
FT                   /translation="DWGGRATMRNASGPRGPSLATLLFLLLIPEGGCERIIGGDTVVPH
FT                   SRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVK
FT                   KAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDV"
FT   mRNA            complement(join(9436232..9436370,9441131..9441356,
FT                   9443057..9443327,9445577..9445721,9448218..>9448319))
FT                   /gene="Gzma"
FT                   /locus_tag="mCG_4516"
FT                   /product="granzyme A, transcript variant mCT3476"
FT                   /note="gene_id=mCG4516.2 transcript_id=mCT3476.2 created on
FT                   13-NOV-2002"
FT   mRNA            complement(join(9436232..9436370,9441131..9441356,
FT                   9443057..9443327,9445577..9445721,9447909..9448034,
FT                   9448218..9448319))
FT                   /gene="Gzma"
FT                   /locus_tag="mCG_4516"
FT                   /product="granzyme A, transcript variant mCT175623"
FT                   /note="gene_id=mCG4516.2 transcript_id=mCT175623.0 created
FT                   on 13-NOV-2002"
FT   assembly_gap    9438407..9438426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(9441198..9441356,9443057..9443327,
FT                   9445577..9445721,9448218..>9448317))
FT                   /codon_start=1
FT                   /gene="Gzma"
FT                   /locus_tag="mCG_4516"
FT                   /product="granzyme A, isoform CRA_b"
FT                   /note="gene_id=mCG4516.2 transcript_id=mCT3476.2
FT                   protein_id=mCP18709.2 isoform=CRA_b"
FT                   /protein_id="EDL18395.1"
FT                   /translation="IPADWGGRATMRNASGPRGPSLATLLFLLLIPEGGCERIIGGDTV
FT                   VPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVLKKKATVNRNVAILHLPKKGDD
FT                   VKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGD
FT                   LRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKG
FT                   SV"
FT   CDS             complement(join(9441198..9441356,9443057..9443327,
FT                   9445577..9445721,9447909..9447969))
FT                   /codon_start=1
FT                   /gene="Gzma"
FT                   /locus_tag="mCG_4516"
FT                   /product="granzyme A, isoform CRA_c"
FT                   /note="gene_id=mCG4516.2 transcript_id=mCT175623.0
FT                   protein_id=mCP98545.0 isoform=CRA_c"
FT                   /protein_id="EDL18396.1"
FT                   /translation="MSKEMNEILLSWEINLSSKRGGCERIIGGDTVVPHSRPYMALLKL
FT                   SSNTICAGALIEKNWVLTAAHCNVLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWG
FT                   RFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSG
FT                   SPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV"
FT   assembly_gap    9443464..9443814
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    9450617..9450664
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    9455162..9455280
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    9474670..9474750
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   gene            <9483428..9491350
FT                   /locus_tag="mCG_145968"
FT                   /note="gene_id=mCG145968.0"
FT   mRNA            join(<9483428..9483614,9483992..9484097,9491200..9491350)
FT                   /locus_tag="mCG_145968"
FT                   /product="mCG145968"
FT                   /note="gene_id=mCG145968.0 transcript_id=mCT186076.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<9483521..9483614,9483992..9484097,9491200..9491257)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145968"
FT                   /product="mCG145968"
FT                   /note="gene_id=mCG145968.0 transcript_id=mCT186076.0
FT                   protein_id=mCP107788.0"
FT                   /protein_id="EDL18393.1"
FT                   /translation="QPSGPDGKGHGLMETARKRIHSAQEIEELETVIIEEKNSEVPPSM
FT                   PSSVPRDQELEPKMTHLCSPIRNLPELTPSCDLREFPLKG"
FT   assembly_gap    9488509..9488528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9497125..9497574)
FT                   /pseudo
FT                   /locus_tag="mCG_1032957"
FT                   /note="gene_id=mCG1032957.1"
FT   mRNA            complement(9497125..9497574)
FT                   /pseudo
FT                   /locus_tag="mCG_1032957"
FT                   /note="gene_id=mCG1032957.1 transcript_id=mCT150661.1
FT                   created on 12-FEB-2003"
FT   assembly_gap    9508108..9508264
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   gene            complement(9517652..9526768)
FT                   /gene="Gzmk"
FT                   /locus_tag="mCG_5167"
FT                   /note="gene_id=mCG5167.2"
FT   mRNA            complement(join(9517652..9518079,9518929..9519198,
FT                   9519968..9520118,9526303..9526450,9526705..9526768))
FT                   /gene="Gzmk"
FT                   /locus_tag="mCG_5167"
FT                   /product="granzyme K"
FT                   /note="gene_id=mCG5167.2 transcript_id=mCT4695.2 created on
FT                   19-SEP-2002"
FT   CDS             complement(join(9517918..9518079,9518929..9519198,
FT                   9519968..9520118,9526303..9526450,9526705..9526765))
FT                   /codon_start=1
FT                   /gene="Gzmk"
FT                   /locus_tag="mCG_5167"
FT                   /product="granzyme K"
FT                   /note="gene_id=mCG5167.2 transcript_id=mCT4695.2
FT                   protein_id=mCP16478.0"
FT                   /protein_id="EDL18392.1"
FT                   /translation="MRFSSWALVSLVAGVYMSSECFHTEIIGGREVQPHSRPFMASIQY
FT                   RSKHICGGVLIHPQWVLTAAHCYSWFPRGHSPTVVLGAHSLSKNEPMKQTFEIKKFIPF
FT                   SRLQSGSASHDIMLIKLRTAAELNKNVQLLHLGSKNYLRDGTKCQVTGWGTTKPDLLTA
FT                   SDTLREVTVTIISRKRCNSQSYYNHKPVITKDMICAGDARGQKDSCKGDSGGPLICKGI
FT                   FHALVSQGYKCGIAKKPGIYTLLTKKYQTWIKSKLAPSRAH"
FT   assembly_gap    9522267..9522286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9532105..9533271
FT                   /estimated_length=1167
FT                   /gap_type="unknown"
FT   assembly_gap    9545410..9545429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9549843..9550327
FT                   /estimated_length=485
FT                   /gap_type="unknown"
FT   gene            9556266..9564503
FT                   /gene="Esm1"
FT                   /locus_tag="mCG_5168"
FT                   /note="gene_id=mCG5168.2"
FT   mRNA            join(9556266..9556740,9559980..9560132,9563018..9564503)
FT                   /gene="Esm1"
FT                   /locus_tag="mCG_5168"
FT                   /product="endothelial cell-specific molecule 1"
FT                   /note="gene_id=mCG5168.2 transcript_id=mCT4692.2 created on
FT                   13-NOV-2002"
FT   CDS             join(9556440..9556740,9559980..9560132,9563018..9563118)
FT                   /codon_start=1
FT                   /gene="Esm1"
FT                   /locus_tag="mCG_5168"
FT                   /product="endothelial cell-specific molecule 1"
FT                   /note="gene_id=mCG5168.2 transcript_id=mCT4692.2
FT                   protein_id=mCP16479.1"
FT                   /db_xref="GOA:B9EJX9"
FT                   /db_xref="InterPro:IPR000867"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="MGI:MGI:1918940"
FT                   /db_xref="UniProtKB/TrEMBL:B9EJX9"
FT                   /protein_id="EDL18391.1"
FT                   /translation="MKSLLLLTTLLVPLHLGMAWSAKYAVDCPEHCDKTECRSSLRCKR
FT                   TVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPY
FT                   GTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAV
FT                   REEIGEGNAARPSVMKWLNPR"
FT   assembly_gap    9561943..9561962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9568353..9569041
FT                   /estimated_length=689
FT                   /gap_type="unknown"
FT   assembly_gap    9569905..9571017
FT                   /estimated_length=1113
FT                   /gap_type="unknown"
FT   assembly_gap    9571790..9571820
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    9577310..9577329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9581949..9581968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9587866..9588060
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    9596958..9596977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9598313..9598332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9614402..9616020
FT                   /estimated_length=1619
FT                   /gap_type="unknown"
FT   assembly_gap    9636433..9639867
FT                   /estimated_length=3435
FT                   /gap_type="unknown"
FT   assembly_gap    9645105..9645124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9646665..9646684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9647990..9648009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9650333..9651355
FT                   /estimated_length=1023
FT                   /gap_type="unknown"
FT   assembly_gap    9652556..9652575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9653258..9653628
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   gene            <9658440..9720645
FT                   /locus_tag="mCG_118705"
FT                   /note="gene_id=mCG118705.1"
FT   mRNA            join(<9658440..9658603,9659021..9662575,9664091..9664561,
FT                   9668889..9669065,9683679..9683877,9687388..9687519,
FT                   9692554..9692723,9707020..9707203,9720334..9720645)
FT                   /locus_tag="mCG_118705"
FT                   /product="mCG118705"
FT                   /note="gene_id=mCG118705.1 transcript_id=mCT119864.1
FT                   created on 12-FEB-2003"
FT   CDS             join(<9658442..9658603,9659021..9662575,9664091..9664561,
FT                   9668889..9669065,9683679..9683877,9687388..9687519,
FT                   9692554..9692723,9707020..9707203,9720334..9720461)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118705"
FT                   /product="mCG118705"
FT                   /note="gene_id=mCG118705.1 transcript_id=mCT119864.1
FT                   protein_id=mCP83899.1"
FT                   /protein_id="EDL18390.1"
FT                   /translation="SFYGESYVGLSTTEVFPELSLQLRFQTSKPQGLLFLAAGKTDYCL
FT                   IELLSGILQVKINMGTGQEILLSEQRLRVDDLAWHSLELRYGKDAVLLVIDKHFETTVR
FT                   LAGGLRNFTFHHGIYIGGRGGLSVPYLDRKIPNFRGCMEDVAFNQREILTSLRSYPGFK
FT                   KVSEVSLGCNDEFFAGKDEAISFFSSRSYVTFPEWKVHGEGFLRFAVQTGTLQALLLFQ
FT                   SGRGRDFVALEIHEGLLKAHVGRGGTKTQLSSFSLVSDNKWHVVQLKVTGRHVDIMVDE
FT                   HRERAGLPLQSQAFVSEGPLFMGGLDDRMWETVRGLEVVSMPGKSVRGMSLKGCLRALE
FT                   ANLEKRALRDALVSRDISAGCTSEGLRGTDPSVAGEDLFPPEPSSPTTIPSSPLKIQSG
FT                   SFLVLNKLEVQEGGRALLGQRHIEVDVDFMDLGINSSQILFKIQEMPAHGFLQIDAWPA
FT                   QEMERTFTLSDLRHGKVWYVHDGSEEPTDSFTFWAFSSSKQALLSQLQAPVPHVFNITV
FT                   LPVNDPPYLKLPEGHLLLFENTKQRLTPRVIQVLDPDTDSRRLRFSVLNNFNSEAGFLE
FT                   NAREPGRAITGFTDMDLQDGNIFYVHRGPRNSRVALRATDGELVSNTVVLRVMAVPWDF
FT                   EVADRTGVVVPQGGTILITRNNLSVKVNGGQHELDTLYDITHPPQFGQIQHRGSNGEWK
FT                   PVRTFSQRSIDQSQIRYYSSFKGLQQENVTDHFKFRVNIEGRVGRELLFPVTVQWLQLT
FT                   LLKNIPLEISNANKKVLDSGHLQAAAGSVAAPERGLHFKLLIPPKRGRLLLGNKVLKSG
FT                   SMFSQKNIADSKVSYEPQGMPGQDSQDSFSFSIVVKQVESKDHTFRIDLKADKTHVTIT
FT                   NTGLYVKEGERTIITKSELFVQTLDNHVFQYKVTKSPQHGELKLVSSSASLGSDNRATG
FT                   FTDEDIVSGRLVYVHDDSEAQWDEFILLASATGLGQQGGVRSLDSEHTSTEIKVSVSVE
FT                   LKNDEKPVRVVDKIFHVVRDSQRLLTLADLCYHDPDIDFDDGQLLYTRHGIPNGDLVKA
FT                   ADPIRKLYQFRQEDLREGRVLFRHHGPDFARFLIFVTDGVHYTSSLFEVSVSEAYVRIV
FT                   NNTGMLVHRGRDSFLTTANLSVTTNQDVRTDHEFEFHIVQPPKHGRLLVNNSTFHSFSQ
FT                   HDLKQGRVIYRYDGDGNLDIFNLTVKVKDAYLDVSIRVQVSLEGRQRSTPILHSRSLIV
FT                   EEGKPVKLSRGKLQAGNEEDIPSEAVFTVRTPPVHGYLQISTAEDGIAGADVMPTLNFT
FT                   QQDVDDGHVLYVQTAPGQQKDQFTLDVTKDSRVIRRVEVLLEPIPKWIPLKVQNLTVQE
FT                   GGSKVLLQDHLQIASKYLEGLDCEFILLEPPKHGYVESSKFPRVKLMKFSRREVAQELI
FT                   YYVHDGSEEFLDSLTILANSSELGKQSPPQTLFVTVESVNDEAPVVTANNILQVWVNSV
FT                   TEVTRGDLCAGDGDSSPQDLVYWVTPPSNGHLALKSTPGRRIQNFTQAQIDEGQLVFVH
FT                   TGAMSGGFNFQVTDGLNFAPRQIFSITARALIISLEVNRGLSIFPGSTKPLSSHDLRAV
FT                   TNDDKAGNRTVTFTVVRSPRLGRLLKMNPDNRTEDVSTFTQCLVSEGLILYQHVGLEST
FT                   GWASEDSFTLTASSPPAELGPEAFRITISYEVNESGRQSRLRANTVQPSHTVLPRAAPR
FT                   LLECHRQEEQMMVIETVRGPFGPAFHIV"
FT   assembly_gap    9686763..9686807
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    9691582..9691690
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    9692828..9692847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9703551..9703705
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    9736213..9736232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9754740..9754886
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   gene            complement(9787301..9843064)
FT                   /locus_tag="mCG_5170"
FT                   /note="gene_id=mCG5170.2"
FT   mRNA            complement(join(9787301..9787804,9791879..9792228,
FT                   9804772..9805260,9805990..9806769,9824766..9824903,
FT                   9825986..9826152,9842923..9843064))
FT                   /locus_tag="mCG_5170"
FT                   /product="mCG5170"
FT                   /note="gene_id=mCG5170.2 transcript_id=mCT4689.2 created on
FT                   20-NOV-2002"
FT   assembly_gap    9794442..9794754
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    9797156..9797443
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    9798185..9798429
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   CDS             complement(9804958..9805176)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5170"
FT                   /product="mCG5170"
FT                   /note="gene_id=mCG5170.2 transcript_id=mCT4689.2
FT                   protein_id=mCP16474.2"
FT                   /protein_id="EDL18389.1"
FT                   /translation="MCSEKDGASWMESLRSGGCPRSQSTLGEAASITYTHALGGISAVP
FT                   KVPLNLKTMRKQVSGTHHLAKHDSVWP"
FT   gene            complement(9820142..9820553)
FT                   /pseudo
FT                   /locus_tag="mCG_5171"
FT                   /note="gene_id=mCG5171.2"
FT   mRNA            complement(9820142..9820553)
FT                   /pseudo
FT                   /locus_tag="mCG_5171"
FT                   /note="gene_id=mCG5171.2 transcript_id=mCT4690.2 created on
FT                   20-NOV-2002"
FT   gene            complement(9869266..>9903650)
FT                   /locus_tag="mCG_145293"
FT                   /note="gene_id=mCG145293.0"
FT   mRNA            complement(join(9869266..9871130,9872236..9872464,
FT                   9874885..9874976,9875100..9875221,9879428..9879586,
FT                   9903576..>9903650))
FT                   /locus_tag="mCG_145293"
FT                   /product="mCG145293"
FT                   /note="gene_id=mCG145293.0 transcript_id=mCT184717.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(9870659..>9870985)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145293"
FT                   /product="mCG145293"
FT                   /note="gene_id=mCG145293.0 transcript_id=mCT184717.0
FT                   protein_id=mCP106328.0"
FT                   /protein_id="EDL18388.1"
FT                   /translation="FTTLGDILKRFFFLHNLKANVSALNCKCILLWPEIHGYFSYFLGC
FT                   SISCFIDQRDHPCPHRNCKVFVVIGSNNLKQVEEFLLIFFWEVPLSGGKQKTKPLSELD
FT                   SYTL"
FT   assembly_gap    9907277..9907296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9928430..>9954802)
FT                   /gene="Snag1"
FT                   /locus_tag="mCG_5169"
FT                   /note="gene_id=mCG5169.1"
FT   mRNA            complement(join(9928430..9931106,9953045..>9954802))
FT                   /gene="Snag1"
FT                   /locus_tag="mCG_5169"
FT                   /product="sorting nexin associated golgi protein 1"
FT                   /note="gene_id=mCG5169.1 transcript_id=mCT4688.1 created on
FT                   13-NOV-2002"
FT   CDS             complement(join(9930853..9931106,9953045..>9954800))
FT                   /codon_start=1
FT                   /gene="Snag1"
FT                   /locus_tag="mCG_5169"
FT                   /product="sorting nexin associated golgi protein 1"
FT                   /note="gene_id=mCG5169.1 transcript_id=mCT4688.1
FT                   protein_id=mCP16473.1"
FT                   /protein_id="EDL18387.1"
FT                   /translation="QSLLRAEPSCTEGESGAGSGPVRCPPGFPSAFGGGILTAGALGPA
FT                   RARGAGLGTMALRARALYDFKSENPGEISLREHEVLSLCSEQDIEGWLEGINSRGDRGL
FT                   FPASYVQVIRAPEPGPPADGGPGAPARYANVPPGGFEPLPAAPPAAFPPLLQPQASPGS
FT                   FQPPGAGFPYGGGALQPSPQQLYGGYQASLGSDDDWDDEWDDSSTVADEPGALGSGAYP
FT                   DLDGSSSAGGGAAGRYRLSTRSDLSLGSRGVSAPPAHQASGAKSSATVSRNLNRFSTFV
FT                   KSGGEAFVLGEASGFVKDGDKLCVVLGPYGPEWQENPYPFQCTIDDPTKQTKFKGMKSY
FT                   ISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRK
FT                   GLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLST
FT                   PPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFR
FT                   GLSQAFELDQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLAN
FT                   FPDIIHVQKGALTKVKESRRHVEEGKMEVQKADGIQDRCNTISFATLAEIHHFHQIRVR
FT                   DFKSQMQHFLQQQIIFFQKVTQKLEEALHKYDSV"
FT   assembly_gap    9960339..9960358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9961459..9961478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9964381..9964400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9966511..9966530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9973580..9973599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9981254..9981273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9982426..9990472
FT                   /estimated_length=8047
FT                   /gap_type="unknown"
FT   assembly_gap    9994457..9997636
FT                   /estimated_length=3180
FT                   /gap_type="unknown"
FT   assembly_gap    9999178..9999496
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   gene            complement(10014277..10015040)
FT                   /gene="Hspb3"
FT                   /locus_tag="mCG_21736"
FT                   /note="gene_id=mCG21736.0"
FT   mRNA            complement(10014277..10015040)
FT                   /gene="Hspb3"
FT                   /locus_tag="mCG_21736"
FT                   /product="heat shock protein 3"
FT                   /note="gene_id=mCG21736.0 transcript_id=mCT20371.1 created
FT                   on 13-NOV-2002"
FT   CDS             complement(10014409..10014873)
FT                   /codon_start=1
FT                   /gene="Hspb3"
FT                   /locus_tag="mCG_21736"
FT                   /product="heat shock protein 3"
FT                   /note="gene_id=mCG21736.0 transcript_id=mCT20371.1
FT                   protein_id=mCP22142.2"
FT                   /protein_id="EDL18386.1"
FT                   /translation="MAKIILRHLIETPVRYQEEFEARGLEDCRLDHTLYALPGPTIEDL
FT                   SKARGTGTPQALAEDSASTEKPPGEGKSRFQILLDVVQFLPEDIIIQTFEGWLLIKAQH
FT                   GTRMDEHGFISRSFTRQYKLPDGVETKDLSAILCHDGILVVEVKDSLGTK"
FT   assembly_gap    10017446..10017798
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    10021310..10021378
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    10022587..10022875
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    10025212..10031915
FT                   /estimated_length=6704
FT                   /gap_type="unknown"
FT   assembly_gap    10033505..10033524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10036097..10036116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10038109..10038128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10040234..10040253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10041957..10048273
FT                   /estimated_length=6317
FT                   /gap_type="unknown"
FT   assembly_gap    10067896..10074160
FT                   /estimated_length=6265
FT                   /gap_type="unknown"
FT   assembly_gap    10075460..10079528
FT                   /estimated_length=4069
FT                   /gap_type="unknown"
FT   assembly_gap    10080796..10080815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10093080..10094109
FT                   /estimated_length=1030
FT                   /gap_type="unknown"
FT   assembly_gap    10121800..10121940
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    10125915..10126776
FT                   /estimated_length=862
FT                   /gap_type="unknown"
FT   assembly_gap    10137717..10138828
FT                   /estimated_length=1112
FT                   /gap_type="unknown"
FT   gene            <10143343..10510531
FT                   /gene="Arl15"
FT                   /locus_tag="mCG_21738"
FT                   /note="gene_id=mCG21738.2"
FT   mRNA            join(<10143343..10143481,10277163..10277307,
FT                   10289487..10289546,10324413..10324621,10507792..10510531)
FT                   /gene="Arl15"
FT                   /locus_tag="mCG_21738"
FT                   /product="ADP-ribosylation factor-like 15, transcript
FT                   variant mCT179403"
FT                   /note="gene_id=mCG21738.2 transcript_id=mCT179403.0 created
FT                   on 07-FEB-2003"
FT   CDS             join(<10143344..10143481,10277163..10277307,
FT                   10289487..10289546,10324413..10324621,10507792..10507944)
FT                   /codon_start=1
FT                   /gene="Arl15"
FT                   /locus_tag="mCG_21738"
FT                   /product="ADP-ribosylation factor-like 15, isoform CRA_a"
FT                   /note="gene_id=mCG21738.2 transcript_id=mCT179403.0
FT                   protein_id=mCP102325.0 isoform=CRA_a"
FT                   /protein_id="EDL18382.1"
FT                   /translation="FQELLAGSPRRCCFFFFSGFGAIPDALGCRMSDLRITEAFLYMDY
FT                   LCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSELCSESPENVVSTTGFSIKAVPFQ
FT                   NAVLNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLETARNELHSALQHPQLC
FT                   TLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDVDTLKDSFSQLIN
FT                   LLEEKDHEAVRM"
FT   mRNA            join(<10143377..10143481,10255898..10256048,
FT                   10277157..10277307,10289487..10289546,10324413..10324622,
FT                   10507792..10509085)
FT                   /gene="Arl15"
FT                   /locus_tag="mCG_21738"
FT                   /product="ADP-ribosylation factor-like 15, transcript
FT                   variant mCT20373"
FT                   /note="gene_id=mCG21738.2 transcript_id=mCT20373.2 created
FT                   on 07-FEB-2003"
FT   mRNA            join(<10143377..10143481,10255898..10256048,
FT                   10277163..10277307,10289487..10289546,10324413..10324621,
FT                   10507792..10509085)
FT                   /gene="Arl15"
FT                   /locus_tag="mCG_21738"
FT                   /product="ADP-ribosylation factor-like 15, transcript
FT                   variant mCT191204"
FT                   /note="gene_id=mCG21738.2 transcript_id=mCT191204.0 created
FT                   on 09-MAR-2004"
FT   assembly_gap    10147437..10147456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10148746..10148765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10150919..10150938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10156360..10156630
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    10163212..10163231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10181140..10181257
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    10192967..10192986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10194264..10194283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10211062..10211081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10213358..10213377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10226681..10226917
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    10233211..10233578
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    10237257..10237386
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    10241229..10241248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10248707..10248726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10250244..10250263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<10255911..10256048,10277163..10277307,
FT                   10289487..10289546,10324413..10324621,10507792..10507944)
FT                   /codon_start=1
FT                   /gene="Arl15"
FT                   /locus_tag="mCG_21738"
FT                   /product="ADP-ribosylation factor-like 15, isoform CRA_b"
FT                   /note="gene_id=mCG21738.2 transcript_id=mCT191204.0
FT                   protein_id=mCP112141.0 isoform=CRA_b"
FT                   /protein_id="EDL18383.1"
FT                   /translation="IGVTIESFFFFHFGGWRIFTQLKTINHLDSMLHLNCDSGRKSRMT
FT                   TCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSELCSESPENVVSTTGFSIKAVPFQ
FT                   NAVLNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLETARNELHSALQHPQLC
FT                   TLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDVDTLKDSFSQLIN
FT                   LLEEKDHEAVRM"
FT   CDS             join(<10255911..10256048,10277157..10277307,
FT                   10289487..10289546,10324413..10324622,10507792..10507808)
FT                   /codon_start=1
FT                   /gene="Arl15"
FT                   /locus_tag="mCG_21738"
FT                   /product="ADP-ribosylation factor-like 15, isoform CRA_c"
FT                   /note="gene_id=mCG21738.2 transcript_id=mCT20373.2
FT                   protein_id=mCP22149.2 isoform=CRA_c"
FT                   /protein_id="EDL18384.1"
FT                   /translation="IGVTIESFFFFHFGGWRIFTQLKTINHLDSMLHLNCDSGRKSRMT
FT                   TWQCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSELCSESPENVVSTTGFSIKAVP
FT                   FQNAVLNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLETARNELHSALQHPQ
FT                   LCTLPFLILANHQDKPAARSVQEDQKVF"
FT   assembly_gap    10286403..10287193
FT                   /estimated_length=791
FT                   /gap_type="unknown"
FT   assembly_gap    10288282..10288704
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   assembly_gap    10306591..10307899
FT                   /estimated_length=1309
FT                   /gap_type="unknown"
FT   assembly_gap    10311033..10311052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10312746..10312765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10318090..10318109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10320617..10320636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10321830..10321849
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10327634..10328013
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    10334265..10334297
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    10355528..10355547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10409694..10409783
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    10421812..10421831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10428204..10428223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10429654..10429673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10434146..10434810
FT                   /estimated_length=665
FT                   /gap_type="unknown"
FT   assembly_gap    10437998..10438074
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    10449431..10449457
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    10463370..10464049
FT                   /estimated_length=680
FT                   /gap_type="unknown"
FT   gene            complement(10477428..>10504439)
FT                   /gene="A430090L17Rik"
FT                   /locus_tag="mCG_60060"
FT                   /note="gene_id=mCG60060.2"
FT   mRNA            complement(join(10477428..10477688,10477813..10477978,
FT                   10478339..10478493,10480451..10480490,10480809..10481328,
FT                   10482986..10484293,10498359..10498584,10499666..10499739,
FT                   10500688..10500880,10501171..10501267,10501365..10501444,
FT                   10502307..10502589,10504365..>10504439))
FT                   /gene="A430090L17Rik"
FT                   /locus_tag="mCG_60060"
FT                   /product="RIKEN cDNA A430090L17"
FT                   /note="gene_id=mCG60060.2 transcript_id=mCT60243.2 created
FT                   on 07-FEB-2003"
FT   assembly_gap    10481576..10481639
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   CDS             complement(join(10498360..10498584,10499666..10499739,
FT                   10500688..10500880,10501171..10501267,10501365..10501444,
FT                   10502307..>10502435))
FT                   /codon_start=1
FT                   /gene="A430090L17Rik"
FT                   /locus_tag="mCG_60060"
FT                   /product="RIKEN cDNA A430090L17"
FT                   /note="gene_id=mCG60060.2 transcript_id=mCT60243.2
FT                   protein_id=mCP42241.2"
FT                   /protein_id="EDL18385.1"
FT                   /translation="ENTLLSVCLLRGLSSSAALITGAPGLNWSPSPESERAVPVRSWHL
FT                   TSATSRRGHPLEEQGSHLSTRLFLSAESRSVDHMPFPSLTPFYNMSGVLLSQQETLEQV
FT                   GTGARGLCTKLLGWFDLIPSDHFCLTWTHTSVGWGICCSQRGQGSSYDVRCGKWSGAGR
FT                   LAVLFCVHTHLVLCPALLLMAESYSRIQNTGALSLQAADKGPALQLSPLHIFSQSHILE
FT                   TVNCSLLAPEELCVLKTKNPRCSPRGTTPWLRKASGFRDSQGS"
FT   assembly_gap    10506110..10506129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10520687..10521636
FT                   /estimated_length=950
FT                   /gap_type="unknown"
FT   assembly_gap    10524287..10524485
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    10544566..10544741
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    10547938..10548152
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    10588264..10588415
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    10609457..10609476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10610613..10613856
FT                   /estimated_length=3244
FT                   /gap_type="unknown"
FT   assembly_gap    10637910..10637929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10647307..>10747899)
FT                   /gene="Ndufs4"
FT                   /locus_tag="mCG_21737"
FT                   /note="gene_id=mCG21737.2"
FT   mRNA            complement(join(10647307..10647749,10666731..10666804,
FT                   10675774..10675946,10710354..10710432,10747775..>10747899))
FT                   /gene="Ndufs4"
FT                   /locus_tag="mCG_21737"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 4"
FT                   /note="gene_id=mCG21737.2 transcript_id=mCT20372.2 created
FT                   on 13-NOV-2002"
FT   CDS             complement(join(10647646..10647749,10666731..10666804,
FT                   10675774..10675946,10710354..10710432,10747775..>10747899))
FT                   /codon_start=1
FT                   /gene="Ndufs4"
FT                   /locus_tag="mCG_21737"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 4"
FT                   /note="gene_id=mCG21737.2 transcript_id=mCT20372.2
FT                   protein_id=mCP22146.1"
FT                   /protein_id="EDL18380.1"
FT                   /translation="RILAFAYRKMAAVSMSVSLRQAMLGRRAMATAAVSVCRVPSRLLS
FT                   TSTWKLADNQTRDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTK
FT                   KWKMEFDTRERWENPLMGWASTADPLSNMVLTFSAKEDAIAFAEKNGWSYDVEEKKVPK
FT                   PKSKSYGANFSWNKRTRVSTK"
FT   gene            <10658649..10662745
FT                   /locus_tag="mCG_145291"
FT                   /note="gene_id=mCG145291.0"
FT   mRNA            join(<10658649..10659190,10659218..10661890,
FT                   10661905..10662711,10662728..10662745)
FT                   /locus_tag="mCG_145291"
FT                   /product="mCG145291"
FT                   /note="gene_id=mCG145291.0 transcript_id=mCT184715.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<10658991..10659190,10659218..10659353)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145291"
FT                   /product="mCG145291"
FT                   /note="gene_id=mCG145291.0 transcript_id=mCT184715.0
FT                   protein_id=mCP106326.0"
FT                   /protein_id="EDL18381.1"
FT                   /translation="SHWLGAVLVVGGGQVPRPWLPMKGSIIFKYTPNIFVPTFLSFLLS
FT                   FSLSLCSLPLSVCLSLFHYLCVVCVCVCVFERWFLHSPGCPGTHYVDQTVFKLTEICLP
FT                   LPPNGRD"
FT   assembly_gap    10662786..10662805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10682891..10682910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10718218..10718237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10722660..10722679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10735858..10736196
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    10737464..10738350
FT                   /estimated_length=887
FT                   /gap_type="unknown"
FT   assembly_gap    10743719..10743738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10746943..10747091
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    10752924..10754008
FT                   /estimated_length=1085
FT                   /gap_type="unknown"
FT   assembly_gap    10772810..10773302
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   assembly_gap    10777272..10777320
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    10787675..10787763
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    10790172..10790234
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    10805228..10805247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10812733..10819540)
FT                   /gene="Fst"
FT                   /locus_tag="mCG_21739"
FT                   /note="gene_id=mCG21739.2"
FT   mRNA            complement(join(10812733..10813974,10814749..10814976,
FT                   10815590..10815814,10816153..10816371,10816832..10817023,
FT                   10819092..10819540))
FT                   /gene="Fst"
FT                   /locus_tag="mCG_21739"
FT                   /product="follistatin, transcript variant mCT20374"
FT                   /note="gene_id=mCG21739.2 transcript_id=mCT20374.2 created
FT                   on 13-NOV-2002"
FT   mRNA            complement(join(10812759..10814274,10814749..10814979,
FT                   10815590..10815814,10816153..10816371,10816832..10817023,
FT                   10819092..>10819320))
FT                   /gene="Fst"
FT                   /locus_tag="mCG_21739"
FT                   /product="follistatin, transcript variant mCT191205"
FT                   /note="gene_id=mCG21739.2 transcript_id=mCT191205.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(10813892..10813974,10814749..10814976,
FT                   10815590..10815814,10816153..10816371,10816832..10817023,
FT                   10819092..10819176))
FT                   /codon_start=1
FT                   /gene="Fst"
FT                   /locus_tag="mCG_21739"
FT                   /product="follistatin, isoform CRA_b"
FT                   /note="gene_id=mCG21739.2 transcript_id=mCT20374.2
FT                   protein_id=mCP22147.2 isoform=CRA_b"
FT                   /protein_id="EDL18379.1"
FT                   /translation="MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVL
FT                   YKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGK
FT                   KCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGK
FT                   CKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRK
FT                   ATCLLGRSIGLAYEGKCITKSCEDIQCGGGKKCLWDSKVGRGRCSLCDELCPDSKSDEP
FT                   VCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSI
FT                   LEW"
FT   CDS             complement(join(10814273..10814274,10814749..10814979,
FT                   10815590..10815814,10816153..10816371,10816832..10817023,
FT                   10819092..>10819308))
FT                   /codon_start=1
FT                   /gene="Fst"
FT                   /locus_tag="mCG_21739"
FT                   /product="follistatin, isoform CRA_a"
FT                   /note="gene_id=mCG21739.2 transcript_id=mCT191205.0
FT                   protein_id=mCP112142.0 isoform=CRA_a"
FT                   /protein_id="EDL18378.1"
FT                   /translation="IARAAGGERGAAPGSLRPPPLASATRAARRSHPPPRSSPRACPRM
FT                   VCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGR
FT                   LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCA
FT                   PDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSST
FT                   CVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEG
FT                   KCIKAKSCEDIQCGGGKKCLWDSKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECA
FT                   MKEAACSSGVLLEVKHSGSCN"
FT   assembly_gap    10817199..10817335
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    10819576..10819740
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    10832752..10832887
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    10848860..10848879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10857402..10857421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10858953..10858972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10860497..10861437
FT                   /estimated_length=941
FT                   /gap_type="unknown"
FT   assembly_gap    10864618..10864799
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    10868166..10868293
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    10870649..10870885
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    10890758..10890797
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    10894194..10895059
FT                   /estimated_length=866
FT                   /gap_type="unknown"
FT   assembly_gap    10899442..10899848
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    10902623..10902642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10903744..10903763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10904795..10904814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10925158..10925177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10926946..10926965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10928395..10928414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10944601..10944620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10945957..10945976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10947844..10947863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10951984..10972885)
FT                   /locus_tag="mCG_147606"
FT                   /note="gene_id=mCG147606.0"
FT   mRNA            complement(join(10951984..10952351,10972720..10972885))
FT                   /locus_tag="mCG_147606"
FT                   /product="mCG147606"
FT                   /note="gene_id=mCG147606.0 transcript_id=mCT187869.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(10952199..10952351,10972720..10972800))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147606"
FT                   /product="mCG147606"
FT                   /note="gene_id=mCG147606.0 transcript_id=mCT187869.0
FT                   protein_id=mCP108830.0"
FT                   /protein_id="EDL18377.1"
FT                   /translation="MLVLPDPYPDSGFQGPNSASEEPTGEETFSLKRLNHSQHSKEVKH
FT                   TMLFAPVSCRAATSKVINPQSNSKGNHDAKLL"
FT   assembly_gap    10954270..10954289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10956494..10956513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10958589..10958608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10973028..11058806
FT                   /gene="4930544M13Rik"
FT                   /locus_tag="mCG_1033034"
FT                   /note="gene_id=mCG1033034.0"
FT   mRNA            join(10973028..10973194,10973849..10974092,
FT                   10975396..10975461,10977709..10977847,11043921..11044034,
FT                   11050736..11050883,11058164..11058523,11058631..11058806)
FT                   /gene="4930544M13Rik"
FT                   /locus_tag="mCG_1033034"
FT                   /product="RIKEN cDNA 4930544M13"
FT                   /note="gene_id=mCG1033034.0 transcript_id=mCT150738.0
FT                   created on 20-NOV-2002"
FT   assembly_gap    10976923..10976942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10983306..10983325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10989729..10989748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11029998..11030017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11037222..11037241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11038484..11038854
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   CDS             join(11050748..11050883,11058164..11058213)
FT                   /codon_start=1
FT                   /gene="4930544M13Rik"
FT                   /locus_tag="mCG_1033034"
FT                   /product="RIKEN cDNA 4930544M13"
FT                   /note="gene_id=mCG1033034.0 transcript_id=mCT150738.0
FT                   protein_id=mCP83878.1"
FT                   /protein_id="EDL18376.1"
FT                   /translation="MTSRKPSTMKIQLYLLPDCRSNMTRCLTFLSPGLPSMMDQAFKLR
FT                   GKKLSLQDCAIIPQIW"
FT   assembly_gap    11085417..11085436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11121711..11128155
FT                   /estimated_length=6445
FT                   /gap_type="unknown"
FT   assembly_gap    11129274..11129293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11130472..11130491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11140279..11140298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11174273..11174292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11177582..11183221
FT                   /estimated_length=5640
FT                   /gap_type="unknown"
FT   gene            11188596..11199508
FT                   /gene="Mocs2"
FT                   /locus_tag="mCG_2840"
FT                   /note="gene_id=mCG2840.2"
FT   mRNA            join(11188596..11188662,11189675..11189796,
FT                   11191141..11191285,11194906..11195033,11195550..11195700,
FT                   11196501..11196624,11198627..11199508)
FT                   /gene="Mocs2"
FT                   /locus_tag="mCG_2840"
FT                   /product="molybdenum cofactor synthesis 2, transcript
FT                   variant mCT175619"
FT                   /note="gene_id=mCG2840.2 transcript_id=mCT175619.0 created
FT                   on 13-NOV-2002"
FT   mRNA            join(11188596..11188662,11189675..11189796,
FT                   11191141..11191285,11194906..11195033,11195550..11195700,
FT                   11196501..11196624,11198816..11199508)
FT                   /gene="Mocs2"
FT                   /locus_tag="mCG_2840"
FT                   /product="molybdenum cofactor synthesis 2, transcript
FT                   variant mCT2156"
FT                   /note="gene_id=mCG2840.2 transcript_id=mCT2156.2 created on
FT                   13-NOV-2002"
FT   mRNA            join(11188596..11188662,11189675..11189796,
FT                   11191141..11191285,11198840..11199508)
FT                   /gene="Mocs2"
FT                   /locus_tag="mCG_2840"
FT                   /product="molybdenum cofactor synthesis 2, transcript
FT                   variant mCT175621"
FT                   /note="gene_id=mCG2840.2 transcript_id=mCT175621.0 created
FT                   on 13-NOV-2002"
FT   mRNA            join(11188596..11188662,11191141..11191285,
FT                   11194906..11195033,11195550..11195700,11196501..11196624,
FT                   11198627..11199508)
FT                   /gene="Mocs2"
FT                   /locus_tag="mCG_2840"
FT                   /product="molybdenum cofactor synthesis 2, transcript
FT                   variant mCT175620"
FT                   /note="gene_id=mCG2840.2 transcript_id=mCT175620.0 created
FT                   on 13-NOV-2002"
FT   mRNA            join(<11188608..11188662,11191141..11191285,
FT                   11194906..11195033,11195550..11196624,11198627..11199344)
FT                   /gene="Mocs2"
FT                   /locus_tag="mCG_2840"
FT                   /product="molybdenum cofactor synthesis 2, transcript
FT                   variant mCT191190"
FT                   /note="gene_id=mCG2840.2 transcript_id=mCT191190.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<11191167..11191285,11194906..11195033,
FT                   11195550..11195704)
FT                   /codon_start=1
FT                   /gene="Mocs2"
FT                   /locus_tag="mCG_2840"
FT                   /product="molybdenum cofactor synthesis 2, isoform CRA_b"
FT                   /note="gene_id=mCG2840.2 transcript_id=mCT191190.0
FT                   protein_id=mCP112147.0 isoform=CRA_b"
FT                   /protein_id="EDL18373.1"
FT                   /translation="YLLFVKSMSSLEISNSCFSPETRSPSSRQSVEDNASEPSGKDVDD
FT                   VQEKPKDIIQFTAEKLSVGEVSQLVVSPLCGAVSLFVGTTRNNFEGKKVISLEYEAYVP
FT                   MAENEIRKICNDIRQKWPVRHIAVFHRLG"
FT   CDS             join(11191188..11191285,11198840..11198852)
FT                   /codon_start=1
FT                   /gene="Mocs2"
FT                   /locus_tag="mCG_2840"
FT                   /product="molybdenum cofactor synthesis 2, isoform CRA_d"
FT                   /note="gene_id=mCG2840.2 transcript_id=mCT175621.0
FT                   protein_id=mCP98543.0 isoform=CRA_d"
FT                   /protein_id="EDL18375.1"
FT                   /translation="MSSLEISNSCFSPETRSPSSRQSVEDNASEPSGCLQ"
FT   CDS             join(11191188..11191285,11194906..11195033,
FT                   11195550..11195700,11196501..11196624,11198816..11198827)
FT                   /codon_start=1
FT                   /gene="Mocs2"
FT                   /locus_tag="mCG_2840"
FT                   /product="molybdenum cofactor synthesis 2, isoform CRA_c"
FT                   /note="gene_id=mCG2840.2 transcript_id=mCT2156.2
FT                   protein_id=mCP22143.2 isoform=CRA_c"
FT                   /protein_id="EDL18374.1"
FT                   /translation="MSSLEISNSCFSPETRSPSSRQSVEDNASEPSGKDVDDVQEKPKD
FT                   IIQFTAEKLSVGEVSQLVVSPLCGAVSLFVGTTRNNFEGKKVISLEYEAYVPMAENEIR
FT                   KICNDIRQKWPVRHIAVFHRLGLVPVSEASTVIAVSSAHRAASLEAVSYAIDSLKAKVP
FT                   IWKKGLT"
FT   CDS             join(11191188..11191285,11194906..11195033,
FT                   11195550..11195700,11196501..11196624,11198627..11198695)
FT                   /codon_start=1
FT                   /gene="Mocs2"
FT                   /locus_tag="mCG_2840"
FT                   /product="molybdenum cofactor synthesis 2, isoform CRA_a"
FT                   /note="gene_id=mCG2840.2 transcript_id=mCT175619.0
FT                   protein_id=mCP98541.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9Z223"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR028888"
FT                   /db_xref="MGI:MGI:1336894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z223"
FT                   /protein_id="EDL18371.1"
FT                   /translation="MSSLEISNSCFSPETRSPSSRQSVEDNASEPSGKDVDDVQEKPKD
FT                   IIQFTAEKLSVGEVSQLVVSPLCGAVSLFVGTTRNNFEGKKVISLEYEAYVPMAENEIR
FT                   KICNDIRQKWPVRHIAVFHRLGLVPVSEASTVIAVSSAHRAASLEAVSYAIDSLKAKVP
FT                   IWKKEIYEESTSSWKRNKECFWAAGD"
FT   CDS             join(11191188..11191285,11194906..11195033,
FT                   11195550..11195700,11196501..11196624,11198627..11198695)
FT                   /codon_start=1
FT                   /gene="Mocs2"
FT                   /locus_tag="mCG_2840"
FT                   /product="molybdenum cofactor synthesis 2, isoform CRA_a"
FT                   /note="gene_id=mCG2840.2 transcript_id=mCT175620.0
FT                   protein_id=mCP98542.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9Z223"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR028888"
FT                   /db_xref="MGI:MGI:1336894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z223"
FT                   /protein_id="EDL18372.1"
FT                   /translation="MSSLEISNSCFSPETRSPSSRQSVEDNASEPSGKDVDDVQEKPKD
FT                   IIQFTAEKLSVGEVSQLVVSPLCGAVSLFVGTTRNNFEGKKVISLEYEAYVPMAENEIR
FT                   KICNDIRQKWPVRHIAVFHRLGLVPVSEASTVIAVSSAHRAASLEAVSYAIDSLKAKVP
FT                   IWKKEIYEESTSSWKRNKECFWAAGD"
FT   gene            complement(11206166..11306514)
FT                   /gene="Itga2"
FT                   /locus_tag="mCG_2841"
FT                   /note="gene_id=mCG2841.2"
FT   mRNA            complement(join(11206166..11206903,11207428..11207544,
FT                   11209831..11209920,11215555..11215668,11220397..11220501,
FT                   11222481..11222591,11223856..11223958,11228102..11228185,
FT                   11228272..11228348,11228820..11228912,11230533..11230674,
FT                   11231060..11231142,11231681..11231791,11233929..11234080,
FT                   11236676..11236815,11239713..11239849,11240558..11240761,
FT                   11242604..11242747,11243596..11243741,11244890..11245028,
FT                   11247656..11247732,11249460..11249625,11249861..11250011,
FT                   11252023..11252171,11254950..11255077,11255332..11255446,
FT                   11258832..11258923,11260976..11261085,11274832..11274949,
FT                   11306338..11306514))
FT                   /gene="Itga2"
FT                   /locus_tag="mCG_2841"
FT                   /product="integrin alpha 2"
FT                   /note="gene_id=mCG2841.2 transcript_id=mCT2153.2 created on
FT                   13-NOV-2002"
FT   CDS             complement(join(11206823..11206903,11207428..11207544,
FT                   11209831..11209920,11215555..11215668,11220397..11220501,
FT                   11222481..11222591,11223856..11223958,11228102..11228185,
FT                   11228272..11228348,11228820..11228912,11230533..11230674,
FT                   11231060..11231142,11231681..11231791,11233929..11234080,
FT                   11236676..11236815,11239713..11239849,11240558..11240761,
FT                   11242604..11242747,11243596..11243741,11244890..11245028,
FT                   11247656..11247732,11249460..11249625,11249861..11250011,
FT                   11252023..11252171,11254950..11255077,11255332..11255446,
FT                   11258832..11258923,11260976..11261085,11274832..11274949,
FT                   11306338..11306395))
FT                   /codon_start=1
FT                   /gene="Itga2"
FT                   /locus_tag="mCG_2841"
FT                   /product="integrin alpha 2"
FT                   /note="gene_id=mCG2841.2 transcript_id=mCT2153.2
FT                   protein_id=mCP22144.2"
FT                   /db_xref="GOA:Q62469"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR013649"
FT                   /db_xref="InterPro:IPR018184"
FT                   /db_xref="MGI:MGI:96600"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62469"
FT                   /protein_id="EDL18370.1"
FT                   /translation="MGPGQAGGALLLRLLMLVQGILNCLAYNVGLPGAKIFSGPSSEQF
FT                   GYSVQQLTNPQGNWLLVGSPWSGFPENRMGDVYKCPVDLPTATCEKLNLQNSASISNVT
FT                   EIKTNMSLGLTLTRNPGTGGFLTCGPLWAHQCGNQYYATGICSDVSPDFQFLTSFSPAV
FT                   QACPSLVDVVVVCDESNSIYPWEAVKNFLVKFVTGLDIGPKKTQVALIQYANEPRIIFN
FT                   LNDFETKEDMVQATSETRQHGGDLTNTFRAIEFARDYAYSQTSGGRPGATKVMVVVTDG
FT                   ESHDGSKLKTVIQQCNDDEILRFGIAVLGYLNRNALDTKNLIKEIKAIASTPTERYFFN
FT                   VADEAALLEKAGTLGEQIFSIEGTVQGGDNFQMEMAQVGFSADYAPQNDILMLGAVGAF
FT                   DWSGTLVQETSHKPVIFPKQAFDQVLQDRNHSSFLGYSVAAISTEDGVHFVAGAPRANY
FT                   TGQIVLYSVNKQGNVTVIQSHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPTYMNDL
FT                   KKEEGKVYLFTITKGILNQHQFLEGPEGTGNARFGSAIAALSDINMDGFNDVIVGSPVE
FT                   NENSGAVYIYNGHQGTIRTKYSQKILGSNGAFRRHLQFFGRSLDGYGDLNGDSITDVSI
FT                   GALGQVIQLWSQSIADVAIEALFTPDKITLLNKDAKITLKLCFRAEFRPAGQNNQVAIL
FT                   FNMTLDADGHSSRVTSRGVFRENSERFLQKNMVVNEVQKCSEHHISIQKPSDVVNPLDL
FT                   RVDISLENPGTSPALEAYSETVKVFSIPFYKECGSDGICISDLILDVQQLPAIQTQSFI
FT                   VSNQNKRLTFSVILKNRGESAYNTVVLAEFSENLFFASFSMPVDGTEVTCEVGSSQKSV
FT                   TCDVGYPALKSEQQVTFTINFDFNLQNLQNQAAINFQAFSESQETNKADNSVSLTIPLL
FT                   YDAELHLTRSTNINFYEISSDENAPSVIKSVEDIGPKFIFSLKVTAGSAPVSMALVTIH
FT                   IPQYTKEKNPLLYLTGIQTDQAGDISCTAEINPLKLPHTAPSVSFKNENFRHTKELDCR
FT                   TTSCSNITCWLKDLHMKAEYFINVTTRVWNRTFAASTFQTVQLTAAAEIDTHNPQLFVI
FT                   EENAVTIPLMIMKPTEKAEVPTGVIIGSIIAGILLLLAMTAGLWKLGFFKRQYKKMGQN
FT                   PDEMDETTELNS"
FT   assembly_gap    11215240..11215259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11216495..11216514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11217906..11218551
FT                   /estimated_length=646
FT                   /gap_type="unknown"
FT   assembly_gap    11297223..11297355
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    11317182..11317713
FT                   /estimated_length=532
FT                   /gap_type="unknown"
FT   gene            complement(11335072..11489446)
FT                   /locus_tag="mCG_2843"
FT                   /note="gene_id=mCG2843.2"
FT   mRNA            complement(join(11335072..11337309,11342773..11342889,
FT                   11343691..11343783,11345399..11345503,11345652..11345756,
FT                   11347674..11347787,11351288..11351390,11352767..11352856,
FT                   11354769..11354845,11357942..11358022,11359856..11360065,
FT                   11362205..11362284,11363226..11363399,11364736..11364902,
FT                   11367184..11367314,11369240..11369497,11370737..11370880,
FT                   11373864..11374006,11378495..11378639,11379206..11379279,
FT                   11383799..11383964,11389037..11389187,11392998..11393146,
FT                   11409129..11409233,11409344..11409432,11413510..11413622,
FT                   11435016..11435136,11474699..11474955,11488952..11489446))
FT                   /locus_tag="mCG_2843"
FT                   /product="mCG2843"
FT                   /note="gene_id=mCG2843.2 transcript_id=mCT2150.2 created on
FT                   13-NOV-2002"
FT   CDS             complement(join(11337265..11337309,11342773..11342889,
FT                   11343691..11343783,11345399..11345503,11345652..11345756,
FT                   11347674..11347787,11351288..11351390,11352767..11352856,
FT                   11354769..11354845,11357942..11358022,11359856..11360065,
FT                   11362205..11362284,11363226..11363399,11364736..11364902,
FT                   11367184..11367314,11369240..11369497,11370737..11370880,
FT                   11373864..11374006,11378495..11378639,11379206..11379279,
FT                   11383799..11383964,11389037..11389187,11392998..11393146,
FT                   11409129..11409233,11409344..11409432,11413510..11413622,
FT                   11435016..11435136,11474699..11474717))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2843"
FT                   /product="mCG2843"
FT                   /note="gene_id=mCG2843.2 transcript_id=mCT2150.2
FT                   protein_id=mCP22148.2"
FT                   /protein_id="EDL18369.1"
FT                   /translation="MWPPGAVILGVCISFNVDVKNSMSFSGPVEDMFGYTVQQYENEEG
FT                   KWVLIGSPLVGQPKARTGDVYKCPVGRERSMPCVKLDLPVNTSIPNVTEIKENMTFGST
FT                   LVTNPKGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSFAPVGIVQYGANVTHEF
FT                   NLNKYSSTEEVLVAANKIGRRGGLQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTD
FT                   GESHDNYRLKQVIQDCEDENIQRFSIAILGHYNRGNLSTEKFVEEIKSIASEPTEKHFF
FT                   NVSDELALVTIVKALGERIFALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAY
FT                   DWNGTVVMQKANQIVIPHNTTFQTEPTKMNEPLASYLGYTVNSATIPGDVLYIAGQPRY
FT                   NHTGQVVIYKMEDGDVNILQTLSGEQIGSYFGSVLTTIDIDKDSYTDLLLVGAPMYMGT
FT                   EKEEQGKVYVYAVNQTRFEYQMSLEPIKQTCCSSLKDNSCTKENKNEPCGARFGTAVAA
FT                   VKDLNVDGFNDVVIGAPLEDDHAGAVYIYHGSGKTIRKEYAQRIPSGGDGKTLKFFGQS
FT                   IHGEMDLNGDGLTDVTIGGLGGAALFWARDVAVVKVTMNFEPNKVNIQKKNCRVEGKET
FT                   VCINATMCFHVKLKSKEDSVYEADLQYRVTLDSLRQISRSFFSGTQERRIQRNLTVRES
FT                   ECIRHSFYMLASKSCVTAAFLQLTLDFNLTDPENGPVLDDALPNSVHGHIPFAKDCGNK
FT                   ERCVSDLTLDVSTTEKNLLIVRSQNDKFNVSLTVKNKGDSAYNTRTVVQYSPNLIFSGI
FT                   EEIQKDSCESNQNITCRVGYPFLRTGDVVNFKIIFQFNTSHLSENAIIHLSATSDSEEP
FT                   LESLYDNEVNISIPVKYEVGLQFYSSASEHHISVAANETVPELINSTKDIGDEINVFYT
FT                   IRKRGHFPMPELRLAISFPNLTSDGYPVLYPTGWSSSDNVNCRPRSLEDPLGINSGKKM
FT                   TISKSEVLKRGTIQDCSTCKIATITCHLLPSDVSQVNVSLILWKPTFIKAHFSSLNLTI
FT                   RGELQSENSSLTLSSSNRKRELAIQISKDGLPGRVPLWVILLSAFAGLLLLMLLILALW
FT                   KIGFFKRPLKKKMEK"
FT   assembly_gap    11358251..11358270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11361564..11361628
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    11368618..11368948
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    11380408..11380438
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    11382020..11382233
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    11391906..11392592
FT                   /estimated_length=687
FT                   /gap_type="unknown"
FT   assembly_gap    11406228..11406247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11407371..11407390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11408585..11408604
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11411336..11411469
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    11418441..11418460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11420154..11420173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11421199..11421218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11422778..11422797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11424237..11424256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11425942..11425961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11428848..11429265
FT                   /estimated_length=418
FT                   /gap_type="unknown"
FT   assembly_gap    11433880..11434044
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    11451072..11451552
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    11474087..11474106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11475958..11476637
FT                   /estimated_length=680
FT                   /gap_type="unknown"
FT   assembly_gap    11478801..11478820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11489871..11490122
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    11503838..11503857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11526747..11526766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11528612..11528631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11553406..11554597)
FT                   /pseudo
FT                   /locus_tag="mCG_1032955"
FT                   /note="gene_id=mCG1032955.1"
FT   mRNA            complement(11553406..11554597)
FT                   /pseudo
FT                   /locus_tag="mCG_1032955"
FT                   /note="gene_id=mCG1032955.1 transcript_id=mCT150659.1
FT                   created on 06-FEB-2003"
FT   assembly_gap    11559196..11559215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11574850..11574920
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    11581414..11581433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11591888..11591907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11594095..11594114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11596560..11596579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11598500..11598519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11600215..11606450
FT                   /estimated_length=6236
FT                   /gap_type="unknown"
FT   assembly_gap    11608273..11608292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11632518..11632559
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    11635168..11635187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11664958..11665010
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    11717703..11722274
FT                   /estimated_length=4572
FT                   /gap_type="unknown"
FT   assembly_gap    11723168..11723476
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    11724195..11724214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11726278..11726867
FT                   /estimated_length=590
FT                   /gap_type="unknown"
FT   assembly_gap    11728186..11733258
FT                   /estimated_length=5073
FT                   /gap_type="unknown"
FT   assembly_gap    11734654..11734673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11737193..11737212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11738482..11738667
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    11762222..11762781
FT                   /estimated_length=560
FT                   /gap_type="unknown"
FT   assembly_gap    11765060..11765079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11769192..11769211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11770406..11770425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11771657..11771676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11773950..11773969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11775681..11775700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11776874..11776893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11803329..11803348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11805271..11805290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11806338..11806357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11815048..11815067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11858419..11858438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11893920..11896328
FT                   /estimated_length=2409
FT                   /gap_type="unknown"
FT   assembly_gap    11897750..11898029
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    11899505..11899524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11900837..11900856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11909677..11909696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11921007..11921706
FT                   /estimated_length=700
FT                   /gap_type="unknown"
FT   assembly_gap    11924975..11927456
FT                   /estimated_length=2482
FT                   /gap_type="unknown"
FT   assembly_gap    11953011..11953030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11954466..11954485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11955401..11956683)
FT                   /pseudo
FT                   /locus_tag="mCG_117828"
FT                   /note="gene_id=mCG117828.0"
FT   mRNA            complement(11955401..11956683)
FT                   /pseudo
FT                   /locus_tag="mCG_117828"
FT                   /note="gene_id=mCG117828.0 transcript_id=mCT118974.0
FT                   created on 06-FEB-2003"
FT   assembly_gap    11957906..11958087
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    11959755..11959774
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11974896..11974915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11986404..11987341
FT                   /estimated_length=938
FT                   /gap_type="unknown"
FT   assembly_gap    11988766..11989110
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    12005945..12006007
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    12009535..12009709
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    12012748..12013109
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    12014568..12017409
FT                   /estimated_length=2842
FT                   /gap_type="unknown"
FT   assembly_gap    12018624..12018765
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    12022166..12023085
FT                   /estimated_length=920
FT                   /gap_type="unknown"
FT   assembly_gap    12061498..12061517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12067585..12067856
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    12071019..12071038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12074852..12074871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12100540..12100559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12109013..12109557
FT                   /estimated_length=545
FT                   /gap_type="unknown"
FT   assembly_gap    12113938..12113957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12116876..12116895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12123031..12124043
FT                   /estimated_length=1013
FT                   /gap_type="unknown"
FT   assembly_gap    12130372..12143533
FT                   /estimated_length=13162
FT                   /gap_type="unknown"
FT   assembly_gap    12147456..12147959
FT                   /estimated_length=504
FT                   /gap_type="unknown"
FT   assembly_gap    12149142..12151491
FT                   /estimated_length=2350
FT                   /gap_type="unknown"
FT   assembly_gap    12183889..12183971
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    12188725..12188744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12190231..12190438
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    12192881..12192900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12195116..12195135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12196665..12196684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12199786..12200052
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    12208850..12208897
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    12273111..12273493
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    12281255..12281274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12295202..12295221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12296640..12296659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12297827..12297846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12301082..12301101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12305056..12305486
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    12307002..12307164
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    12310750..12310769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12311808..12311827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12326870..12326889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12341621..12343254
FT                   /estimated_length=1634
FT                   /gap_type="unknown"
FT   assembly_gap    12345522..12345541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12346735..12346754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12348052..12348071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12349220..12349239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12350327..12350346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12351977..12351996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12353028..12353047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12357204..12357223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12358624..12358643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12365329..12365607
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    12367724..12367743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12371626..12371645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12373464..12374071
FT                   /estimated_length=608
FT                   /gap_type="unknown"
FT   assembly_gap    12375565..12376911
FT                   /estimated_length=1347
FT                   /gap_type="unknown"
FT   assembly_gap    12391627..12391646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12394217..12394347
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    12398064..12398083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12416288..12416307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12420692..12420711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12459630..12459649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12472994..12473013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12474198..12474217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12475412..12475431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12476699..12476860
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    12478208..12478227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12479686..12480978
FT                   /estimated_length=1293
FT                   /gap_type="unknown"
FT   assembly_gap    12482154..12486834
FT                   /estimated_length=4681
FT                   /gap_type="unknown"
FT   assembly_gap    12519584..12519603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12553471..12553490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12556086..12556105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12560375..12560481
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    12570941..12570960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12575692..12575734
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    12584255..12584274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12615669..12622066
FT                   /estimated_length=6398
FT                   /gap_type="unknown"
FT   assembly_gap    12623554..12623573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12624672..12624691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12644445..12644664
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    12647962..12647981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12653900..12654429
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    12655678..12656046
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    12659791..12659810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12661396..12661415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12667662..12670776
FT                   /estimated_length=3115
FT                   /gap_type="unknown"
FT   assembly_gap    12676361..12678191
FT                   /estimated_length=1831
FT                   /gap_type="unknown"
FT   assembly_gap    12679859..12679878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12696007..12697051
FT                   /estimated_length=1045
FT                   /gap_type="unknown"
FT   gene            complement(12722682..12734003)
FT                   /gene="Isl1"
FT                   /locus_tag="mCG_11532"
FT                   /note="gene_id=mCG11532.2"
FT   mRNA            complement(join(12722682..12724001,12725999..12726166,
FT                   12727433..12727719,12729557..12729816,12732613..12732802,
FT                   12733734..12734003))
FT                   /gene="Isl1"
FT                   /locus_tag="mCG_11532"
FT                   /product="ISL1 transcription factor, LIM/homeodomain,
FT                   transcript variant mCT11534"
FT                   /note="gene_id=mCG11532.2 transcript_id=mCT11534.2 created
FT                   on 13-NOV-2002"
FT   mRNA            complement(join(<12723885..12724001,12725999..12726097,
FT                   12727433..12727719,12729557..12729816,12732613..12732802,
FT                   12733734..>12733761))
FT                   /gene="Isl1"
FT                   /locus_tag="mCG_11532"
FT                   /product="ISL1 transcription factor, LIM/homeodomain,
FT                   transcript variant mCT191191"
FT                   /note="gene_id=mCG11532.2 transcript_id=mCT191191.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(12723885..12724001,12725999..12726097,
FT                   12727433..12727719,12729557..12729816,12732613..12732802,
FT                   12733734..12733761))
FT                   /codon_start=1
FT                   /gene="Isl1"
FT                   /locus_tag="mCG_11532"
FT                   /product="ISL1 transcription factor, LIM/homeodomain,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11532.2 transcript_id=mCT191191.0
FT                   protein_id=mCP112157.0 isoform=CRA_a"
FT                   /protein_id="EDL18367.1"
FT                   /translation="MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKC
FT                   AECNQYLDESCTCFVRDGKTYCKRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIEC
FT                   FRCVACSRQLIPGDEFALREDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAAEPI
FT                   SARQPALRPHVHKQPEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSP
FT                   RVIRVWFQNKRCKDKKRSIMMKQLQQQQPNDKTANPVEVQSYQPPWKVLSDFALQSDID
FT                   QPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA"
FT   CDS             complement(join(12723885..12724001,12725999..12726166,
FT                   12727433..12727719,12729557..12729816,12732613..12732802,
FT                   12733734..12733761))
FT                   /codon_start=1
FT                   /gene="Isl1"
FT                   /locus_tag="mCG_11532"
FT                   /product="ISL1 transcription factor, LIM/homeodomain,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11532.2 transcript_id=mCT11534.2
FT                   protein_id=mCP4705.2 isoform=CRA_b"
FT                   /db_xref="GOA:A2RSV5"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:101791"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSV5"
FT                   /protein_id="EDL18368.1"
FT                   /translation="MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKC
FT                   AECNQYLDESCTCFVRDGKTYCKRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIEC
FT                   FRCVACSRQLIPGDEFALREDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAAEPI
FT                   SARQPALRPHVHKQPEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSP
FT                   RVIRVWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANP
FT                   VEVQSYQPPWKVLSDFALQSDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPN
FT                   SMVASPIEA"
FT   assembly_gap    12735264..12738322
FT                   /estimated_length=3059
FT                   /gap_type="unknown"
FT   assembly_gap    12739439..12739850
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    12750148..12750167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12755323..12756033)
FT                   /pseudo
FT                   /locus_tag="mCG_52766"
FT                   /note="gene_id=mCG52766.2"
FT   mRNA            complement(12755323..12756033)
FT                   /pseudo
FT                   /locus_tag="mCG_52766"
FT                   /note="gene_id=mCG52766.2 transcript_id=mCT52949.2 created
FT                   on 06-FEB-2003"
FT   assembly_gap    12756678..12756697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12758866..12758885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12761625..12761644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12763112..12763131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12764701..12765520
FT                   /estimated_length=820
FT                   /gap_type="unknown"
FT   assembly_gap    12766788..12766807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12768213..12768232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<12790983..>12791306)
FT                   /locus_tag="mCG_67732"
FT                   /note="gene_id=mCG67732.0"
FT   mRNA            complement(<12790983..>12791306)
FT                   /locus_tag="mCG_67732"
FT                   /product="mCG67732"
FT                   /note="gene_id=mCG67732.0 transcript_id=mCT67915.1 created
FT                   on 06-FEB-2003"
FT   CDS             complement(12790983..12791306)
FT                   /codon_start=1
FT                   /locus_tag="mCG_67732"
FT                   /product="mCG67732"
FT                   /note="gene_id=mCG67732.0 transcript_id=mCT67915.1
FT                   protein_id=mCP27673.1"
FT                   /protein_id="EDL18366.1"
FT                   /translation="MTDCDRNGFIYKEDLLPSLGGIPIEEYLDIVMSEALGPIDFIIYL
FT                   PVISKKLKSLDSEDITRNVFACYDEEAAGTIQEEHLRDLLSTTNDEFTDGGVDELAAQG
FT                   RSC"
FT   assembly_gap    12795068..12795087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12804089..12805328
FT                   /estimated_length=1240
FT                   /gap_type="unknown"
FT   assembly_gap    12806675..12806694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12808403..12808429
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    12819163..12819182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12836806..12837073
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    12855492..12855511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12859705..12859730
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    12862422..12864099
FT                   /estimated_length=1678
FT                   /gap_type="unknown"
FT   assembly_gap    12865605..12865624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12866757..12866958
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    12868453..12868472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12869685..12869704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12870712..12870731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12871945..12872075
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    12876796..12876815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12895846..12897151
FT                   /estimated_length=1306
FT                   /gap_type="unknown"
FT   assembly_gap    12911969..12912038
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    12913158..12913192
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    12971900..12971919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12973336..12973355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12982106..12982294
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    12983502..12983521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12986848..12986867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13013785..13013804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13015576..13015595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13036411..13036430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13037652..13037671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13044869..13044888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13046001..13046020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13072896..13072958
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    13074191..13074210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13076228..13077018
FT                   /estimated_length=791
FT                   /gap_type="unknown"
FT   assembly_gap    13093936..13094090
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    13113562..13113710
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    13115161..13116787
FT                   /estimated_length=1627
FT                   /gap_type="unknown"
FT   assembly_gap    13126714..13126733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13137789..13137808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13140503..13140559
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    13153195..13153214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13177452..13177508
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    13193043..13193062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13198933..13199100
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    13200442..13200461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13201464..13201483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13203219..13203302
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    13221875..13221894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13231080..>13268422)
FT                   /locus_tag="mCG_145292"
FT                   /note="gene_id=mCG145292.0"
FT   mRNA            complement(join(13231080..13231413,13266017..13266122,
FT                   13266230..13266593,13267445..>13268422))
FT                   /locus_tag="mCG_145292"
FT                   /product="mCG145292"
FT                   /note="gene_id=mCG145292.0 transcript_id=mCT184716.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    13238210..13238517
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    13257423..13257957
FT                   /estimated_length=535
FT                   /gap_type="unknown"
FT   CDS             complement(join(13266556..13266593,13267445..>13267889))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145292"
FT                   /product="mCG145292"
FT                   /note="gene_id=mCG145292.0 transcript_id=mCT184716.0
FT                   protein_id=mCP106327.0"
FT                   /protein_id="EDL18365.1"
FT                   /translation="LSPLSFSGQSSLCRQALLFQGRCTVIWCLDLLLAEDEGPKQDLSQ
FT                   KLCCFGQEGGRLSGAEDGAASEALWLSPVPETVGLCFPHLHRCSLPSAGSRSQGGSRRG
FT                   LRHKPLGPGGPLCSHQEGGRLSGAEDGAASEALWLSPVRLSTIEALRGSASLLSTE"
FT   assembly_gap    13268745..13272334
FT                   /estimated_length=3590
FT                   /gap_type="unknown"
FT   assembly_gap    13273942..13274504
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   gene            complement(13284520..>13454009)
FT                   /locus_tag="mCG_119138"
FT                   /note="gene_id=mCG119138.1"
FT   mRNA            complement(join(13284520..13284893,13291837..13291921,
FT                   13292702..13292771,13293813..13293886,13296695..13296764,
FT                   13297784..13297856,13298097..13298209,13299072..13299120,
FT                   13301295..13301362,13307531..13307596,13308491..13308616,
FT                   13310024..13310116,13324432..13324527,13324629..13324679,
FT                   13326063..13326621,13327083..13327208,13334232..13334298,
FT                   13342208..13342298,13342727..13342787,13354118..13354212,
FT                   13356533..13356610,13358149..13358219,13358930..13359019,
FT                   13369091..13369128,13453940..>13454009))
FT                   /locus_tag="mCG_119138"
FT                   /product="mCG119138"
FT                   /note="gene_id=mCG119138.1 transcript_id=mCT120302.1
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(13284791..13284893,13291837..13291921,
FT                   13292702..13292771,13293813..13293886,13296695..13296764,
FT                   13297784..13297856,13298097..13298209,13299072..13299120,
FT                   13301295..13301362,13307531..13307596,13308491..13308616,
FT                   13310024..13310116,13324432..13324527,13324629..13324679,
FT                   13326063..13326621,13327083..13327208,13334232..13334298,
FT                   13342208..13342298,13342727..13342787,13354118..13354212,
FT                   13356533..13356610,13358149..13358219,13358930..13359019,
FT                   13369091..13369128,13453940..>13454007))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119138"
FT                   /product="mCG119138"
FT                   /note="gene_id=mCG119138.1 transcript_id=mCT120302.1
FT                   protein_id=mCP83797.1"
FT                   /protein_id="EDL18364.1"
FT                   /translation="LSVSDFRYSDSTFTFTYVGGPKSVSYSVHVSEDYPDNTYVSSSEN
FT                   DEDVLVTTDPIPVIFHRIATELRKTNDINCCLSIRSKLQKENGEESRQNSTVEEDSEGD
FT                   NDSEEFYYGGQVNYDGELHKHPQLEADLSAVRELYGPHAVSLREYGAIDDVDIDLHIDV
FT                   SFLDEEIAVAWEVIRTEPIIVRLHCSLTQYLNGPVPTVDVFQISTKERFGLGHQLKKIM
FT                   QTFVSQQWKQSKDKSNCPHGKKLSEKKVKSPLHLFSTLRRSPSYPPPGCGKSKSKLKPE
FT                   QDGISKTHKLLRRTCSSTVKADDMCAKSHRTFGRSLSSDPRAEQAMSTIKSHKLLGRPC
FT                   PSAGKQEDCLTLKSHKLLTRSCSGDPRCEHNTNLKPHKLLSRSYSSNLRMEELYGLKNH
FT                   KLLSKSYSSAPKTSKMEHFKEPNAEGRRLSLTSGLIGILTPSSSSSQPPTNGAKSIPIR
FT                   DRGFLVQTIEFAEQRIPVLNEYCVVCDEPHVFQNGPMLRPTVCERELCVFAFQTLGVMN
FT                   EAADEIATGAQVVDLLVSMCRSALESPRKVVIFEPYPSVVDPNDPQMLAFNPRKKNYDR
FT                   VMKALDSITSIREMTQAPYLEIKKQMDKQDPLAHPLLQWVISSNRSHIVKLPVNRQLKF
FT                   MHTPHQFLLLSSPPAKESNFRAAKKLFGSTFAFHGSHIENWHSILRNGLVVASNTRLQL
FT                   HGAMYGSGIYLSPMSSISFGYSGMNKKQKVSTKDEPASSSKSSNASQSQKKGQQSQFLQ
FT                   SRNLKCIALCEVITSPDLHKHGEIWVVPNTDHVCTRFFFVYEDGQVGDANINTQEGGIH
FT                   KEILRVIGNQTATG"
FT   assembly_gap    13303965..13303984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13306457..13306476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13310710..13311051
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    13317527..13317546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13318735..13318754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13320588..13320607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13341762..13341834
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    13347974..13351282
FT                   /estimated_length=3309
FT                   /gap_type="unknown"
FT   assembly_gap    13355143..13355913
FT                   /estimated_length=771
FT                   /gap_type="unknown"
FT   assembly_gap    13357121..13358089
FT                   /estimated_length=969
FT                   /gap_type="unknown"
FT   assembly_gap    13361698..13362018
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    13408874..13408893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13413378..13414814
FT                   /estimated_length=1437
FT                   /gap_type="unknown"
FT   assembly_gap    13434576..13434595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13435624..13435643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13437487..13437506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13438706..13438725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13439803..13439822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13454742..13455301
FT                   /estimated_length=560
FT                   /gap_type="unknown"
FT   assembly_gap    13461411..13461430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13462641..13462660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13470836..13470855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13481222..13481903
FT                   /estimated_length=682
FT                   /gap_type="unknown"
FT   assembly_gap    13495703..13497088
FT                   /estimated_length=1386
FT                   /gap_type="unknown"
FT   assembly_gap    13497939..13498691
FT                   /estimated_length=753
FT                   /gap_type="unknown"
FT   assembly_gap    13499813..13499832
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13501127..13501146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13517765..13517859
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    13545568..13545587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13547184..13547203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13549575..13549594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13558817..13558836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13562378..13562397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13566378..13566397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13570682..13570701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13571880..13571899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13573488..13573507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13576986..13577005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13578648..13578667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13580030..13580049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13581165..13584349
FT                   /estimated_length=3185
FT                   /gap_type="unknown"
FT   assembly_gap    13585466..13585485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13586994..13590216
FT                   /estimated_length=3223
FT                   /gap_type="unknown"
FT   assembly_gap    13601903..13601922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13621675..13621713
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    13624923..13625459
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    13626818..13626909
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    13643523..13643554
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    13646055..13646074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13647539..13647558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13649525..13702575
FT                   /gene="Emb"
FT                   /locus_tag="mCG_6163"
FT                   /note="gene_id=mCG6163.2"
FT   mRNA            join(13649525..13649880,13661885..13661974,
FT                   13679629..13679821,13680058..13680143,13691467..13691594,
FT                   13694394..13694673,13696010..13696043,13700436..13700490,
FT                   13701436..13702575)
FT                   /gene="Emb"
FT                   /locus_tag="mCG_6163"
FT                   /product="embigin"
FT                   /note="gene_id=mCG6163.2 transcript_id=mCT5517.2 created on
FT                   13-NOV-2002"
FT   CDS             join(13649772..13649880,13661885..13661974,
FT                   13679629..13679821,13680058..13680143,13691467..13691594,
FT                   13694394..13694673,13696010..13696043,13700436..13700490,
FT                   13701436..13701453)
FT                   /codon_start=1
FT                   /gene="Emb"
FT                   /locus_tag="mCG_6163"
FT                   /product="embigin"
FT                   /note="gene_id=mCG6163.2 transcript_id=mCT5517.2
FT                   protein_id=mCP4716.2"
FT                   /protein_id="EDL18363.1"
FT                   /translation="MRSHTGLRALVAPGYPLLLLCLLAATRPDPAEGDPTDPTFTSLPV
FT                   REEMMAKYSNLSLKSCNISVTEKSNVSVEENVILEKPSHVELKCVYTATKDLNLMNVTW
FT                   KKDDEPLETTGDFNTTKMGNTLTSQYRFIVFNSKQLGKYSCVFGEKELRGTFNIHVPKA
FT                   HGKKKSLIAYVGDSTVLKCVCQDCLPLNWTWYMGNETAQVPIDAHSNEKYIINGSHANE
FT                   TRLKIKHLLEEDGGSYWCRATFQLGESEERNELVVLSFLVPLKPFLAILAEVILLVAII
FT                   LLCEVYTHKKKNDPDAGKEFEQIEQLKSDDSNGIENNVPRYRKTDSADQ"
FT   assembly_gap    13655322..13655690
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    13660200..13660688
FT                   /estimated_length=489
FT                   /gap_type="unknown"
FT   assembly_gap    13670731..13670750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13671861..13671880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13681851..13681870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13697800..13697819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13703947..13703966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13710263..13710282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13712095..13712114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13715531..13715550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13718716..13718735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13727975..13727994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13729609..13734563
FT                   /estimated_length=4955
FT                   /gap_type="unknown"
FT   assembly_gap    13741084..13742662
FT                   /estimated_length=1579
FT                   /gap_type="unknown"
FT   assembly_gap    13753749..13753768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13763437..13763848
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    13784024..13784308
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    13787656..13787819
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   gene            complement(13791066..13791874)
FT                   /locus_tag="mCG_6162"
FT                   /note="gene_id=mCG6162.1"
FT   mRNA            complement(13791066..13791874)
FT                   /locus_tag="mCG_6162"
FT                   /product="mCG6162"
FT                   /note="gene_id=mCG6162.1 transcript_id=mCT5522.1 created on
FT                   06-FEB-2003"
FT   CDS             complement(13791373..13791783)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6162"
FT                   /product="mCG6162"
FT                   /note="gene_id=mCG6162.1 transcript_id=mCT5522.1
FT                   protein_id=mCP4715.1"
FT                   /protein_id="EDL18362.1"
FT                   /translation="MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
FT                   TVALREIRRYQKATELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL
FT                   FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA"
FT   assembly_gap    13792652..13792671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13793958..13793977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13802884..13803579
FT                   /estimated_length=696
FT                   /gap_type="unknown"
FT   assembly_gap    13804284..13805605
FT                   /estimated_length=1322
FT                   /gap_type="unknown"
FT   assembly_gap    13807077..13808016
FT                   /estimated_length=940
FT                   /gap_type="unknown"
FT   assembly_gap    13820074..13820093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13821084..13821103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13825742..13825761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13831556..13831575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13860263..13860282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13872964..13872983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13875595..13875614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13877545..13877564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13889796..13891035)
FT                   /pseudo
FT                   /locus_tag="mCG_6159"
FT                   /note="gene_id=mCG6159.1"
FT   mRNA            complement(13889796..13891035)
FT                   /pseudo
FT                   /locus_tag="mCG_6159"
FT                   /note="gene_id=mCG6159.1 transcript_id=mCT5519.2 created on
FT                   06-FEB-2003"
FT   assembly_gap    13899758..13899777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13902148..13902167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13917649..13917740
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    13925008..13925027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13936811..13936830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13939013..13939032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13941569..13941588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13960479..13960498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13981704..13981723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13983829..13983848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13985214..13985233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13986588..13988597
FT                   /estimated_length=2010
FT                   /gap_type="unknown"
FT   assembly_gap    13990807..13990826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13992254..13992273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13994567..13994742
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    14019932..14019951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14048205..14048636
FT                   /estimated_length=432
FT                   /gap_type="unknown"
FT   gene            <14048704..14440551
FT                   /gene="Hcn1"
FT                   /locus_tag="mCG_50885"
FT                   /note="gene_id=mCG50885.2"
FT   mRNA            join(<14048704..14049099,14102378..14102801,
FT                   14259058..14259219,14325390..14325608,14356455..14356601,
FT                   14389961..14390201,14434878..14435042,14438617..14440551)
FT                   /gene="Hcn1"
FT                   /locus_tag="mCG_50885"
FT                   /product="hyperpolarization-activated, cyclic
FT                   nucleotide-gated K+ 1"
FT                   /note="gene_id=mCG50885.2 transcript_id=mCT51068.2 created
FT                   on 13-NOV-2002"
FT   CDS             join(<14048705..14049099,14102378..14102801,
FT                   14259058..14259219,14325390..14325608,14356455..14356601,
FT                   14389961..14390201,14434878..14435042,14438617..14439599)
FT                   /codon_start=1
FT                   /gene="Hcn1"
FT                   /locus_tag="mCG_50885"
FT                   /product="hyperpolarization-activated, cyclic
FT                   nucleotide-gated K+ 1"
FT                   /note="gene_id=mCG50885.2 transcript_id=mCT51068.2
FT                   protein_id=mCP27668.2"
FT                   /protein_id="EDL18360.1"
FT                   /translation="GMEGGGKPNSASNSRDDGNSVFPSKAPATGPVAADKRLGTPPGGG
FT                   AAGKEHGNSVCFKVDGGGGEEPAGSFEDAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMF
FT                   GSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTT
FT                   PWIIFNVASDTVFLLDLIMNFRTGTVNEDSSEIILDPKVIKMNYLKSWFVVDFISSIPV
FT                   DYIFLIVEKGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDL
FT                   ASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALF
FT                   KAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQE
FT                   KYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRK
FT                   LVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSS
FT                   KEMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV
FT                   AIDRLDRIGKKNSILLQKFQKDLNTGVFNNQENEILKQIVKHDREMVQAIPPINYPQMT
FT                   ALNCTSSTTTPTSRMRTQSPPVYTATSLSHSNLHSPSPSTQTPQPSAILSPCSYTTAVC
FT                   SPPIQSPLATRTFHYASPTASQLSLMQQPQQQLPQSQVQQTQTQTQQQQQQQQQQQQQQ
FT                   QQQQQQQQQQQQQQQQQQQQQQQPQTPGSSTPKNEVHKSTQALHNTNLTKEVRPLSASQ
FT                   PSLPHEVSTLISRPHPTVGESLASIPQPVAAVHSTGLQAGSRSTVPQRVTLFRQMSSGA
FT                   IPPNRGVPPAPPPPAAVQRESPSVLNTDPDAEKPRFASNL"
FT   assembly_gap    14052620..14052802
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    14054631..14054650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14056146..14056165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14059341..14059360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14062531..14063129
FT                   /estimated_length=599
FT                   /gap_type="unknown"
FT   assembly_gap    14067185..14067204
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14073600..14074458
FT                   /estimated_length=859
FT                   /gap_type="unknown"
FT   assembly_gap    14087313..14087584
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    14089133..14089773
FT                   /estimated_length=641
FT                   /gap_type="unknown"
FT   assembly_gap    14110537..14111288
FT                   /estimated_length=752
FT                   /gap_type="unknown"
FT   assembly_gap    14124364..14124457
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    14126063..14126082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14146950..14147149
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   gene            complement(14152631..>14165898)
FT                   /locus_tag="mCG_145290"
FT                   /note="gene_id=mCG145290.0"
FT   mRNA            complement(join(14152631..14153002,14155534..14155727,
FT                   14157825..14157853,14162711..14162860,14165721..>14165898))
FT                   /locus_tag="mCG_145290"
FT                   /product="mCG145290"
FT                   /note="gene_id=mCG145290.0 transcript_id=mCT184714.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(14155646..14155727,14157825..14157853,
FT                   14162711..>14162770))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145290"
FT                   /product="mCG145290"
FT                   /note="gene_id=mCG145290.0 transcript_id=mCT184714.0
FT                   protein_id=mCP106325.0"
FT                   /protein_id="EDL18361.1"
FT                   /translation="LNCPESSDLSCSLAEQIASQVLLCHSVFLRCERAISKDKSGLSRS
FT                   LYHSLKKGVND"
FT   assembly_gap    14170226..14170245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14172973..14172992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14175266..14175285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14177144..14177163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14180649..14180668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14191821..14191840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14199842..14199861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14217895..14217914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14230919..14230938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14252802..14252821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14266295..14266928
FT                   /estimated_length=634
FT                   /gap_type="unknown"
FT   assembly_gap    14273636..14273655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14275654..14275673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14300509..14300528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14326065..14326206
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    14328923..14328942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14337045..14337064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14338207..14338226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14339464..14339483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14349652..14349709
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    14352434..14352453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14361977..14361996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14364034..14364053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14365183..14365202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14366611..14366630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14368227..14368246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14370281..14370300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14371869..14371888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14374990..14375009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14378339..14378358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14380995..14381014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14403782..14403801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14429429..14429791
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    14458196..14458215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14460184..14460203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14476265..14476441
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    14492409..14493239
FT                   /estimated_length=831
FT                   /gap_type="unknown"
FT   assembly_gap    14497115..14497134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14498421..14498847
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    14500011..14500030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14501156..14501175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14513513..14513532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14516580..14516599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14517818..14517837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14532178..14532197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14534564..14534583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14547173..14548846
FT                   /estimated_length=1674
FT                   /gap_type="unknown"
FT   assembly_gap    14550405..14550634
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    14552055..14552074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14622727..14622746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14623826..14624115
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    14628343..14628362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14629774..14630264
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    14649595..14649711
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    14655078..14655097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14694864..14696470
FT                   /estimated_length=1607
FT                   /gap_type="unknown"
FT   assembly_gap    14697701..14697720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14700395..14700414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14701811..14706633
FT                   /estimated_length=4823
FT                   /gap_type="unknown"
FT   assembly_gap    14710798..14710817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14714227..14714246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14716342..14716684
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    14728653..14728768
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    14730391..14730591
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    14740971..14740990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14769862..14769881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14777673..14778230
FT                   /estimated_length=558
FT                   /gap_type="unknown"
FT   assembly_gap    14793378..14793397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14794777..14794796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14800751..14800770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14803021..14803040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14812453..14812472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14828202..14828221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14832849..14832868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14834946..14835039
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    14836190..14836209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14853353..>14863641)
FT                   /gene="Mrps30"
FT                   /locus_tag="mCG_1400"
FT                   /note="gene_id=mCG1400.1"
FT   mRNA            complement(join(14853353..14854198,14857408..14857584,
FT                   14860953..14861058,14861624..14861769,14863038..>14863641))
FT                   /gene="Mrps30"
FT                   /locus_tag="mCG_1400"
FT                   /product="mitochondrial ribosomal protein S30"
FT                   /note="gene_id=mCG1400.1 transcript_id=mCT7995.2 created on
FT                   20-NOV-2002"
FT   CDS             complement(join(14853882..14854198,14857408..14857584,
FT                   14860953..14861058,14861624..14861769,14863038..>14863641))
FT                   /codon_start=1
FT                   /gene="Mrps30"
FT                   /locus_tag="mCG_1400"
FT                   /product="mitochondrial ribosomal protein S30"
FT                   /note="gene_id=mCG1400.1 transcript_id=mCT7995.2
FT                   protein_id=mCP4714.1"
FT                   /protein_id="EDL18359.1"
FT                   /translation="SGSRRAKMAAARYWKLVPRGRGLSQNAAAKASATAPEVRDLEVVA
FT                   TPVARYPPIVASMTADSKAARQRRVQRWQATVHAAPSVDEKIRILTKMQFKKYVVHPQI
FT                   SALNADRWYQSFTKTVFVSGLPPAPALSPPPPSLDLAALRAAVCDCILQEQVYVRRRRP
FT                   RSLFDRRQALASSILDQVVRTLVNLLAPLNPVLSTAALDCKRSVDFYWLRGEERIPAGH
FT                   RKGHIDALRYQINDKPHNQIRISKQLPEFVPLDYSIPTEIPVMKCKPDKLPLFRRQYEN
FT                   SIFTGSKTADPCCYGHTQFHLIPDRLKRERLIRQNQAEQVEAVFRANAIASLFAWTGAQ
FT                   AMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTVQADQNNPRKNLCWGSQS
FT                   QPLYETVEDNDVKGFDDGTLLQIVHFLLNKPREDGAQLLASQEKELDLGP"
FT   assembly_gap    14855385..14857222
FT                   /estimated_length=1838
FT                   /gap_type="unknown"
FT   assembly_gap    14858573..14858592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14860187..14860206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14864854..14864873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14866103..14866122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14867642..14867661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14868873..14868892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14871927..14871946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14874849..14875620
FT                   /estimated_length=772
FT                   /gap_type="unknown"
FT   assembly_gap    14877422..14877441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14893348..14893430
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    14897478..14897533
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    14908230..14908249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14946740..14946759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14948913..14949262
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    14976837..14977496
FT                   /estimated_length=660
FT                   /gap_type="unknown"
FT   assembly_gap    14998261..14998280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14999325..14999344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15002304..15002402
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    15023698..15023717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15025189..15025208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15027167..15027734
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   gene            15028798..15059114
FT                   /locus_tag="mCG_1033012"
FT                   /note="gene_id=mCG1033012.1"
FT   mRNA            join(15028798..15028823,15035534..15035716,
FT                   15057582..15057632,15058296..15059114)
FT                   /locus_tag="mCG_1033012"
FT                   /product="mCG1033012, transcript variant mCT175928"
FT                   /note="gene_id=mCG1033012.1 transcript_id=mCT175928.0
FT                   created on 20-NOV-2002"
FT   mRNA            join(15029591..15029658,15035534..15035680,
FT                   15057582..15057632,15058448..15059039)
FT                   /locus_tag="mCG_1033012"
FT                   /product="mCG1033012, transcript variant mCT175929"
FT                   /note="gene_id=mCG1033012.1 transcript_id=mCT175929.0
FT                   created on 20-NOV-2002"
FT   mRNA            join(15029605..15029658,15035534..15035680,
FT                   15057582..15057632,15058296..15059039)
FT                   /locus_tag="mCG_1033012"
FT                   /product="mCG1033012, transcript variant mCT150716"
FT                   /note="gene_id=mCG1033012.1 transcript_id=mCT150716.1
FT                   created on 20-NOV-2002"
FT   assembly_gap    15032273..15032292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             15035537..15035659
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033012"
FT                   /product="mCG1033012, isoform CRA_a"
FT                   /note="gene_id=mCG1033012.1 transcript_id=mCT150716.1
FT                   protein_id=mCP83869.1 isoform=CRA_a"
FT                   /protein_id="EDL18356.1"
FT                   /translation="MNDFAGPHTVNHRLKSKGANQSWTKTSATVVSLMCYSDSK"
FT   CDS             15035537..15035659
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033012"
FT                   /product="mCG1033012, isoform CRA_a"
FT                   /note="gene_id=mCG1033012.1 transcript_id=mCT175929.0
FT                   protein_id=mCP98851.0 isoform=CRA_a"
FT                   /protein_id="EDL18357.1"
FT                   /translation="MNDFAGPHTVNHRLKSKGANQSWTKTSATVVSLMCYSDSK"
FT   CDS             15035537..15035659
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033012"
FT                   /product="mCG1033012, isoform CRA_a"
FT                   /note="gene_id=mCG1033012.1 transcript_id=mCT175928.0
FT                   protein_id=mCP98850.0 isoform=CRA_a"
FT                   /protein_id="EDL18358.1"
FT                   /translation="MNDFAGPHTVNHRLKSKGANQSWTKTSATVVSLMCYSDSK"
FT   assembly_gap    15039670..15039689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15054434..15054453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15059756..15059775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15073825..>15075698)
FT                   /locus_tag="mCG_1033011"
FT                   /note="gene_id=mCG1033011.1"
FT   mRNA            complement(join(15073825..15074253,15075664..>15075698))
FT                   /locus_tag="mCG_1033011"
FT                   /product="mCG1033011"
FT                   /note="gene_id=mCG1033011.1 transcript_id=mCT150715.1
FT                   created on 06-FEB-2003"
FT   CDS             complement(15073848..>15074030)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033011"
FT                   /product="mCG1033011"
FT                   /note="gene_id=mCG1033011.1 transcript_id=mCT150715.1
FT                   protein_id=mCP83866.0"
FT                   /protein_id="EDL18355.1"
FT                   /translation="HRCCEIGSYCNVQETKQQELFTQYSPLDLYRMFSKLFWVFCSLSS
FT                   VLISRPLSHKLNKIN"
FT   assembly_gap    15077342..15077361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15086278..15086297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15087404..15087423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15116759..15117530
FT                   /estimated_length=772
FT                   /gap_type="unknown"
FT   assembly_gap    15118574..15118593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15119690..15119709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15129038..15129057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15160288..15161149
FT                   /estimated_length=862
FT                   /gap_type="unknown"
FT   assembly_gap    15162947..15162966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15175546..15175565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15181633..15181652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15188516..15269488
FT                   /gene="Fgf10"
FT                   /locus_tag="mCG_114454"
FT                   /note="gene_id=mCG114454.1"
FT   mRNA            join(15188516..15189601,15261095..15261198,
FT                   15268708..15269488)
FT                   /gene="Fgf10"
FT                   /locus_tag="mCG_114454"
FT                   /product="fibroblast growth factor 10"
FT                   /note="gene_id=mCG114454.1 transcript_id=mCT115546.1
FT                   created on 16-DEC-2002"
FT   CDS             join(15189274..15189601,15261095..15261198,
FT                   15268708..15268905)
FT                   /codon_start=1
FT                   /gene="Fgf10"
FT                   /locus_tag="mCG_114454"
FT                   /product="fibroblast growth factor 10"
FT                   /note="gene_id=mCG114454.1 transcript_id=mCT115546.1
FT                   protein_id=mCP83815.1"
FT                   /protein_id="EDL18354.1"
FT                   /translation="MWKWILTHCASAFPHLPGCCCCFLLLFLVSSFPVTCQALGQDMVS
FT                   QEATNCSSSSSSFSSPSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKN
FT                   EDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYN
FT                   TYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT"
FT   assembly_gap    15205999..15206018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15225169..15225188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15226854..15226873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15227891..15227910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15238016..15238035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15239888..15239907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15240939..15240958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15279219..15280985
FT                   /estimated_length=1767
FT                   /gap_type="unknown"
FT   assembly_gap    15318287..15318533
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    15319395..15319414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15321154..15321189
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    15356778..15359798
FT                   /estimated_length=3021
FT                   /gap_type="unknown"
FT   assembly_gap    15361208..15361227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15366361..15366397
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    15378042..15378134
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    15381036..15381055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15382197..15384588
FT                   /estimated_length=2392
FT                   /gap_type="unknown"
FT   assembly_gap    15385891..15388128
FT                   /estimated_length=2238
FT                   /gap_type="unknown"
FT   assembly_gap    15392345..15392916
FT                   /estimated_length=572
FT                   /gap_type="unknown"
FT   assembly_gap    15397807..15397826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15418206..15418225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15426974..15426993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15428100..15428119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15431240..15431259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15463684..15463703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15464933..15464952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15466584..15466603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15469803..15470549
FT                   /estimated_length=747
FT                   /gap_type="unknown"
FT   assembly_gap    15474615..15477001
FT                   /estimated_length=2387
FT                   /gap_type="unknown"
FT   assembly_gap    15482757..15483253
FT                   /estimated_length=497
FT                   /gap_type="unknown"
FT   assembly_gap    15492070..15492374
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    15500638..15500657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15518325..15518943
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   assembly_gap    15522325..15523162
FT                   /estimated_length=838
FT                   /gap_type="unknown"
FT   assembly_gap    15529442..15529788
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    15531136..15531155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15539245..15540591
FT                   /estimated_length=1347
FT                   /gap_type="unknown"
FT   assembly_gap    15543143..15543498
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    15549074..15549093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15551508..15551600
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    15575850..15575885
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    15579153..15579172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15580649..15581509
FT                   /estimated_length=861
FT                   /gap_type="unknown"
FT   assembly_gap    15582597..15582616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15583758..15583777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15584956..15587791
FT                   /estimated_length=2836
FT                   /gap_type="unknown"
FT   assembly_gap    15601406..15601425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15603508..15603527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15604941..15604960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15607407..15607426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15609191..15609210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15626787..15626806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15628747..15630368
FT                   /estimated_length=1622
FT                   /gap_type="unknown"
FT   assembly_gap    15633578..15633597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15661725..15661744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15664776..15664795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15668100..15668119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15677525..15685275
FT                   /estimated_length=7751
FT                   /gap_type="unknown"
FT   assembly_gap    15688159..15688403
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    15723260..15723284
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    15747104..15747123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15755239..15755439
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    15777359..15777378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15781926..15782446
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   gene            complement(15793132..15888069)
FT                   /gene="Nnt"
FT                   /locus_tag="mCG_1988"
FT                   /note="gene_id=mCG1988.2"
FT   mRNA            complement(join(15793132..15794090,15796056..15796171,
FT                   15797512..15797630,15812324..15812405,15815168..15815327,
FT                   15823960..15824139,15826109..15826269,15827546..15827779,
FT                   15830033..15830228,15832265..15832410,15833358..15833468,
FT                   15834522..15834683,15837429..15837582,15838068..15838259,
FT                   15838826..15838959,15857856..15858043,15862754..15862842,
FT                   15865365..15865452,15871927..15872144,15875430..15875659,
FT                   15883069..15883271,15887969..15888069))
FT                   /gene="Nnt"
FT                   /locus_tag="mCG_1988"
FT                   /product="nicotinamide nucleotide transhydrogenase,
FT                   transcript variant mCT175618"
FT                   /note="gene_id=mCG1988.2 transcript_id=mCT175618.0 created
FT                   on 12-NOV-2002"
FT   mRNA            complement(join(15793132..15794090,15796056..15796171,
FT                   15797512..15797630,15812324..15812405,15815168..15815327,
FT                   15823960..15824139,15826109..15826269,15827546..15827779,
FT                   15857856..15858043,15862754..15862842,15865365..15865452,
FT                   15871927..15872144,15874063..15874293,15883069..15883271,
FT                   15887466..>15887560))
FT                   /gene="Nnt"
FT                   /locus_tag="mCG_1988"
FT                   /product="nicotinamide nucleotide transhydrogenase,
FT                   transcript variant mCT191202"
FT                   /note="gene_id=mCG1988.2 transcript_id=mCT191202.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(15793132..15794090,15796056..15796171,
FT                   15797512..15797630,15812324..15812405,15815168..15815327,
FT                   15823960..15824139,15826109..15826269,15827546..15827779,
FT                   15830033..15830228,15832265..15832410,15833358..15833468,
FT                   15834522..15834683,15837429..15837582,15838068..15838259,
FT                   15838826..15838959,15857856..15858043,15862754..15862842,
FT                   15865365..15865452,15871927..15872144,15875430..15875659,
FT                   15883069..15883271,15887466..15887537))
FT                   /gene="Nnt"
FT                   /locus_tag="mCG_1988"
FT                   /product="nicotinamide nucleotide transhydrogenase,
FT                   transcript variant mCT1208"
FT                   /note="gene_id=mCG1988.2 transcript_id=mCT1208.2 created on
FT                   12-NOV-2002"
FT   mRNA            complement(join(15793212..15794090,15796056..15796171,
FT                   15797512..15797630,15812324..15812405,15815168..15815327,
FT                   15823960..15824139,15826109..15826269,15827546..15827779,
FT                   15830033..15830228,15832265..15832410,15833358..15833468,
FT                   15834522..15834683,15837429..15837582,15838068..15838259,
FT                   15838826..15838959,15857856..15858043,15862754..15862842,
FT                   15865365..15865452,15871927..15872144,15874063..15874293,
FT                   15883069..15883271,15887466..>15887537))
FT                   /gene="Nnt"
FT                   /locus_tag="mCG_1988"
FT                   /product="nicotinamide nucleotide transhydrogenase,
FT                   transcript variant mCT191200"
FT                   /note="gene_id=mCG1988.2 transcript_id=mCT191200.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(15793213..15794090,15796056..15796171,
FT                   15797512..15797630,15812324..15812405,15815168..15815327,
FT                   15823960..15824139,15826109..15826269,15827546..15827779,
FT                   15830033..15830228,15832265..15832410,15857856..15858043,
FT                   15862754..15862842,15865365..15865452,15871927..15872144,
FT                   15874063..15874293,15883069..15883271,15887466..>15887560))
FT                   /gene="Nnt"
FT                   /locus_tag="mCG_1988"
FT                   /product="nicotinamide nucleotide transhydrogenase,
FT                   transcript variant mCT191201"
FT                   /note="gene_id=mCG1988.2 transcript_id=mCT191201.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(15793941..15794090,15796056..15796171,
FT                   15797512..15797630,15812324..15812405,15815168..15815327,
FT                   15823960..15824139,15826109..15826269,15827546..15827779,
FT                   15830033..15830228,15832265..15832410,15833358..15833468,
FT                   15834522..15834683,15837429..15837582,15838068..15838259,
FT                   15838826..15838959,15857856..15858043,15862754..15862842,
FT                   15865365..15865452,15871927..15872144,15875430..15875659,
FT                   15883069..15883219))
FT                   /codon_start=1
FT                   /gene="Nnt"
FT                   /locus_tag="mCG_1988"
FT                   /product="nicotinamide nucleotide transhydrogenase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1988.2 transcript_id=mCT1208.2
FT                   protein_id=mCP7144.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8C1W8"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR030168"
FT                   /db_xref="MGI:MGI:109279"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C1W8"
FT                   /protein_id="EDL18349.1"
FT                   /translation="MAHLLKTVVAGCSCPFLSNLGSSKVLPGKRDFVRMLRTHQALWCK
FT                   SPVKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQALVKQGFNVVVESGAGEASKFPDD
FT                   LYRAAGAQIQGMKEVLASDLVVKVRAPMVNPTLGAHEADFLKPSGTLISFIYPAQNPDL
FT                   LNKLSERKTTVLAMDQVPRVTIAQGYDALSSMANISGYKAVVLAANHFGRFFTGQITAA
FT                   GKVPPAKILIVGGGVAGLASAGAAKSMGAVVRGFDTRAAALEQFKSLGAEPLEVDLKES
FT                   GEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKKAPVLFSKEMIESMKEG
FT                   SVVVDLAAEAGGNFETTKPGELYVHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAI
FT                   SPDKDNFHFEVKDDFDFGTMSHVIRGTVVMKDGKVIFPAPTPKNIPEEAPVKPKTVAEL
FT                   EAEKAGTVSMYTKTLTTASVYSAGLTGMLGLGIVAPNVAFSQMVTTFGLAGIIGYHTVW
FT                   GVTPALHSPLMSVTNAISGLTAVGGLALMGGHFYPSTTSQSLAALATFISSVNIAGGFL
FT                   VTQRMLDMFKRPTDPPEYNYLYLLPGGTFVGGYLAALYGGYNIEEIMYLGSGLCCVGAL
FT                   GGLSTQGTARLGNALGMIGVAGGLAATLGGLKPDPQLLAQMSGAMAMGGTIGLTIAKRI
FT                   QISDLPQLVAAFHSLVGLAAVLTCMAEYIVEYPHFAMDATSNFTKIVAYLGTYIGGVTF
FT                   SGSLVAYGKLQGILKSAPLLLPGRHALNAGLLAASVGGIIPFMADPSFTTGITCLGSVS
FT                   ALSTLMGVTLTAAIGGADMPVVITVLNSYSGWALCAEGFLLNNNLLTIVGALIGSSGAI
FT                   LSYIMCVAMNRSLANVILGGYGTTSTAGGKPMEISGTHTEINLDNAVEMIREANSIVIT
FT                   PGYGLCAAKAQYPIADLVKMLTEQGKKVRFGIHPVAGRMPGQLNVLLAEAGVPYDIVLE
FT                   MDEINSDFPDTDLVLVIGANDTVNSAAQEDPNSIIAGMPVLEVWKSKQVIVMKRSLGVG
FT                   YAAVDNPIFYKPNTAMLLGDAKKTCDALQAKVRESYQK"
FT   CDS             complement(join(15793941..15794090,15796056..15796171,
FT                   15797512..15797630,15812324..15812405,15815168..15815327,
FT                   15823960..15824139,15826109..15826269,15827546..15827779,
FT                   15830033..15830228,15832265..15832410,15833358..15833468,
FT                   15834522..15834683,15837429..15837582,15838068..15838259,
FT                   15838826..15838959,15857856..15858043,15862754..15862842,
FT                   15865365..15865452,15871927..15872144,15875430..15875659,
FT                   15883069..15883219))
FT                   /codon_start=1
FT                   /gene="Nnt"
FT                   /locus_tag="mCG_1988"
FT                   /product="nicotinamide nucleotide transhydrogenase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1988.2 transcript_id=mCT175618.0
FT                   protein_id=mCP98540.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8C1W8"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR030168"
FT                   /db_xref="MGI:MGI:109279"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C1W8"
FT                   /protein_id="EDL18353.1"
FT                   /translation="MAHLLKTVVAGCSCPFLSNLGSSKVLPGKRDFVRMLRTHQALWCK
FT                   SPVKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQALVKQGFNVVVESGAGEASKFPDD
FT                   LYRAAGAQIQGMKEVLASDLVVKVRAPMVNPTLGAHEADFLKPSGTLISFIYPAQNPDL
FT                   LNKLSERKTTVLAMDQVPRVTIAQGYDALSSMANISGYKAVVLAANHFGRFFTGQITAA
FT                   GKVPPAKILIVGGGVAGLASAGAAKSMGAVVRGFDTRAAALEQFKSLGAEPLEVDLKES
FT                   GEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKKAPVLFSKEMIESMKEG
FT                   SVVVDLAAEAGGNFETTKPGELYVHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAI
FT                   SPDKDNFHFEVKDDFDFGTMSHVIRGTVVMKDGKVIFPAPTPKNIPEEAPVKPKTVAEL
FT                   EAEKAGTVSMYTKTLTTASVYSAGLTGMLGLGIVAPNVAFSQMVTTFGLAGIIGYHTVW
FT                   GVTPALHSPLMSVTNAISGLTAVGGLALMGGHFYPSTTSQSLAALATFISSVNIAGGFL
FT                   VTQRMLDMFKRPTDPPEYNYLYLLPGGTFVGGYLAALYGGYNIEEIMYLGSGLCCVGAL
FT                   GGLSTQGTARLGNALGMIGVAGGLAATLGGLKPDPQLLAQMSGAMAMGGTIGLTIAKRI
FT                   QISDLPQLVAAFHSLVGLAAVLTCMAEYIVEYPHFAMDATSNFTKIVAYLGTYIGGVTF
FT                   SGSLVAYGKLQGILKSAPLLLPGRHALNAGLLAASVGGIIPFMADPSFTTGITCLGSVS
FT                   ALSTLMGVTLTAAIGGADMPVVITVLNSYSGWALCAEGFLLNNNLLTIVGALIGSSGAI
FT                   LSYIMCVAMNRSLANVILGGYGTTSTAGGKPMEISGTHTEINLDNAVEMIREANSIVIT
FT                   PGYGLCAAKAQYPIADLVKMLTEQGKKVRFGIHPVAGRMPGQLNVLLAEAGVPYDIVLE
FT                   MDEINSDFPDTDLVLVIGANDTVNSAAQEDPNSIIAGMPVLEVWKSKQVIVMKRSLGVG
FT                   YAAVDNPIFYKPNTAMLLGDAKKTCDALQAKVRESYQK"
FT   CDS             complement(join(15793941..15794090,15796056..15796171,
FT                   15797512..15797630,15812324..15812405,15815168..15815327,
FT                   15823960..15824139,15826109..15826269,15827546..15827779,
FT                   15857856..15858043,15862754..15862842,15865365..15865452,
FT                   15871927..15872144,15874063..>15874272))
FT                   /codon_start=1
FT                   /gene="Nnt"
FT                   /locus_tag="mCG_1988"
FT                   /product="nicotinamide nucleotide transhydrogenase, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG1988.2 transcript_id=mCT191202.0
FT                   protein_id=mCP112166.0 isoform=CRA_d"
FT                   /protein_id="EDL18352.1"
FT                   /translation="QLGSPRKIFQNEKRVALSPAGVQALVKQGFNVVVESGAGEASKFP
FT                   DDLYRAAGAQIQGMKEVLASDLVVKVRAPMVNPTLGAHEADFLKPSGTLISFIYPAQNP
FT                   DLLNKLSERKTTVLAMDQVPRVTIAQGYDALSSMANISGYKAVVLAANHFGRFFTGQIT
FT                   AAGKVPPAKILIVGGGVAGLASAGAAKSMGAVVRGFDTRAAALEQFKSLGAEPLEVDLK
FT                   ESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGLTIAKRIQISDLPQLV
FT                   AAFHSLVGLAAVLTCMAEYIVEYPHFAMDATSNFTKIVAYLGTYIGGVTFSGSLVAYGK
FT                   LQGILKSAPLLLPGRHALNAGLLAASVGGIIPFMADPSFTTGITCLGSVSALSTLMGVT
FT                   LTAAIGGADMPVVITVLNSYSGWALCAEGFLLNNNLLTIVGALIGSSGAILSYIMCVAM
FT                   NRSLANVILGGYGTTSTAGGKPMEISGTHTEINLDNAVEMIREANSIVITPGYGLCAAK
FT                   AQYPIADLVKMLTEQGKKVRFGIHPVAGRMPGQLNVLLAEAGVPYDIVLEMDEINSDFP
FT                   DTDLVLVIGANDTVNSAAQEDPNSIIAGMPVLEVWKSKQVIVMKRSLGVGYAAVDNPIF
FT                   YKPNTAMLLGDAKKTCDALQAKVRESYQK"
FT   CDS             complement(join(15793941..15794090,15796056..15796171,
FT                   15797512..15797630,15812324..15812405,15815168..15815327,
FT                   15823960..15824139,15826109..15826269,15827546..15827779,
FT                   15830033..15830228,15832265..15832410,15857856..15858043,
FT                   15862754..15862842,15865365..15865452,15871927..15872144,
FT                   15874063..>15874272))
FT                   /codon_start=1
FT                   /gene="Nnt"
FT                   /locus_tag="mCG_1988"
FT                   /product="nicotinamide nucleotide transhydrogenase, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1988.2 transcript_id=mCT191201.0
FT                   protein_id=mCP112165.0 isoform=CRA_c"
FT                   /protein_id="EDL18351.1"
FT                   /translation="QLGSPRKIFQNEKRVALSPAGVQALVKQGFNVVVESGAGEASKFP
FT                   DDLYRAAGAQIQGMKEVLASDLVVKVRAPMVNPTLGAHEADFLKPSGTLISFIYPAQNP
FT                   DLLNKLSERKTTVLAMDQVPRVTIAQGYDALSSMANISGYKAVVLAANHFGRFFTGQIT
FT                   AAGKVPPAKILIVGGGVAGLASAGAAKSMGAVVRGFDTRAAALEQFKSLGAEPLEVDLK
FT                   ESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGGFLVTQRMLDMFKRPT
FT                   DPPEYNYLYLLPGGTFVGGYLAALYGGYNIEEIMYLGSGLCCVGALGGLSTQGTARLGN
FT                   ALGMIGVAGGLAATLGGLKPDPQLLAQMSGAMAMGGTIGLTIAKRIQISDLPQLVAAFH
FT                   SLVGLAAVLTCMAEYIVEYPHFAMDATSNFTKIVAYLGTYIGGVTFSGSLVAYGKLQGI
FT                   LKSAPLLLPGRHALNAGLLAASVGGIIPFMADPSFTTGITCLGSVSALSTLMGVTLTAA
FT                   IGGADMPVVITVLNSYSGWALCAEGFLLNNNLLTIVGALIGSSGAILSYIMCVAMNRSL
FT                   ANVILGGYGTTSTAGGKPMEISGTHTEINLDNAVEMIREANSIVITPGYGLCAAKAQYP
FT                   IADLVKMLTEQGKKVRFGIHPVAGRMPGQLNVLLAEAGVPYDIVLEMDEINSDFPDTDL
FT                   VLVIGANDTVNSAAQEDPNSIIAGMPVLEVWKSKQVIVMKRSLGVGYAAVDNPIFYKPN
FT                   TAMLLGDAKKTCDALQAKVRESYQK"
FT   CDS             complement(join(15793941..15794090,15796056..15796171,
FT                   15797512..15797630,15812324..15812405,15815168..15815327,
FT                   15823960..15824139,15826109..15826269,15827546..15827779,
FT                   15830033..15830228,15832265..15832410,15833358..15833468,
FT                   15834522..15834683,15837429..15837582,15838068..15838259,
FT                   15838826..15838959,15857856..15858043,15862754..15862842,
FT                   15865365..15865452,15871927..15872144,15874063..>15874272))
FT                   /codon_start=1
FT                   /gene="Nnt"
FT                   /locus_tag="mCG_1988"
FT                   /product="nicotinamide nucleotide transhydrogenase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1988.2 transcript_id=mCT191200.0
FT                   protein_id=mCP112164.0 isoform=CRA_b"
FT                   /protein_id="EDL18350.1"
FT                   /translation="QLGSPRKIFQNEKRVALSPAGVQALVKQGFNVVVESGAGEASKFP
FT                   DDLYRAAGAQIQGMKEVLASDLVVKVRAPMVNPTLGAHEADFLKPSGTLISFIYPAQNP
FT                   DLLNKLSERKTTVLAMDQVPRVTIAQGYDALSSMANISGYKAVVLAANHFGRFFTGQIT
FT                   AAGKVPPAKILIVGGGVAGLASAGAAKSMGAVVRGFDTRAAALEQFKSLGAEPLEVDLK
FT                   ESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKKAPVLFSKEMIESMK
FT                   EGSVVVDLAAEAGGNFETTKPGELYVHKGITHIGYTDLPSRMATQASTLYSNNITKLLK
FT                   AISPDKDNFHFEVKDDFDFGTMSHVIRGTVVMKDGKVIFPAPTPKNIPEEAPVKPKTVA
FT                   ELEAEKAGTVSMYTKTLTTASVYSAGLTGMLGLGIVAPNVAFSQMVTTFGLAGIIGYHT
FT                   VWGVTPALHSPLMSVTNAISGLTAVGGLALMGGHFYPSTTSQSLAALATFISSVNIAGG
FT                   FLVTQRMLDMFKRPTDPPEYNYLYLLPGGTFVGGYLAALYGGYNIEEIMYLGSGLCCVG
FT                   ALGGLSTQGTARLGNALGMIGVAGGLAATLGGLKPDPQLLAQMSGAMAMGGTIGLTIAK
FT                   RIQISDLPQLVAAFHSLVGLAAVLTCMAEYIVEYPHFAMDATSNFTKIVAYLGTYIGGV
FT                   TFSGSLVAYGKLQGILKSAPLLLPGRHALNAGLLAASVGGIIPFMADPSFTTGITCLGS
FT                   VSALSTLMGVTLTAAIGGADMPVVITVLNSYSGWALCAEGFLLNNNLLTIVGALIGSSG
FT                   AILSYIMCVAMNRSLANVILGGYGTTSTAGGKPMEISGTHTEINLDNAVEMIREANSIV
FT                   ITPGYGLCAAKAQYPIADLVKMLTEQGKKVRFGIHPVAGRMPGQLNVLLAEAGVPYDIV
FT                   LEMDEINSDFPDTDLVLVIGANDTVNSAAQEDPNSIIAGMPVLEVWKSKQVIVMKRSLG
FT                   VGYAAVDNPIFYKPNTAMLLGDAKKTCDALQAKVRESYQK"
FT   assembly_gap    15806226..15806427
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    15840523..15840567
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    15843440..15843459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15844735..15844754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15846018..15846432
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    15848126..15848457
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    15851428..15851447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15856238..15856257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15869288..15869307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15874417..15874436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15876858..15876877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15884052..15884071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15887134..15887163
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    15894344..15894363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15896089..15896108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15897628..15897647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15908392..15909857
FT                   /estimated_length=1466
FT                   /gap_type="unknown"
FT   gene            <15910186..15938489
FT                   /gene="Paip1"
FT                   /locus_tag="mCG_1990"
FT                   /note="gene_id=mCG1990.2"
FT   mRNA            join(<15910186..15910365,15918003..15918188,
FT                   15920972..15921084,15925953..15926064,15927928..15928053,
FT                   15930111..15930217,15930903..15931020,15932000..15932054,
FT                   15935905..15935998,15937197..15938489)
FT                   /gene="Paip1"
FT                   /locus_tag="mCG_1990"
FT                   /product="polyadenylate binding protein-interacting protein
FT                   1"
FT                   /note="gene_id=mCG1990.2 transcript_id=mCT1210.2 created on
FT                   26-NOV-2002"
FT   CDS             join(<15910186..15910365,15918003..15918188,
FT                   15920972..15921084,15925953..15926064,15927928..15928053,
FT                   15930111..15930217,15930903..15931020,15932000..15932054,
FT                   15935905..15935998,15937197..15937290)
FT                   /codon_start=1
FT                   /gene="Paip1"
FT                   /locus_tag="mCG_1990"
FT                   /product="polyadenylate binding protein-interacting protein
FT                   1"
FT                   /note="gene_id=mCG1990.2 transcript_id=mCT1210.2
FT                   protein_id=mCP7141.2"
FT                   /protein_id="EDL18348.1"
FT                   /translation="SFSEQTKPQRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLSA
FT                   NAPEFYPSGYSSNYTESYEDGCEDYPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNG
FT                   WVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRT
FT                   EYEAKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQVTRADILQVGLRELLNAL
FT                   FSNPMDDNLICAVKLLKLTGSVLEDTWKEKGKTDMEEIIQRIENVVLDANCSRDVKQML
FT                   LKLVELRSSNWGRVHATSTYREATPENDPNYFMNEPTFYTSDGVPFTAADPDYQEKYQE
FT                   LLEREDFFPDYEENGTDLSGAGDPYLDDIDDEMDPEIEEAYEKFCLESERKRKQ"
FT   assembly_gap    15920275..15920294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15942959..15968242
FT                   /gene="4833420G17Rik"
FT                   /locus_tag="mCG_1987"
FT                   /note="gene_id=mCG1987.2"
FT   mRNA            join(15942959..15943320,15944767..15944892,
FT                   15945482..15946506,15948979..15949068,15951628..15952274,
FT                   15954236..15954337,15955930..15956053,15956930..15957021,
FT                   15958036..15958105,15959783..15959953,15961548..15961642,
FT                   15963055..15963150,15966584..15966624,15967852..15968242)
FT                   /gene="4833420G17Rik"
FT                   /locus_tag="mCG_1987"
FT                   /product="RIKEN cDNA 4833420G17, transcript variant
FT                   mCT175615"
FT                   /note="gene_id=mCG1987.2 transcript_id=mCT175615.1 created
FT                   on 11-JUN-2003"
FT   mRNA            join(15942959..15943320,15944767..15944892,
FT                   15946213..15946506,15948979..15949068,15951628..15952274,
FT                   15954236..15954337,15955930..15956053,15956930..15957021,
FT                   15958036..15958105,15959783..15959953,15961548..15961642,
FT                   15963055..15963150,15966584..15966624,15967852..15968242)
FT                   /gene="4833420G17Rik"
FT                   /locus_tag="mCG_1987"
FT                   /product="RIKEN cDNA 4833420G17, transcript variant
FT                   mCT175617"
FT                   /note="gene_id=mCG1987.2 transcript_id=mCT175617.1 created
FT                   on 11-JUN-2003"
FT   mRNA            join(15942959..15943320,15944767..15944892,
FT                   15946276..15946506,15946843..15946932,15951628..15952274,
FT                   15954236..15954337,15955930..15956053,15956930..15957021,
FT                   15958036..15958105,15959783..15959953,15961548..15961642,
FT                   15963055..15963150,15966584..15966624,15967852..15968242)
FT                   /gene="4833420G17Rik"
FT                   /locus_tag="mCG_1987"
FT                   /product="RIKEN cDNA 4833420G17, transcript variant
FT                   mCT175616"
FT                   /note="gene_id=mCG1987.2 transcript_id=mCT175616.1 created
FT                   on 11-JUN-2003"
FT   mRNA            join(15942959..15943320,15946213..15946506,
FT                   15948979..15949068,15951628..15952274,15954236..15954337,
FT                   15955930..15956053,15956930..15957021,15958036..15958105,
FT                   15959783..15959953,15961548..15961642,15963055..15963150,
FT                   15966584..15966624,15967852..15968242)
FT                   /gene="4833420G17Rik"
FT                   /locus_tag="mCG_1987"
FT                   /product="RIKEN cDNA 4833420G17, transcript variant
FT                   mCT1213"
FT                   /note="gene_id=mCG1987.2 transcript_id=mCT1213.3 created on
FT                   11-JUN-2003"
FT   mRNA            join(15942959..15943320,15946276..15946506,
FT                   15948979..15949068,15951628..15952274,15954236..15954337,
FT                   15955930..15956053,15956930..15957021,15958036..15958105,
FT                   15959783..15959953,15961548..15961642,15963055..15963150,
FT                   15966584..15966624,15967852..15968242)
FT                   /gene="4833420G17Rik"
FT                   /locus_tag="mCG_1987"
FT                   /product="RIKEN cDNA 4833420G17, transcript variant
FT                   mCT175614"
FT                   /note="gene_id=mCG1987.2 transcript_id=mCT175614.1 created
FT                   on 11-JUN-2003"
FT   CDS             join(15946306..15946506,15946843..15946932,
FT                   15951628..15952274,15954236..15954337,15955930..15956053,
FT                   15956930..15957021,15958036..15958105,15959783..15959953,
FT                   15961548..15961642,15963055..15963150,15966584..15966624,
FT                   15967852..15968042)
FT                   /codon_start=1
FT                   /gene="4833420G17Rik"
FT                   /locus_tag="mCG_1987"
FT                   /product="RIKEN cDNA 4833420G17, isoform CRA_b"
FT                   /note="gene_id=mCG1987.2 transcript_id=mCT175616.1
FT                   protein_id=mCP98538.0 isoform=CRA_b"
FT                   /protein_id="EDL18344.1"
FT                   /translation="MGMAAEVRMVLYEDDSVQVHYACGSTLQLSPCGSEFLFEKALPPS
FT                   THPLEQPERIRQRTHFVISNYREQLQRALDFRNSSATCPFLSENIIPPERKKHIFIDFS
FT                   EVEWPSLDRDDCIMYSESGVVKITSLDGHAYLCLPRSQHEFTVHFLCKVSQRPDSSGIL
FT                   SETQNQDPKNKLVEKTRKVCRCGNLSEQTLRNKENEPPYQILKSKNASVNTCCVNDSEG
FT                   RGELPSLGTNHRCVYAWVKQAWSVAACPEAWKHPLSLALRFYNKVRAASEIDADFPASS
FT                   IVTSDCPEERGMEVSVLPRALLLSCPAPHMHRWTFCDSLLQRQPDAEDFSYPELVKVVW
FT                   YKGVTYRLTHKNVNSIEIFPGDGSVFKSEGAHFGNYFTYYPSQEESEKREEKTYSVNNL
FT                   PPDRPGNFFSVRSLIKQATRILQHCAKIRLSLSHNYRVCCWKMAPGVSVSTILPVLLKE
FT                   SLIPGVGRFLAYSDDKVHAVFLDGVTVTLNWHLSSSAEKKQVDQGLSFGWCRLTFPDGQ
FT                   DQLIPTEHPGAYERYVTSVISWCRGLTQTSPRRVPTHLSPALKENWSVASELEKIQKFN
FT                   WLLENSGVLNLTSSKNEQCSGHCKSGSSETLLEATNEERVSVALKRTSEILQDIDRLLS
FT                   LSRK"
FT   CDS             join(15946306..15946506,15948979..15949068,
FT                   15951628..15952274,15954236..15954337,15955930..15956053,
FT                   15956930..15957021,15958036..15958105,15959783..15959953,
FT                   15961548..15961642,15963055..15963150,15966584..15966624,
FT                   15967852..15968042)
FT                   /codon_start=1
FT                   /gene="4833420G17Rik"
FT                   /locus_tag="mCG_1987"
FT                   /product="RIKEN cDNA 4833420G17, isoform CRA_a"
FT                   /note="gene_id=mCG1987.2 transcript_id=mCT175615.1
FT                   protein_id=mCP98539.1 isoform=CRA_a"
FT                   /protein_id="EDL18343.1"
FT                   /translation="MGMAAEVRMVLYEDDSVQVHYACGSTLQLSPCGSEFLFEKALPPS
FT                   THPLEQPERIRQRTHFVISNYREQLQRALDFRNSSATCPFLSESIIPPERKKHIFIDFS
FT                   EVEWPSLDRDDCIMYSESGVVKITSLDGHAYLCLPRSQHEFTVHFLCKVSQRPDSSGIL
FT                   SETQNQDPKNKLVEKTRKVCRCGNLSEQTLRNKENEPPYQILKSKNASVNTCCVNDSEG
FT                   RGELPSLGTNHRCVYAWVKQAWSVAACPEAWKHPLSLALRFYNKVRAASEIDADFPASS
FT                   IVTSDCPEERGMEVSVLPRALLLSCPAPHMHRWTFCDSLLQRQPDAEDFSYPELVKVVW
FT                   YKGVTYRLTHKNVNSIEIFPGDGSVFKSEGAHFGNYFTYYPSQEESEKREEKTYSVNNL
FT                   PPDRPGNFFSVRSLIKQATRILQHCAKIRLSLSHNYRVCCWKMAPGVSVSTILPVLLKE
FT                   SLIPGVGRFLAYSDDKVHAVFLDGVTVTLNWHLSSSAEKKQVDQGLSFGWCRLTFPDGQ
FT                   DQLIPTEHPGAYERYVTSVISWCRGLTQTSPRRVPTHLSPALKENWSVASELEKIQKFN
FT                   WLLENSGVLNLTSSKNEQCSGHCKSGSSETLLEATNEERVSVALKRTSEILQDIDRLLS
FT                   LSRK"
FT   CDS             join(15946306..15946506,15948979..15949068,
FT                   15951628..15952274,15954236..15954337,15955930..15956053,
FT                   15956930..15957021,15958036..15958105,15959783..15959953,
FT                   15961548..15961642,15963055..15963150,15966584..15966624,
FT                   15967852..15968042)
FT                   /codon_start=1
FT                   /gene="4833420G17Rik"
FT                   /locus_tag="mCG_1987"
FT                   /product="RIKEN cDNA 4833420G17, isoform CRA_a"
FT                   /note="gene_id=mCG1987.2 transcript_id=mCT175617.1
FT                   protein_id=mCP98536.1 isoform=CRA_a"
FT                   /protein_id="EDL18345.1"
FT                   /translation="MGMAAEVRMVLYEDDSVQVHYACGSTLQLSPCGSEFLFEKALPPS
FT                   THPLEQPERIRQRTHFVISNYREQLQRALDFRNSSATCPFLSESIIPPERKKHIFIDFS
FT                   EVEWPSLDRDDCIMYSESGVVKITSLDGHAYLCLPRSQHEFTVHFLCKVSQRPDSSGIL
FT                   SETQNQDPKNKLVEKTRKVCRCGNLSEQTLRNKENEPPYQILKSKNASVNTCCVNDSEG
FT                   RGELPSLGTNHRCVYAWVKQAWSVAACPEAWKHPLSLALRFYNKVRAASEIDADFPASS
FT                   IVTSDCPEERGMEVSVLPRALLLSCPAPHMHRWTFCDSLLQRQPDAEDFSYPELVKVVW
FT                   YKGVTYRLTHKNVNSIEIFPGDGSVFKSEGAHFGNYFTYYPSQEESEKREEKTYSVNNL
FT                   PPDRPGNFFSVRSLIKQATRILQHCAKIRLSLSHNYRVCCWKMAPGVSVSTILPVLLKE
FT                   SLIPGVGRFLAYSDDKVHAVFLDGVTVTLNWHLSSSAEKKQVDQGLSFGWCRLTFPDGQ
FT                   DQLIPTEHPGAYERYVTSVISWCRGLTQTSPRRVPTHLSPALKENWSVASELEKIQKFN
FT                   WLLENSGVLNLTSSKNEQCSGHCKSGSSETLLEATNEERVSVALKRTSEILQDIDRLLS
FT                   LSRK"
FT   CDS             join(15946306..15946506,15948979..15949068,
FT                   15951628..15952274,15954236..15954337,15955930..15956053,
FT                   15956930..15957021,15958036..15958105,15959783..15959953,
FT                   15961548..15961642,15963055..15963150,15966584..15966624,
FT                   15967852..15968042)
FT                   /codon_start=1
FT                   /gene="4833420G17Rik"
FT                   /locus_tag="mCG_1987"
FT                   /product="RIKEN cDNA 4833420G17, isoform CRA_a"
FT                   /note="gene_id=mCG1987.2 transcript_id=mCT1213.3
FT                   protein_id=mCP7143.3 isoform=CRA_a"
FT                   /protein_id="EDL18346.1"
FT                   /translation="MGMAAEVRMVLYEDDSVQVHYACGSTLQLSPCGSEFLFEKALPPS
FT                   THPLEQPERIRQRTHFVISNYREQLQRALDFRNSSATCPFLSESIIPPERKKHIFIDFS
FT                   EVEWPSLDRDDCIMYSESGVVKITSLDGHAYLCLPRSQHEFTVHFLCKVSQRPDSSGIL
FT                   SETQNQDPKNKLVEKTRKVCRCGNLSEQTLRNKENEPPYQILKSKNASVNTCCVNDSEG
FT                   RGELPSLGTNHRCVYAWVKQAWSVAACPEAWKHPLSLALRFYNKVRAASEIDADFPASS
FT                   IVTSDCPEERGMEVSVLPRALLLSCPAPHMHRWTFCDSLLQRQPDAEDFSYPELVKVVW
FT                   YKGVTYRLTHKNVNSIEIFPGDGSVFKSEGAHFGNYFTYYPSQEESEKREEKTYSVNNL
FT                   PPDRPGNFFSVRSLIKQATRILQHCAKIRLSLSHNYRVCCWKMAPGVSVSTILPVLLKE
FT                   SLIPGVGRFLAYSDDKVHAVFLDGVTVTLNWHLSSSAEKKQVDQGLSFGWCRLTFPDGQ
FT                   DQLIPTEHPGAYERYVTSVISWCRGLTQTSPRRVPTHLSPALKENWSVASELEKIQKFN
FT                   WLLENSGVLNLTSSKNEQCSGHCKSGSSETLLEATNEERVSVALKRTSEILQDIDRLLS
FT                   LSRK"
FT   CDS             join(15946306..15946506,15948979..15949068,
FT                   15951628..15952274,15954236..15954337,15955930..15956053,
FT                   15956930..15957021,15958036..15958105,15959783..15959953,
FT                   15961548..15961642,15963055..15963150,15966584..15966624,
FT                   15967852..15968042)
FT                   /codon_start=1
FT                   /gene="4833420G17Rik"
FT                   /locus_tag="mCG_1987"
FT                   /product="RIKEN cDNA 4833420G17, isoform CRA_a"
FT                   /note="gene_id=mCG1987.2 transcript_id=mCT175614.1
FT                   protein_id=mCP98537.1 isoform=CRA_a"
FT                   /protein_id="EDL18347.1"
FT                   /translation="MGMAAEVRMVLYEDDSVQVHYACGSTLQLSPCGSEFLFEKALPPS
FT                   THPLEQPERIRQRTHFVISNYREQLQRALDFRNSSATCPFLSESIIPPERKKHIFIDFS
FT                   EVEWPSLDRDDCIMYSESGVVKITSLDGHAYLCLPRSQHEFTVHFLCKVSQRPDSSGIL
FT                   SETQNQDPKNKLVEKTRKVCRCGNLSEQTLRNKENEPPYQILKSKNASVNTCCVNDSEG
FT                   RGELPSLGTNHRCVYAWVKQAWSVAACPEAWKHPLSLALRFYNKVRAASEIDADFPASS
FT                   IVTSDCPEERGMEVSVLPRALLLSCPAPHMHRWTFCDSLLQRQPDAEDFSYPELVKVVW
FT                   YKGVTYRLTHKNVNSIEIFPGDGSVFKSEGAHFGNYFTYYPSQEESEKREEKTYSVNNL
FT                   PPDRPGNFFSVRSLIKQATRILQHCAKIRLSLSHNYRVCCWKMAPGVSVSTILPVLLKE
FT                   SLIPGVGRFLAYSDDKVHAVFLDGVTVTLNWHLSSSAEKKQVDQGLSFGWCRLTFPDGQ
FT                   DQLIPTEHPGAYERYVTSVISWCRGLTQTSPRRVPTHLSPALKENWSVASELEKIQKFN
FT                   WLLENSGVLNLTSSKNEQCSGHCKSGSSETLLEATNEERVSVALKRTSEILQDIDRLLS
FT                   LSRK"
FT   assembly_gap    15948490..15948509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15968983..15969695
FT                   /estimated_length=713
FT                   /gap_type="unknown"
FT   gene            complement(15969742..>15970723)
FT                   /locus_tag="mCG_114444"
FT                   /note="gene_id=mCG114444.0"
FT   mRNA            complement(15969742..>15970723)
FT                   /locus_tag="mCG_114444"
FT                   /product="mCG114444"
FT                   /note="gene_id=mCG114444.0 transcript_id=mCT115536.0
FT                   created on 11-NOV-2002"
FT   CDS             complement(15970333..>15970722)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114444"
FT                   /product="mCG114444"
FT                   /note="gene_id=mCG114444.0 transcript_id=mCT115536.0
FT                   protein_id=mCP83932.0"
FT                   /protein_id="EDL18342.1"
FT                   /translation="VCAHRVTPLTTMLTCGGRDGEAPRRLQGTPWVGGSTAQTFLTSCS
FT                   GRHRADDAGSRDLSDQTHRSASPPPWGFLKALLLTGGGDTGDGRRLISGHRGQSKKAQR
FT                   LRTLTALHTMHPESLCWARLQNRFR"
FT   gene            <15970551..16015976
FT                   /locus_tag="mCG_114452"
FT                   /note="gene_id=mCG114452.1"
FT   mRNA            join(<15970551..15970681,16012863..16013244,
FT                   16015406..16015976)
FT                   /locus_tag="mCG_114452"
FT                   /product="mCG114452"
FT                   /note="gene_id=mCG114452.1 transcript_id=mCT115544.1
FT                   created on 04-FEB-2003"
FT   CDS             join(<15970551..15970681,16012863..16013244,
FT                   16015406..16015741)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114452"
FT                   /product="mCG114452"
FT                   /note="gene_id=mCG114452.1 transcript_id=mCT115544.1
FT                   protein_id=mCP83970.0"
FT                   /protein_id="EDL18340.1"
FT                   /translation="GRAILHRLPCGVHCRTLGTSEPSSPRPTVCPAAGEGLLHPGRHRM
FT                   LGMRTRIACWFLTAFTILTQLTMASKVEKTHALPPCCSTESLISSIGLGIFCLVADRFL
FT                   RFPIIQHNDWLRAISDNIVHGVIGMWSWAVVTGIRKKSDFGEVLLAGFLASVIDVDHFF
FT                   QARSLSLQAALTLPRRPFLHCSTVIPIAVLSVKLAVHLFKLRDSWRFLPWMILVSWTSH
FT                   HIRDGIRHGLWICPFGKTPPLPSSFYVISTLSLPHLCSFLMYLTGTRQTVSSKYGMRID
FT                   V"
FT   assembly_gap    15970724..15988699
FT                   /estimated_length=17976
FT                   /gap_type="unknown"
FT   gene            complement(<15996560..>15999589)
FT                   /locus_tag="mCG_1032950"
FT                   /note="gene_id=mCG1032950.1"
FT   mRNA            complement(join(<15996560..15996929,15998048..15998418,
FT                   15999505..>15999589))
FT                   /locus_tag="mCG_1032950"
FT                   /product="mCG1032950"
FT                   /note="gene_id=mCG1032950.1 transcript_id=mCT150654.1
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(<15996560..15996929,15998048..15998418,
FT                   15999505..>15999533))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032950"
FT                   /product="mCG1032950"
FT                   /note="gene_id=mCG1032950.1 transcript_id=mCT150654.1
FT                   protein_id=mCP83784.1"
FT                   /protein_id="EDL18341.1"
FT                   /translation="GPPARDPQPPDPDPTPASTRHGRHPQRCHPRERTRRRGRRGQDVS
FT                   AIPTGRTDGQTPQGRKPAPTAPPHPPRHTGHTRAPRLHRHTRHTRQAGQAHASAGRLAR
FT                   HADTDARRGQDVCATDPRPAGRMDGQTPSASTGHCRRPQRRRPREHTRRRGRRGQESLP
FT                   SPRDGWTDGLHKVGSLRRPHRCTHHSTQDTRGPRARTGTHGTHGRQARHTHPRDAAPAT
FT                   QTRTPAAVKMFTRRGQDVCANDPRPGGRTDARHQV"
FT   assembly_gap    16008983..16009725
FT                   /estimated_length=743
FT                   /gap_type="unknown"
FT   assembly_gap    16011714..16011733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16012540..16012559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16015977..16020326
FT                   /estimated_length=4350
FT                   /gap_type="unknown"
FT   gene            16029607..16063087
FT                   /gene="Ccl28"
FT                   /locus_tag="mCG_114447"
FT                   /note="gene_id=mCG114447.1"
FT   mRNA            join(16029607..16029737,16057566..16057692,
FT                   16062652..16063087)
FT                   /gene="Ccl28"
FT                   /locus_tag="mCG_114447"
FT                   /product="chemokine (C-C motif) ligand 28"
FT                   /note="gene_id=mCG114447.1 transcript_id=mCT115539.1
FT                   created on 16-DEC-2002"
FT   CDS             join(16029674..16029737,16057566..16057692,
FT                   16062652..16062853)
FT                   /codon_start=1
FT                   /gene="Ccl28"
FT                   /locus_tag="mCG_114447"
FT                   /product="chemokine (C-C motif) ligand 28"
FT                   /note="gene_id=mCG114447.1 transcript_id=mCT115539.1
FT                   protein_id=mCP83951.1"
FT                   /protein_id="EDL18339.1"
FT                   /translation="MQQAGLTLMAVAVCVAFQTSEAILPMASSCCTEVSHHVSGRLLER
FT                   VSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQ
FT                   PSRKDRKGHTTRKHRTRGTHRHEASR"
FT   assembly_gap    16030071..16030165
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    16037224..16037911
FT                   /estimated_length=688
FT                   /gap_type="unknown"
FT   assembly_gap    16047288..16047335
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    16048914..16048933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16050324..16050343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16051839..16051858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16053333..16053352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16054406..16054425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16063877..16063896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16066388..16066437
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            complement(16067957..16068335)
FT                   /pseudo
FT                   /locus_tag="mCG_1033007"
FT                   /note="gene_id=mCG1033007.1"
FT   mRNA            complement(16067957..16068335)
FT                   /pseudo
FT                   /locus_tag="mCG_1033007"
FT                   /note="gene_id=mCG1033007.1 transcript_id=mCT150711.1
FT                   created on 04-FEB-2003"
FT   assembly_gap    16072478..16072497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16077222..16077241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16078874..16078893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16081850..16083346
FT                   /locus_tag="mCG_1033006"
FT                   /note="gene_id=mCG1033006.1"
FT   mRNA            join(16081850..16082087,16082518..16082561,
FT                   16083085..16083346)
FT                   /locus_tag="mCG_1033006"
FT                   /product="mCG1033006"
FT                   /note="gene_id=mCG1033006.1 transcript_id=mCT150710.1
FT                   created on 20-NOV-2002"
FT   CDS             16083121..16083312
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033006"
FT                   /product="mCG1033006"
FT                   /note="gene_id=mCG1033006.1 transcript_id=mCT150710.1
FT                   protein_id=mCP83853.1"
FT                   /protein_id="EDL18338.1"
FT                   /translation="MFPLQLLWQSSKAVWERLVTVAKRSRTGDTNHNLSVLERPLIPLL
FT                   ADQTPYHPPCLSSLFQIV"
FT   assembly_gap    16086635..16086654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16090063..16090082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <16095118..16112954
FT                   /gene="Hmgcs1"
FT                   /locus_tag="mCG_8022"
FT                   /note="gene_id=mCG8022.2"
FT   mRNA            join(<16095118..16095185,16099662..16099720,
FT                   16104356..16104813,16105200..16105325,16105768..16105932,
FT                   16107227..16107392,16108212..16108382,16109118..16109224,
FT                   16109750..16109875,16110041..16110204,16111082..16112954)
FT                   /gene="Hmgcs1"
FT                   /locus_tag="mCG_8022"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1,
FT                   transcript variant mCT7177"
FT                   /note="gene_id=mCG8022.2 transcript_id=mCT7177.2 created on
FT                   26-NOV-2002"
FT   mRNA            join(<16095118..16095185,16104356..16104813,
FT                   16105200..16105325,16105768..16105932,16107227..16107392,
FT                   16108212..16108382,16109118..16109224,16109750..16109875,
FT                   16110041..16110204,16111082..16112953)
FT                   /gene="Hmgcs1"
FT                   /locus_tag="mCG_8022"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1,
FT                   transcript variant mCT176216"
FT                   /note="gene_id=mCG8022.2 transcript_id=mCT176216.0 created
FT                   on 26-NOV-2002"
FT   CDS             join(<16095118..16095185,16104356..16104813,
FT                   16105200..16105325,16105768..16105932,16107227..16107392,
FT                   16108212..16108382,16109118..16109224,16109750..16109875,
FT                   16110041..16110204,16111082..16111171)
FT                   /codon_start=1
FT                   /gene="Hmgcs1"
FT                   /locus_tag="mCG_8022"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG8022.2 transcript_id=mCT176216.0
FT                   protein_id=mCP99138.0 isoform=CRA_a"
FT                   /protein_id="EDL18336.1"
FT                   /translation="GREARSAVSLLCSFFFQGLIPFGSFTMPGSLPLNAEACWPKDVGI
FT                   VALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQARMGFCTDREDINSLCLTVVQKLME
FT                   RHSLSYDCIGRLEVGTETIIDKSKSVKSNLMQLFEESGNTDIEGIDTTNACYGGTAAVF
FT                   NAVNWVESSSWDGRYALVVAGDIAIYATGNARPTGGVGAVALLIGPNAPLIFDRGLRGT
FT                   HMQHAYDFYKPDMLSEYPVVDGKLSIQCYLSALDRCYSVYRKKIRAQWQKEGKDKDFTL
FT                   NDFGFMIFHSPYCKLVQKSLARMFLNDFLNDQNRDKNSIYSGLEAFGDVKLEDTYFDRD
FT                   VEKAFMKASSELFNQKTKASLLVSNQNGNMYTSSVYGSLASVLAQYSPQQLAGKRVGVF
FT                   SYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTCVAPDVFAENMKLRED
FT                   THHLANYIPQCSIDSLFEGTWYLVRVDEKHRRTYARRPFTNDHSLDEGMGLVHSNTATE
FT                   HIPSPAKKVPRLPATSAESESAVISNGEH"
FT   CDS             join(<16095120..16095185,16099662..16099720,
FT                   16104356..16104813,16105200..16105325,16105768..16105932,
FT                   16107227..16107392,16108212..16108382,16109118..16109224,
FT                   16109750..16109875,16110041..16110204,16111082..16111171)
FT                   /codon_start=1
FT                   /gene="Hmgcs1"
FT                   /locus_tag="mCG_8022"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG8022.2 transcript_id=mCT7177.2
FT                   protein_id=mCP6447.2 isoform=CRA_b"
FT                   /protein_id="EDL18337.1"
FT                   /translation="AGGTVCGLLALLVLLPGSDPLWWLKEEPVTDLETTVLCPSHSSFT
FT                   MPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQARMGFC
FT                   TDREDINSLCLTVVQKLMERHSLSYDCIGRLEVGTETIIDKSKSVKSNLMQLFEESGNT
FT                   DIEGIDTTNACYGGTAAVFNAVNWVESSSWDGRYALVVAGDIAIYATGNARPTGGVGAV
FT                   ALLIGPNAPLIFDRGLRGTHMQHAYDFYKPDMLSEYPVVDGKLSIQCYLSALDRCYSVY
FT                   RKKIRAQWQKEGKDKDFTLNDFGFMIFHSPYCKLVQKSLARMFLNDFLNDQNRDKNSIY
FT                   SGLEAFGDVKLEDTYFDRDVEKAFMKASSELFNQKTKASLLVSNQNGNMYTSSVYGSLA
FT                   SVLAQYSPQQLAGKRVGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLD
FT                   SRTCVAPDVFAENMKLREDTHHLANYIPQCSIDSLFEGTWYLVRVDEKHRRTYARRPFT
FT                   NDHSLDEGMGLVHSNTATEHIPSPAKKVPRLPATSAESESAVISNGEH"
FT   gene            complement(16114782..>16160994)
FT                   /gene="E130304F04Rik"
FT                   /locus_tag="mCG_114448"
FT                   /note="gene_id=mCG114448.1"
FT   mRNA            complement(join(16114782..16117483,16118790..16119058,
FT                   16132231..16133172,16160806..>16160994))
FT                   /gene="E130304F04Rik"
FT                   /locus_tag="mCG_114448"
FT                   /product="RIKEN cDNA E130304F04, transcript variant
FT                   mCT115540"
FT                   /note="gene_id=mCG114448.1 transcript_id=mCT115540.1
FT                   created on 04-FEB-2003"
FT   mRNA            complement(join(16116617..16117483,16118790..16119053,
FT                   16132231..16133172,16160806..>16160989))
FT                   /gene="E130304F04Rik"
FT                   /locus_tag="mCG_114448"
FT                   /product="RIKEN cDNA E130304F04, transcript variant
FT                   mCT179402"
FT                   /note="gene_id=mCG114448.1 transcript_id=mCT179402.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(16116734..16117483,16118790..16119058,
FT                   16132231..>16132525))
FT                   /codon_start=1
FT                   /gene="E130304F04Rik"
FT                   /locus_tag="mCG_114448"
FT                   /product="RIKEN cDNA E130304F04, isoform CRA_a"
FT                   /note="gene_id=mCG114448.1 transcript_id=mCT115540.1
FT                   protein_id=mCP83954.1 isoform=CRA_a"
FT                   /protein_id="EDL18334.1"
FT                   /translation="TMTAVFVNGGGLVNTHCDRWERRDSVESSCQTEGGKDSEEDQQRQ
FT                   LTPFEKLTQDMCQDEKVVREITLGKRIGFYRIRGEIGSGNFSQVKLGIHSLTKEKVAIK
FT                   ILDKTKLDQKTQRLLSREISSMEKLHHPNIVRLYEVVETLSKLHLVMEYAGGGELFGKI
FT                   STEGKLSEPESKLIFSQILSAVKHMHENQIIHRDLKAENVFYTSRTCVKVGDFGFSTVS
FT                   KKGEMLNTFCGSPPYAAPELFRDQHYVGVYVDIWALGVLLYFMVTGTMPFRAETVAKLK
FT                   KSILEGTYTIPQHVSEPCHRLIRGVLQPTPTERYGINYIMNNEWMRGVPYPTPLEPFQL
FT                   DPKHLSETSTLKEEENEVKSTLEHLGITDEHIRNNQGRDARSSITGVYRIILHRVQRRK
FT                   ALESVPIMILPEPKERDLKKGSRIYRGIRHTSKFCSIL"
FT   CDS             complement(join(16116734..16117483,16118790..16119053,
FT                   16132231..>16132236))
FT                   /codon_start=1
FT                   /gene="E130304F04Rik"
FT                   /locus_tag="mCG_114448"
FT                   /product="RIKEN cDNA E130304F04, isoform CRA_b"
FT                   /note="gene_id=mCG114448.1 transcript_id=mCT179402.0
FT                   protein_id=mCP102324.0 isoform=CRA_b"
FT                   /protein_id="EDL18335.1"
FT                   /translation="PKVAIKILDKTKLDQKTQRLLSREISSMEKLHHPNIVRLYEVVET
FT                   LSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQILSAVKHMHENQIIHRDLKAEN
FT                   VFYTSRTCVKVGDFGFSTVSKKGEMLNTFCGSPPYAAPELFRDQHYVGVYVDIWALGVL
FT                   LYFMVTGTMPFRAETVAKLKKSILEGTYTIPQHVSEPCHRLIRGVLQPTPTERYGINYI
FT                   MNNEWMRGVPYPTPLEPFQLDPKHLSETSTLKEEENEVKSTLEHLGITDEHIRNNQGRD
FT                   ARSSITGVYRIILHRVQRRKALESVPIMILPEPKERDLKKGSRIYRGIRHTSKFCSIL"
FT   assembly_gap    16123675..16124180
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    16136346..16136413
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    16137838..16138723
FT                   /estimated_length=886
FT                   /gap_type="unknown"
FT   assembly_gap    16139843..16139862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16141259..16141278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16142759..16144376
FT                   /estimated_length=1618
FT                   /gap_type="unknown"
FT   assembly_gap    16145302..16145321
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16146448..16146467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16147693..16147712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16148949..16149205
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    16152056..16152075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16161580..16161706
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    16162777..16162796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16164175..16164194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16166374..16166393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16169703..16169722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16172753..16198848)
FT                   /gene="Zfp131"
FT                   /locus_tag="mCG_8023"
FT                   /note="gene_id=mCG8023.2"
FT   mRNA            complement(join(16172753..16174592,16176216..16176346,
FT                   16183297..16183519,16183622..16183979,16190319..16190463,
FT                   16196403..16196504,16197692..16197830,16198231..16198848))
FT                   /gene="Zfp131"
FT                   /locus_tag="mCG_8023"
FT                   /product="zinc finger protein 131, transcript variant
FT                   mCT7174"
FT                   /note="gene_id=mCG8023.2 transcript_id=mCT7174.2 created on
FT                   20-NOV-2002"
FT   mRNA            complement(join(16172753..16174592,16176216..16176346,
FT                   16183297..16183519,16183622..16183979,16190319..16190463,
FT                   16196403..16196504,16197692..16197830,16198230..>16198259))
FT                   /gene="Zfp131"
FT                   /locus_tag="mCG_8023"
FT                   /product="zinc finger protein 131, transcript variant
FT                   mCT191188"
FT                   /note="gene_id=mCG8023.2 transcript_id=mCT191188.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(16172755..16174592,16176216..16176346,
FT                   16183297..16183979,16190319..16190463,16196403..16196504,
FT                   16197692..16198000))
FT                   /gene="Zfp131"
FT                   /locus_tag="mCG_8023"
FT                   /product="zinc finger protein 131, transcript variant
FT                   mCT175934"
FT                   /note="gene_id=mCG8023.2 transcript_id=mCT175934.0 created
FT                   on 20-NOV-2002"
FT   mRNA            complement(join(16173371..16174592,16176216..16176346,
FT                   16183297..16183979,16190319..16190463,16196403..16196504,
FT                   16197692..16197830,16198271..>16198340))
FT                   /gene="Zfp131"
FT                   /locus_tag="mCG_8023"
FT                   /product="zinc finger protein 131, transcript variant
FT                   mCT191189"
FT                   /note="gene_id=mCG8023.2 transcript_id=mCT191189.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(16173918..16174592,16176216..16176346,
FT                   16183297..16183979,16190319..16190463,16196403..16196504,
FT                   16197692..16197830,16198271..>16198339))
FT                   /codon_start=1
FT                   /gene="Zfp131"
FT                   /locus_tag="mCG_8023"
FT                   /product="zinc finger protein 131, isoform CRA_b"
FT                   /note="gene_id=mCG8023.2 transcript_id=mCT191189.0
FT                   protein_id=mCP112150.0 isoform=CRA_b"
FT                   /protein_id="EDL18331.1"
FT                   /translation="WPGFTGIGAPGASASGVVTHHVDSTPTAMEAEETMECLQEFPEHH
FT                   KMILDRLNEQREQDRFTDITLIVDGHHFKAHKAVLAACSKFFYKFFQEFTQEPLVEIEG
FT                   VSKMAFRHLIEFTYTAKLMIQGEEEANDVWKAAEFLQMLEAIKALEVRNKENSAPLEEN
FT                   TTGKNEAKKRKIAETSNVITESLPSAESEPVEIEVEIAEGTIEVEDEGIEALEEMASAK
FT                   QSIKYIQSTGSSDDSALALLADITSKYRQGESKGQISEDDCASDPISKQVEGIEIVELQ
FT                   LSHVKDLFHCEKCNRSFKLFYHFKEHMKSHSTESFKCEICNKRYLRESAWKQHLNCYHL
FT                   EEGGVSKKQRTGKKIHICQYCDKQFDHFGHFKEHLRKHTGEKPFECSNCHERFARNSTL
FT                   KCHLTACQTGVGAKKGRKKLYECQVCNSVFNSWDQFKDHLVIHTGDKPNHCTLCDLWFM
FT                   QGNELRRHLSDAHNISERIVTEEVLSVETHLQTEPVTSMTIIEQVGKVHVLPLLQVQVD
FT                   SAQVTVEQVHPDLLQDSQVHDSQMTGLPEQVQVSYLEVGRIQTEEGTEVHVEELHVERV
FT                   NQMPVEVQTELLEADLDHMTPEIMSQEEREPNHADAAMEEHEDAEGLETKPSEYSQARK
FT                   TENDRTSLPVLE"
FT   CDS             complement(join(16173918..16174592,16176216..16176346,
FT                   16183297..16183519,16183622..16183979,16190319..16190463,
FT                   16196403..16196504,16197692..>16197830))
FT                   /codon_start=1
FT                   /gene="Zfp131"
FT                   /locus_tag="mCG_8023"
FT                   /product="zinc finger protein 131, isoform CRA_a"
FT                   /note="gene_id=mCG8023.2 transcript_id=mCT191188.0
FT                   protein_id=mCP112149.0 isoform=CRA_a"
FT                   /protein_id="EDL18330.1"
FT                   /translation="STPTAMEAEETMECLQEFPEHHKMILDRLNEQREQDRFTDITLIV
FT                   DGHHFKAHKAVLAACSKFFYKFFQEFTQEPLVEIEGVSKMAFRHLIEFTYTAKLMIQGE
FT                   EEANDVWKAAEFLQMLEAIKALEVRNKENSAPLEENTTGKNEAKKRKIAETSNVITESL
FT                   PSAESEPVEIEVEIAEGTIEVEDEGIEALEEMASAKQSIKYIQSTGSSDDSALALLADI
FT                   TSKYRQGESKGQISEDDCASDPISKQEHMKSHSTESFKCEICNKRYLRESAWKQHLNCY
FT                   HLEEGGVSKKQRTGKKIHICQYCDKQFDHFGHFKEHLRKHTGEKPFECSNCHERFARNS
FT                   TLKCHLTACQTGVGAKKGRKKLYECQVCNSVFNSWDQFKDHLVIHTGDKPNHCTLCDLW
FT                   FMQGNELRRHLSDAHNISERIVTEEVLSVETHLQTEPVTSMTIIEQVGKVHVLPLLQVQ
FT                   VDSAQVTVEQVHPDLLQDSQVHDSQMTGLPEQVQVSYLEVGRIQTEEGTEVHVEELHVE
FT                   RVNQMPVEVQTELLEADLDHMTPEIMSQEEREPNHADAAMEEHEDAEGLETKPSEYSQA
FT                   RKTENDRTSLPVLE"
FT   CDS             complement(join(16173918..16174592,16176216..16176346,
FT                   16183297..16183519,16183622..16183979,16190319..16190463,
FT                   16196403..16196504,16197692..16197815))
FT                   /codon_start=1
FT                   /gene="Zfp131"
FT                   /locus_tag="mCG_8023"
FT                   /product="zinc finger protein 131, isoform CRA_c"
FT                   /note="gene_id=mCG8023.2 transcript_id=mCT7174.2
FT                   protein_id=mCP6445.2 isoform=CRA_c"
FT                   /protein_id="EDL18332.1"
FT                   /translation="MEAEETMECLQEFPEHHKMILDRLNEQREQDRFTDITLIVDGHHF
FT                   KAHKAVLAACSKFFYKFFQEFTQEPLVEIEGVSKMAFRHLIEFTYTAKLMIQGEEEAND
FT                   VWKAAEFLQMLEAIKALEVRNKENSAPLEENTTGKNEAKKRKIAETSNVITESLPSAES
FT                   EPVEIEVEIAEGTIEVEDEGIEALEEMASAKQSIKYIQSTGSSDDSALALLADITSKYR
FT                   QGESKGQISEDDCASDPISKQEHMKSHSTESFKCEICNKRYLRESAWKQHLNCYHLEEG
FT                   GVSKKQRTGKKIHICQYCDKQFDHFGHFKEHLRKHTGEKPFECSNCHERFARNSTLKCH
FT                   LTACQTGVGAKKGRKKLYECQVCNSVFNSWDQFKDHLVIHTGDKPNHCTLCDLWFMQGN
FT                   ELRRHLSDAHNISERIVTEEVLSVETHLQTEPVTSMTIIEQVGKVHVLPLLQVQVDSAQ
FT                   VTVEQVHPDLLQDSQVHDSQMTGLPEQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQM
FT                   PVEVQTELLEADLDHMTPEIMSQEEREPNHADAAMEEHEDAEGLETKPSEYSQARKTEN
FT                   DRTSLPVLE"
FT   CDS             complement(join(16173918..16174592,16176216..16176346,
FT                   16183297..16183979,16190319..16190463,16196403..16196504,
FT                   16197692..16197815))
FT                   /codon_start=1
FT                   /gene="Zfp131"
FT                   /locus_tag="mCG_8023"
FT                   /product="zinc finger protein 131, isoform CRA_d"
FT                   /note="gene_id=mCG8023.2 transcript_id=mCT175934.0
FT                   protein_id=mCP98856.0 isoform=CRA_d"
FT                   /protein_id="EDL18333.1"
FT                   /translation="MEAEETMECLQEFPEHHKMILDRLNEQREQDRFTDITLIVDGHHF
FT                   KAHKAVLAACSKFFYKFFQEFTQEPLVEIEGVSKMAFRHLIEFTYTAKLMIQGEEEAND
FT                   VWKAAEFLQMLEAIKALEVRNKENSAPLEENTTGKNEAKKRKIAETSNVITESLPSAES
FT                   EPVEIEVEIAEGTIEVEDEGIEALEEMASAKQSIKYIQSTGSSDDSALALLADITSKYR
FT                   QGESKGQISEDDCASDPISKQVEGIEIVELQLSHVKDLFHCEKCNRSFKLFYHFKEHMK
FT                   SHSTESFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKKQRTGKKIHICQYCDKQFDHF
FT                   GHFKEHLRKHTGEKPFECSNCHERFARNSTLKCHLTACQTGVGAKKGRKKLYECQVCNS
FT                   VFNSWDQFKDHLVIHTGDKPNHCTLCDLWFMQGNELRRHLSDAHNISERIVTEEVLSVE
FT                   THLQTEPVTSMTIIEQVGKVHVLPLLQVQVDSAQVTVEQVHPDLLQDSQVHDSQMTGLP
FT                   EQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQMPVEVQTELLEADLDHMTPEIMSQEE
FT                   REPNHADAAMEEHEDAEGLETKPSEYSQARKTENDRTSLPVLE"
FT   assembly_gap    16174651..16174670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16198006..16198211
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    16214057..16215249
FT                   /estimated_length=1193
FT                   /gap_type="unknown"
FT   assembly_gap    16223350..16223671
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    16234635..16234654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
XX
CO   join(complement(AAHY01109622.1:1..8255),gap(35),
CO   complement(AAHY01109623.1:1..9333),gap(92),
CO   complement(AAHY01109624.1:1..8095),gap(277),
CO   complement(AAHY01109625.1:1..8891),gap(20),
CO   complement(AAHY01109626.1:1..23153),gap(20),
CO   complement(AAHY01109627.1:1..3246),gap(21),
CO   complement(AAHY01109628.1:1..16967),gap(172),
CO   complement(AAHY01109629.1:1..2416),gap(20),
CO   complement(AAHY01109630.1:1..3321),gap(206),AAHY01109631.1:1..15061,
CO   gap(20),AAHY01109632.1:1..15396,gap(197),
CO   complement(AAHY01109633.1:1..8037),gap(775),
CO   complement(AAHY01109634.1:1..18445),gap(4511),
CO   complement(AAHY01109635.1:1..1756),gap(550),AAHY01109636.1:1..2013,gap(66),
CO   complement(AAHY01109637.1:1..25311),gap(55),AAHY01109638.1:1..8844,gap(20),
CO   AAHY01109639.1:1..28340,gap(20),complement(AAHY01109640.1:1..27496),
CO   gap(20),AAHY01109641.1:1..35859,gap(697),
CO   complement(AAHY01109642.1:1..19853),gap(20),
CO   complement(AAHY01109643.1:1..12332),gap(20),
CO   complement(AAHY01109644.1:1..37971),gap(87),
CO   complement(AAHY01109645.1:1..491),gap(29),
CO   complement(AAHY01109646.1:1..21584),gap(171),
CO   complement(AAHY01109647.1:1..16143),gap(90),AAHY01109648.1:1..15604,
CO   gap(144),complement(AAHY01109649.1:1..4115),gap(20),
CO   complement(AAHY01109650.1:1..5287),gap(108),
CO   complement(AAHY01109651.1:1..3048),gap(4503),AAHY01109652.1:1..1547,
CO   gap(20),complement(AAHY01109653.1:1..8426),gap(293),
CO   complement(AAHY01109654.1:1..18044),gap(164),
CO   complement(AAHY01109655.1:1..64247),gap(20),AAHY01109656.1:1..43993,
CO   gap(20),AAHY01109657.1:1..7261,gap(20),AAHY01109658.1:1..1163,gap(20),
CO   complement(AAHY01109659.1:1..22367),gap(78),
CO   complement(AAHY01109660.1:1..29479),gap(20),
CO   complement(AAHY01109661.1:1..48161),gap(20),AAHY01109662.1:1..5434,gap(20),
CO   complement(AAHY01109663.1:1..4044),gap(20),
CO   complement(AAHY01109664.1:1..1100),gap(20),
CO   complement(AAHY01109665.1:1..735),gap(20),
CO   complement(AAHY01109666.1:1..2005),gap(20),
CO   complement(AAHY01109667.1:1..19146),gap(473),
CO   complement(AAHY01109668.1:1..2200),gap(2889),AAHY01109669.1:1..1252,
CO   gap(20),complement(AAHY01109670.1:1..5013),gap(20),
CO   complement(AAHY01109671.1:1..63440),gap(146),AAHY01109672.1:1..3178,
CO   gap(20),AAHY01109673.1:1..42556,gap(171),
CO   complement(AAHY01109674.1:1..34043),gap(20),
CO   complement(AAHY01109675.1:1..9016),gap(20),
CO   complement(AAHY01109676.1:1..14520),gap(76),
CO   complement(AAHY01109677.1:1..63657),gap(20),AAHY01109678.1:1..10832,
CO   gap(20),complement(AAHY01109679.1:1..8722),gap(20),AAHY01109680.1:1..23980,
CO   gap(491),complement(AAHY01109681.1:1..23733),gap(238),
CO   complement(AAHY01109682.1:1..56675),gap(76),
CO   complement(AAHY01109683.1:1..14713),gap(122),
CO   complement(AAHY01109684.1:1..55844),gap(20),
CO   complement(AAHY01109685.1:1..19409),gap(20),
CO   complement(AAHY01109686.1:1..4770),gap(137),
CO   complement(AAHY01109687.1:1..6266),gap(20),
CO   complement(AAHY01109688.1:1..1268),gap(611),AAHY01109689.1:1..17877,
CO   gap(20),complement(AAHY01109690.1:1..5017),gap(20),
CO   complement(AAHY01109691.1:1..36438),gap(20),
CO   complement(AAHY01109692.1:1..2946),gap(20),
CO   complement(AAHY01109693.1:1..29453),gap(370),AAHY01109694.1:1..27058,
CO   gap(596),complement(AAHY01109695.1:1..33925),gap(4922),
CO   complement(AAHY01109696.1:1..5649),gap(20),AAHY01109697.1:1..3144,gap(81),
CO   complement(AAHY01109698.1:1..30734),gap(20),
CO   complement(AAHY01109699.1:1..29644),gap(145),
CO   complement(AAHY01109700.1:1..2150),gap(31),
CO   complement(AAHY01109701.1:1..15854),gap(210),
CO   complement(AAHY01109702.1:1..8857),gap(162),AAHY01109703.1:1..12071,
CO   gap(470),complement(AAHY01109704.1:1..29662),gap(20),
CO   complement(AAHY01109705.1:1..17662),gap(20),AAHY01109706.1:1..3924,
CO   gap(1446),complement(AAHY01109707.1:1..5419),gap(20),
CO   complement(AAHY01109708.1:1..90026),gap(20),AAHY01109709.1:1..8018,gap(20),
CO   complement(AAHY01109710.1:1..21790),gap(91),
CO   complement(AAHY01109711.1:1..29451),gap(20),
CO   complement(AAHY01109712.1:1..13750),gap(20),AAHY01109713.1:1..6399,gap(20),
CO   AAHY01109714.1:1..50242,gap(169),AAHY01109715.1:1..4491,gap(20),
CO   AAHY01109716.1:1..14825,gap(20),AAHY01109717.1:1..23490,gap(20),
CO   complement(AAHY01109718.1:1..41066),gap(850),
CO   complement(AAHY01109719.1:1..1507),gap(307),AAHY01109720.1:1..10695,
CO   gap(20),complement(AAHY01109721.1:1..10438),gap(388),
CO   complement(AAHY01109722.1:1..3802),gap(104),
CO   complement(AAHY01109723.1:1..15636),gap(20),
CO   complement(AAHY01109724.1:1..1603),gap(20),
CO   complement(AAHY01109725.1:1..23403),gap(310),
CO   complement(AAHY01109726.1:1..8941),gap(20),
CO   complement(AAHY01109727.1:1..7571),gap(136),
CO   complement(AAHY01109728.1:1..9899),gap(20),
CO   complement(AAHY01109729.1:1..94992),gap(213),
CO   complement(AAHY01109730.1:1..7039),gap(20),AAHY01109731.1:1..4072,gap(75),
CO   complement(AAHY01109732.1:1..49983),gap(673),
CO   complement(AAHY01109733.1:1..7177),gap(20),
CO   complement(AAHY01109734.1:1..35946),gap(908),AAHY01109735.1:1..1199,
CO   gap(416),AAHY01109736.1:1..2144,gap(20),
CO   complement(AAHY01109737.1:1..29154),gap(20),
CO   complement(AAHY01109738.1:1..1523),gap(20),
CO   complement(AAHY01109739.1:1..17299),gap(20),AAHY01109740.1:1..21174,
CO   gap(1772),AAHY01109741.1:1..9028,gap(2105),
CO   complement(AAHY01109742.1:1..13822),gap(20),
CO   complement(AAHY01109743.1:1..1219),gap(852),
CO   complement(AAHY01109744.1:1..847),gap(20),
CO   complement(AAHY01109745.1:1..1267),gap(20),
CO   complement(AAHY01109746.1:1..1496),gap(20),AAHY01109747.1:1..3564,gap(20),
CO   complement(AAHY01109748.1:1..5615),gap(20),
CO   complement(AAHY01109749.1:1..4985),gap(50941),
CO   complement(AAHY01109750.1:1..28658),gap(1212),
CO   complement(AAHY01109751.1:1..2956),gap(511),
CO   complement(AAHY01109752.1:1..38434),gap(1206),
CO   complement(AAHY01109753.1:1..26651),gap(173),
CO   complement(AAHY01109754.1:1..5716),gap(20),AAHY01109755.1:1..9728,gap(223),
CO   complement(AAHY01109756.1:1..25114),gap(115),
CO   complement(AAHY01109757.1:1..47067),gap(20),
CO   complement(AAHY01109758.1:1..62554),gap(20),
CO   complement(AAHY01109759.1:1..38663),gap(44),AAHY01109760.1:1..23786,
CO   gap(89),AAHY01109761.1:1..3598,gap(602),
CO   complement(AAHY01109762.1:1..15113),gap(20),
CO   complement(AAHY01109763.1:1..13957),gap(20),
CO   complement(AAHY01109764.1:1..7901),gap(20),
CO   complement(AAHY01109765.1:1..3405),gap(20),AAHY01109766.1:1..1453,
CO   gap(2128),complement(AAHY01109767.1:1..74892),gap(2280),
CO   complement(AAHY01109768.1:1..46231),gap(2508),AAHY01109769.1:1..1067,
CO   gap(1167),AAHY01109770.1:1..2493,gap(20),AAHY01109771.1:1..1373,gap(20),
CO   complement(AAHY01109772.1:1..1087),gap(20),
CO   complement(AAHY01109773.1:1..18401),gap(43),
CO   complement(AAHY01109774.1:1..42840),gap(132),AAHY01109775.1:1..21561,
CO   gap(20),complement(AAHY01109776.1:1..8887),gap(20),AAHY01109777.1:1..8032,
CO   gap(129),complement(AAHY01109778.1:1..29667),gap(79),
CO   complement(AAHY01109779.1:1..2612),gap(20),
CO   complement(AAHY01109780.1:1..6232),gap(20),
CO   complement(AAHY01109781.1:1..3195),gap(20),
CO   complement(AAHY01109782.1:1..1039),gap(20),
CO   complement(AAHY01109783.1:1..8455),gap(20),AAHY01109784.1:1..1040,gap(20),
CO   complement(AAHY01109785.1:1..1018),gap(20),
CO   complement(AAHY01109786.1:1..1654),gap(20),
CO   complement(AAHY01109787.1:1..54027),gap(20),
CO   complement(AAHY01109788.1:1..12759),gap(1108),
CO   complement(AAHY01109789.1:1..10216),gap(226),
CO   complement(AAHY01109790.1:1..1331),gap(20),
CO   complement(AAHY01109791.1:1..24640),gap(9184),
CO   complement(AAHY01109792.1:1..9416),gap(3068),
CO   complement(AAHY01109793.1:1..3672),gap(164),
CO   complement(AAHY01109794.1:1..4977),gap(290),AAHY01109795.1:1..2984,gap(20),
CO   complement(AAHY01109796.1:1..4013),gap(20),
CO   complement(AAHY01109797.1:1..16633),gap(428),
CO   complement(AAHY01109798.1:1..9161),gap(20),AAHY01109799.1:1..2604,gap(20),
CO   complement(AAHY01109800.1:1..2210),gap(20),
CO   complement(AAHY01109801.1:1..53408),gap(20),AAHY01109802.1:1..34931,
CO   gap(319),complement(AAHY01109803.1:1..11209),gap(312),
CO   complement(AAHY01109804.1:1..11145),gap(20),
CO   complement(AAHY01109805.1:1..40725),gap(20),
CO   complement(AAHY01109806.1:1..49542),gap(186),
CO   complement(AAHY01109807.1:1..17717),gap(20),
CO   complement(AAHY01109808.1:1..31678),gap(20),AAHY01109809.1:1..3217,gap(20),
CO   complement(AAHY01109810.1:1..3629),gap(41),
CO   complement(AAHY01109811.1:1..38026),gap(20),
CO   complement(AAHY01109812.1:1..18737),gap(20),AAHY01109813.1:1..5870,gap(20),
CO   complement(AAHY01109814.1:1..1224),gap(20),AAHY01109815.1:1..1253,gap(20),
CO   complement(AAHY01109816.1:1..1348),gap(504),AAHY01109817.1:1..1095,gap(20),
CO   complement(AAHY01109818.1:1..1282),gap(20),
CO   complement(AAHY01109819.1:1..13431),gap(20),AAHY01109820.1:1..6758,gap(20),
CO   complement(AAHY01109821.1:1..81510),gap(245),
CO   complement(AAHY01109822.1:1..1100),gap(20),AAHY01109823.1:1..8471,gap(249),
CO   AAHY01109824.1:1..2324,gap(817),AAHY01109825.1:1..18822,gap(62),
CO   complement(AAHY01109826.1:1..5032),gap(49),AAHY01109827.1:1..9073,gap(130),
CO   complement(AAHY01109828.1:1..5066),gap(20),AAHY01109829.1:1..37159,gap(20),
CO   AAHY01109830.1:1..27380,gap(26),AAHY01109831.1:1..19844,gap(185),
CO   AAHY01109832.1:1..6841,gap(54),complement(AAHY01109833.1:1..25885),gap(20),
CO   complement(AAHY01109834.1:1..32847),gap(3044),
CO   complement(AAHY01109835.1:1..10163),gap(29),AAHY01109836.1:1..30257,
CO   gap(20),complement(AAHY01109837.1:1..2787),gap(20),
CO   complement(AAHY01109838.1:1..1186),gap(20),
CO   complement(AAHY01109839.1:1..21492),gap(115),
CO   complement(AAHY01109840.1:1..5805),gap(119),
CO   complement(AAHY01109841.1:1..5059),gap(3762),
CO   complement(AAHY01109842.1:1..1245),gap(20),AAHY01109843.1:1..29169,gap(95),
CO   complement(AAHY01109844.1:1..16853),gap(3120),
CO   complement(AAHY01109845.1:1..8262),gap(220),AAHY01109846.1:1..4731,gap(20),
CO   AAHY01109847.1:1..15961,gap(573),complement(AAHY01109848.1:1..10495),
CO   gap(20),complement(AAHY01109849.1:1..4869),gap(1159),
CO   complement(AAHY01109850.1:1..2553),gap(20),
CO   complement(AAHY01109851.1:1..27510),gap(20),
CO   complement(AAHY01109852.1:1..10806),gap(85),AAHY01109853.1:1..5993,gap(20),
CO   complement(AAHY01109854.1:1..2506),gap(562),AAHY01109855.1:1..1925,
CO   gap(203),complement(AAHY01109856.1:1..16068),gap(20),
CO   complement(AAHY01109857.1:1..12516),gap(38),
CO   complement(AAHY01109858.1:1..41770),gap(155),AAHY01109859.1:1..6063,
CO   gap(20),AAHY01109860.1:1..1528,gap(38),AAHY01109861.1:1..4011,gap(988),
CO   AAHY01109862.1:1..1870,gap(20),complement(AAHY01109863.1:1..1417),gap(64),
CO   complement(AAHY01109864.1:1..4403),gap(39),
CO   complement(AAHY01109865.1:1..102436),gap(57),
CO   complement(AAHY01109866.1:1..2942),gap(20),
CO   complement(AAHY01109867.1:1..10979),gap(20),AAHY01109868.1:1..29188,
CO   gap(1001),complement(AAHY01109869.1:1..5566),gap(20),
CO   complement(AAHY01109870.1:1..31298),gap(487),
CO   complement(AAHY01109871.1:1..15115),gap(91),AAHY01109872.1:1..3308,
CO   gap(2114),complement(AAHY01109873.1:1..5824),gap(389),
CO   complement(AAHY01109874.1:1..1089),gap(1078),AAHY01109875.1:1..3022,
CO   gap(2144),complement(AAHY01109876.1:1..18542),gap(165),
CO   complement(AAHY01109877.1:1..3381),gap(966),
CO   complement(AAHY01109878.1:1..19789),gap(20),
CO   complement(AAHY01109879.1:1..13494),gap(337),
CO   complement(AAHY01109880.1:1..4406),gap(198),
CO   complement(AAHY01109881.1:1..5550),gap(20),
CO   complement(AAHY01109882.1:1..29045),gap(20),
CO   complement(AAHY01109883.1:1..8352),gap(20),
CO   complement(AAHY01109884.1:1..97937),gap(89),
CO   complement(AAHY01109885.1:1..33649),gap(20),
CO   complement(AAHY01109886.1:1..24332),gap(37),
CO   complement(AAHY01109887.1:1..18209),gap(146),
CO   complement(AAHY01109888.1:1..9595),gap(20),AAHY01109889.1:1..2307,gap(793),
CO   complement(AAHY01109890.1:1..20924),gap(424),
CO   complement(AAHY01109891.1:1..3644),gap(20),
CO   complement(AAHY01109892.1:1..73890),gap(234),
CO   complement(AAHY01109893.1:1..4614),gap(79),
CO   complement(AAHY01109894.1:1..1280),gap(20),
CO   complement(AAHY01109895.1:1..11499),gap(1329),
CO   complement(AAHY01109896.1:1..1767),gap(390),
CO   complement(AAHY01109897.1:1..549),gap(102),
CO   complement(AAHY01109898.1:1..26924),gap(44),
CO   complement(AAHY01109899.1:1..24417),gap(20),
CO   complement(AAHY01109900.1:1..5505),gap(50),
CO   complement(AAHY01109901.1:1..21764),gap(20),
CO   complement(AAHY01109902.1:1..1106),gap(20),AAHY01109903.1:1..8716,gap(544),
CO   complement(AAHY01109904.1:1..9591),gap(121),
CO   complement(AAHY01109905.1:1..2439),gap(20),AAHY01109906.1:1..2839,gap(20),
CO   complement(AAHY01109907.1:1..1262),gap(20),
CO   complement(AAHY01109908.1:1..3186),gap(4225),
CO   complement(AAHY01109909.1:1..1604),gap(20),
CO   complement(AAHY01109910.1:1..11058),gap(133),AAHY01109911.1:1..17300,
CO   gap(66),complement(AAHY01109912.1:1..4790),gap(362),
CO   complement(AAHY01109913.1:1..1662),gap(2079),
CO   complement(AAHY01109914.1:1..42391),gap(3098),AAHY01109915.1:1..4740,
CO   gap(310),AAHY01109916.1:1..1176,gap(972),AAHY01109917.1:1..24527,gap(20),
CO   AAHY01109918.1:1..38054,gap(20),complement(AAHY01109919.1:1..1588),
CO   gap(102),complement(AAHY01109920.1:1..37581),gap(492),
CO   complement(AAHY01109921.1:1..1003),gap(20),
CO   complement(AAHY01109922.1:1..12960),gap(20),
CO   complement(AAHY01109923.1:1..4049),gap(49),AAHY01109924.1:1..4251,gap(20),
CO   AAHY01109925.1:1..8653,gap(195),AAHY01109926.1:1..15306,gap(1119),
CO   complement(AAHY01109927.1:1..439),gap(20),
CO   complement(AAHY01109928.1:1..62333),gap(20),AAHY01109929.1:1..4718,
CO   gap(197),AAHY01109930.1:1..42989,gap(5424),AAHY01109931.1:1..30098,gap(20),
CO   complement(AAHY01109932.1:1..55573),gap(39),
CO   complement(AAHY01109933.1:1..8511),gap(25),
CO   complement(AAHY01109934.1:1..3077),gap(52),AAHY01109935.1:1..24803,
CO   gap(1006),AAHY01109936.1:1..1275,gap(25),AAHY01109937.1:1..1702,gap(20),
CO   complement(AAHY01109938.1:1..14187),gap(84),
CO   complement(AAHY01109939.1:1..9241),gap(355),
CO   complement(AAHY01109940.1:1..40601),gap(444),
CO   complement(AAHY01109941.1:1..9239),gap(20),
CO   complement(AAHY01109942.1:1..22268),gap(153),
CO   complement(AAHY01109943.1:1..8692),gap(20),
CO   complement(AAHY01109944.1:1..56586),gap(20),
CO   complement(AAHY01109945.1:1..16728),gap(20),
CO   complement(AAHY01109946.1:1..6063),gap(20),
CO   complement(AAHY01109947.1:1..1699),gap(20),
CO   complement(AAHY01109948.1:1..18723),gap(20),
CO   complement(AAHY01109949.1:1..75309),gap(20),
CO   complement(AAHY01109950.1:1..2204),gap(20),AAHY01109951.1:1..8694,gap(20),
CO   AAHY01109952.1:1..1370,gap(342),complement(AAHY01109953.1:1..5036),
CO   gap(190),complement(AAHY01109954.1:1..8996),gap(678),
CO   complement(AAHY01109955.1:1..36528),gap(119),
CO   complement(AAHY01109956.1:1..24262),gap(20),
CO   complement(AAHY01109957.1:1..70874),gap(65),
CO   complement(AAHY01109958.1:1..5724),gap(2415),
CO   complement(AAHY01109959.1:1..42250),gap(4366),
CO   complement(AAHY01109960.1:1..76351),gap(127),AAHY01109961.1:1..11963,
CO   gap(20),AAHY01109962.1:1..5518,gap(20),complement(AAHY01109963.1:1..4867),
CO   gap(106),complement(AAHY01109964.1:1..38906),gap(20),
CO   AAHY01109965.1:1..2516,gap(1861),complement(AAHY01109966.1:1..30413),
CO   gap(20),complement(AAHY01109967.1:1..9945),gap(20),AAHY01109968.1:1..12961,
CO   gap(20),complement(AAHY01109969.1:1..11874),gap(26),
CO   AAHY01109970.1:1..21002,gap(110),AAHY01109971.1:1..32352,gap(306),
CO   AAHY01109972.1:1..3241,gap(20),complement(AAHY01109973.1:1..86337),
CO   gap(952),complement(AAHY01109974.1:1..24878),gap(20),
CO   complement(AAHY01109975.1:1..18815),gap(189),AAHY01109976.1:1..2271,
CO   gap(20),complement(AAHY01109977.1:1..13785),gap(364),
CO   complement(AAHY01109978.1:1..8562),gap(20),
CO   complement(AAHY01109979.1:1..14854),gap(3768),
CO   complement(AAHY01109980.1:1..2125),gap(20),
CO   complement(AAHY01109981.1:1..1114),gap(20),
CO   complement(AAHY01109982.1:1..1119),gap(20),
CO   complement(AAHY01109983.1:1..3947),gap(20),
CO   complement(AAHY01109984.1:1..1203),gap(20),
CO   complement(AAHY01109985.1:1..3182),gap(20),
CO   complement(AAHY01109986.1:1..4251),gap(270),
CO   complement(AAHY01109987.1:1..11277),gap(1067),
CO   complement(AAHY01109988.1:1..10258),gap(20),
CO   complement(AAHY01109989.1:1..1262),gap(20),
CO   complement(AAHY01109990.1:1..5246),gap(639),
CO   complement(AAHY01109991.1:1..1730),gap(20),
CO   complement(AAHY01109992.1:1..1757),gap(20),AAHY01109993.1:1..14681,gap(20),
CO   complement(AAHY01109994.1:1..8369),gap(20),AAHY01109995.1:1..12939,gap(20),
CO   complement(AAHY01109996.1:1..1661),gap(20),
CO   complement(AAHY01109997.1:1..3084),gap(20),
CO   complement(AAHY01109998.1:1..6126),gap(33),
CO   complement(AAHY01109999.1:1..38464),gap(632),
CO   complement(AAHY01110000.1:1..18972),gap(20),
CO   complement(AAHY01110001.1:1..35219),gap(20),
CO   complement(AAHY01110002.1:1..12827),gap(243),
CO   complement(AAHY01110003.1:1..8664),gap(20),
CO   complement(AAHY01110004.1:1..4368),gap(65),
CO   complement(AAHY01110005.1:1..8666),gap(74),
CO   complement(AAHY01110006.1:1..143699),gap(780),
CO   complement(AAHY01110007.1:1..2157),gap(469),
CO   complement(AAHY01110008.1:1..1116),gap(183),AAHY01110009.1:1..1894,
CO   gap(265),complement(AAHY01110010.1:1..1378),gap(20),
CO   complement(AAHY01110011.1:1..4325),gap(20),
CO   complement(AAHY01110012.1:1..37002),gap(470),
CO   complement(AAHY01110013.1:1..19472),gap(20),
CO   complement(AAHY01110014.1:1..17151),gap(20),
CO   complement(AAHY01110015.1:1..4543),gap(379),
CO   complement(AAHY01110016.1:1..6199),gap(957),
CO   complement(AAHY01110017.1:1..1368),gap(20),
CO   complement(AAHY01110018.1:1..2830),gap(404),AAHY01110019.1:1..14696,
CO   gap(132),AAHY01110020.1:1..5416,gap(20),AAHY01110021.1:1..22539,gap(20),
CO   AAHY01110022.1:1..8500,gap(269),complement(AAHY01110023.1:1..16617),
CO   gap(115),AAHY01110024.1:1..11647,gap(20),
CO   complement(AAHY01110025.1:1..20667),gap(20),
CO   complement(AAHY01110026.1:1..21461),gap(20),
CO   complement(AAHY01110027.1:1..30239),gap(1245),AAHY01110028.1:1..19197,
CO   gap(98),AAHY01110029.1:1..7948,gap(53),AAHY01110030.1:1..10925,gap(20),
CO   AAHY01110031.1:1..45835,gap(20),AAHY01110032.1:1..3190,gap(30),
CO   AAHY01110033.1:1..24891,gap(20),complement(AAHY01110034.1:1..22014),
CO   gap(20),complement(AAHY01110035.1:1..5089),gap(232),
CO   complement(AAHY01110036.1:1..1589),gap(20),AAHY01110037.1:1..1278,
CO   gap(4992),AAHY01110038.1:1..1336,gap(20),
CO   complement(AAHY01110039.1:1..1037),gap(20),
CO   complement(AAHY01110040.1:1..1214),gap(20),AAHY01110041.1:1..6525,gap(556),
CO   AAHY01110042.1:1..1237,gap(20),complement(AAHY01110043.1:1..1520),gap(20),
CO   complement(AAHY01110044.1:1..5271),gap(124),
CO   complement(AAHY01110045.1:1..37793),gap(20),AAHY01110046.1:1..17603,
CO   gap(20),AAHY01110047.1:1..20479,gap(82),AAHY01110048.1:1..1562,gap(736),
CO   AAHY01110049.1:1..9772,gap(136),AAHY01110050.1:1..7664,gap(149),
CO   complement(AAHY01110051.1:1..3412),gap(327),
CO   complement(AAHY01110052.1:1..6631),gap(71),AAHY01110053.1:1..12048,
CO   gap(704),complement(AAHY01110054.1:1..45008),gap(21),
CO   AAHY01110055.1:1..6985,gap(1262),AAHY01110056.1:1..1561,gap(209),
CO   complement(AAHY01110057.1:1..1067),gap(20),
CO   complement(AAHY01110058.1:1..1133),gap(2234),
CO   complement(AAHY01110059.1:1..22880),gap(834),
CO   complement(AAHY01110060.1:1..14756),gap(471),
CO   complement(AAHY01110061.1:1..2962),gap(20),
CO   complement(AAHY01110062.1:1..40284),gap(731),
CO   complement(AAHY01110063.1:1..33256),gap(73),AAHY01110064.1:1..16912,
CO   gap(39),complement(AAHY01110065.1:1..1747),gap(20),
CO   complement(AAHY01110066.1:1..1057),gap(149),
CO   complement(AAHY01110067.1:1..2886),gap(259),
CO   complement(AAHY01110068.1:1..14121),gap(20),
CO   complement(AAHY01110069.1:1..11020),gap(54),
CO   complement(AAHY01110070.1:1..7433),gap(106),
CO   complement(AAHY01110071.1:1..32404),gap(20),
CO   complement(AAHY01110072.1:1..37583),gap(20),
CO   complement(AAHY01110073.1:1..3176),gap(54),
CO   complement(AAHY01110074.1:1..31012),gap(773),
CO   complement(AAHY01110075.1:1..17342),gap(20),
CO   complement(AAHY01110076.1:1..16079),gap(44),
CO   complement(AAHY01110077.1:1..3742),gap(28),
CO   complement(AAHY01110078.1:1..27366),gap(256),
CO   complement(AAHY01110079.1:1..3577),gap(20),
CO   complement(AAHY01110080.1:1..8061),gap(20),AAHY01110081.1:1..2798,gap(80),
CO   complement(AAHY01110082.1:1..1196),gap(883),
CO   complement(AAHY01110083.1:1..33034),gap(143),
CO   complement(AAHY01110084.1:1..3410),gap(61),AAHY01110085.1:1..25939,
CO   gap(190),complement(AAHY01110086.1:1..7004),gap(278),
CO   complement(AAHY01110087.1:1..1915),gap(20),AAHY01110088.1:1..7254,gap(202),
CO   AAHY01110089.1:1..4146,gap(98),complement(AAHY01110090.1:1..19011),gap(22),
CO   AAHY01110091.1:1..4223,gap(198),AAHY01110092.1:1..11763,gap(694),
CO   complement(AAHY01110093.1:1..20577),gap(55),AAHY01110094.1:1..3429,
CO   gap(108),AAHY01110095.1:1..18997,gap(107),AAHY01110096.1:1..10879,gap(20),
CO   AAHY01110097.1:1..10703,gap(4937),AAHY01110098.1:1..1915,gap(779),
CO   complement(AAHY01110099.1:1..7381),gap(20),
CO   complement(AAHY01110100.1:1..12435),gap(20),AAHY01110101.1:1..11295,
CO   gap(203),complement(AAHY01110102.1:1..3872),gap(227),
CO   complement(AAHY01110103.1:1..65840),gap(322),AAHY01110104.1:1..735,
CO   gap(267),complement(AAHY01110105.1:1..15576),gap(20),
CO   complement(AAHY01110106.1:1..6285),gap(20),
CO   complement(AAHY01110107.1:1..2839),gap(1109),
CO   complement(AAHY01110108.1:1..13783),gap(20),
CO   complement(AAHY01110109.1:1..4303),gap(67),
CO   complement(AAHY01110110.1:1..14533),gap(765),
CO   complement(AAHY01110111.1:1..6454),gap(587),AAHY01110112.1:1..6120,gap(20),
CO   complement(AAHY01110113.1:1..5084),gap(20),
CO   complement(AAHY01110114.1:1..21102),gap(472),AAHY01110115.1:1..3114,
CO   gap(207),complement(AAHY01110116.1:1..5764),gap(653),
CO   complement(AAHY01110117.1:1..13704),gap(183),
CO   complement(AAHY01110118.1:1..13794),gap(68),
CO   complement(AAHY01110119.1:1..23530),gap(176),
CO   complement(AAHY01110120.1:1..23504),gap(383),
CO   complement(AAHY01110121.1:1..1443),gap(300),
CO   complement(AAHY01110122.1:1..7237),gap(20),
CO   complement(AAHY01110123.1:1..1077),gap(8399),
CO   complement(AAHY01110124.1:1..29097),gap(2789),
CO   complement(AAHY01110125.1:1..4353),gap(117),AAHY01110126.1:1..22861,
CO   gap(20),complement(AAHY01110127.1:1..4234),gap(2259),
CO   complement(AAHY01110128.1:1..1215),gap(20),
CO   complement(AAHY01110129.1:1..1754),gap(1199),
CO   complement(AAHY01110130.1:1..1952),gap(3533),
CO   complement(AAHY01110131.1:1..26971),gap(563),
CO   complement(AAHY01110132.1:1..9543),gap(20),
CO   complement(AAHY01110133.1:1..9203),gap(481),
CO   complement(AAHY01110134.1:1..6265),gap(4087),
CO   complement(AAHY01110135.1:1..5786),gap(300),
CO   complement(AAHY01110136.1:1..7071),gap(554),
CO   complement(AAHY01110137.1:1..1716),gap(20),
CO   complement(AAHY01110138.1:1..1966),gap(20),
CO   complement(AAHY01110139.1:1..11821),gap(157),
CO   complement(AAHY01110140.1:1..1483),gap(259),AAHY01110141.1:1..1575,gap(24),
CO   complement(AAHY01110142.1:1..17047),gap(20),
CO   complement(AAHY01110143.1:1..1592),gap(566),
CO   complement(AAHY01110144.1:1..1117),gap(929),
CO   complement(AAHY01110145.1:1..1702),gap(1320),
CO   complement(AAHY01110146.1:1..1777),gap(20),
CO   complement(AAHY01110147.1:1..9334),gap(33),AAHY01110148.1:1..1682,gap(574),
CO   complement(AAHY01110149.1:1..11214),gap(291),
CO   complement(AAHY01110150.1:1..20823),gap(20),
CO   complement(AAHY01110151.1:1..9836),gap(80),
CO   complement(AAHY01110152.1:1..6588),gap(80),
CO   complement(AAHY01110153.1:1..8264),gap(20),
CO   complement(AAHY01110154.1:1..9269),gap(20),AAHY01110155.1:1..1357,gap(20),
CO   complement(AAHY01110156.1:1..1145),gap(20),
CO   complement(AAHY01110157.1:1..11051),gap(20),
CO   complement(AAHY01110158.1:1..8010),gap(57),AAHY01110159.1:1..818,gap(506),
CO   AAHY01110160.1:1..7094,gap(263),complement(AAHY01110161.1:1..7655),
CO   gap(1395),complement(AAHY01110162.1:1..3449),gap(991),
CO   AAHY01110163.1:1..2565,gap(236),complement(AAHY01110164.1:1..1067),gap(82),
CO   AAHY01110165.1:1..1826,gap(108),AAHY01110166.1:1..2980,gap(12008),
CO   AAHY01110167.1:1..1604,gap(562),complement(AAHY01110168.1:1..4131),gap(27),
CO   complement(AAHY01110169.1:1..13728),gap(20),AAHY01110170.1:1..1373,gap(20),
CO   complement(AAHY01110171.1:1..3498),gap(579),
CO   complement(AAHY01110172.1:1..6188),gap(298),
CO   complement(AAHY01110173.1:1..8431),gap(237),
CO   complement(AAHY01110174.1:1..22183),gap(1243),AAHY01110175.1:1..11652,
CO   gap(20),AAHY01110176.1:1..1411,gap(20),AAHY01110177.1:1..16590,gap(176),
CO   complement(AAHY01110178.1:1..4364),gap(3532),AAHY01110179.1:1..1246,
CO   gap(7718),complement(AAHY01110180.1:1..1597),gap(2684),
CO   AAHY01110181.1:1..755,gap(202),complement(AAHY01110182.1:1..16607),gap(20),
CO   complement(AAHY01110183.1:1..14810),gap(234),
CO   complement(AAHY01110184.1:1..1115),gap(1429),
CO   complement(AAHY01110185.1:1..15610),gap(192),
CO   complement(AAHY01110186.1:1..6693),gap(20),
CO   complement(AAHY01110187.1:1..6536),gap(20),
CO   complement(AAHY01110188.1:1..10535),gap(408),AAHY01110189.1:1..1754,
CO   gap(217),complement(AAHY01110190.1:1..37586),gap(20),
CO   complement(AAHY01110191.1:1..37502),gap(134),
CO   complement(AAHY01110192.1:1..23021),gap(27),
CO   complement(AAHY01110193.1:1..1999),gap(147),
CO   complement(AAHY01110194.1:1..22334),gap(167),AAHY01110195.1:1..4419,
CO   gap(20),complement(AAHY01110196.1:1..9105),gap(89),
CO   complement(AAHY01110197.1:1..9458),gap(147),
CO   complement(AAHY01110198.1:1..8517),gap(778),
CO   complement(AAHY01110199.1:1..1892),gap(1633),
CO   complement(AAHY01110200.1:1..1669),gap(20),
CO   complement(AAHY01110201.1:1..8912),gap(1819),
CO   complement(AAHY01110202.1:1..2380),gap(219),
CO   complement(AAHY01110203.1:1..3603),gap(408),
CO   complement(AAHY01110204.1:1..3243),gap(270),AAHY01110205.1:1..355,gap(419),
CO   complement(AAHY01110206.1:1..2014),gap(20),AAHY01110207.1:1..3859,gap(76),
CO   complement(AAHY01110208.1:1..6811),gap(119),AAHY01110209.1:1..3359,
CO   gap(738),complement(AAHY01110210.1:1..1560),gap(2039),
CO   complement(AAHY01110211.1:1..9796),gap(60),
CO   complement(AAHY01110212.1:1..8029),gap(20),AAHY01110213.1:1..1532,gap(353),
CO   complement(AAHY01110214.1:1..1360),gap(20),
CO   complement(AAHY01110215.1:1..3401),gap(20),
CO   complement(AAHY01110216.1:1..1079),gap(20),
CO   complement(AAHY01110217.1:1..56208),gap(20),
CO   complement(AAHY01110218.1:1..26006),gap(20),
CO   complement(AAHY01110219.1:1..24770),gap(360),AAHY01110220.1:1..1150,
CO   gap(20),complement(AAHY01110221.1:1..6902),gap(1259),
CO   complement(AAHY01110222.1:1..16608),gap(20),AAHY01110223.1:1..1392,gap(20),
CO   AAHY01110224.1:1..1263,gap(20),complement(AAHY01110225.1:1..8659),gap(20),
CO   complement(AAHY01110226.1:1..1721),gap(20),AAHY01110227.1:1..1829,gap(20),
CO   complement(AAHY01110228.1:1..16545),gap(20),
CO   complement(AAHY01110229.1:1..26037),gap(20),
CO   complement(AAHY01110230.1:1..10689),gap(3973),
CO   complement(AAHY01110231.1:1..9748),gap(20),
CO   complement(AAHY01110232.1:1..1334),gap(20),
CO   complement(AAHY01110233.1:1..30143),gap(20),
CO   complement(AAHY01110234.1:1..22630),gap(20),
CO   complement(AAHY01110235.1:1..11610),gap(450),
CO   complement(AAHY01110236.1:1..14786),gap(227),
CO   complement(AAHY01110237.1:1..1613),gap(120),AAHY01110238.1:1..5741,
CO   gap(272),AAHY01110239.1:1..8015,gap(27),
CO   complement(AAHY01110240.1:1..31041),gap(998),
CO   complement(AAHY01110241.1:1..1175),gap(106),AAHY01110242.1:1..5600,gap(20),
CO   AAHY01110243.1:1..11395,gap(22),complement(AAHY01110244.1:1..1502),
CO   gap(1407),complement(AAHY01110245.1:1..8439),gap(440),
CO   complement(AAHY01110246.1:1..2360),gap(36),
CO   complement(AAHY01110247.1:1..40641),gap(20),
CO   complement(AAHY01110248.1:1..7889),gap(20),
CO   complement(AAHY01110249.1:1..91251),gap(20),
CO   complement(AAHY01110250.1:1..30685),gap(318),
CO   complement(AAHY01110251.1:1..871),gap(20),AAHY01110252.1:1..12343,gap(101),
CO   complement(AAHY01110253.1:1..5249),gap(362),
CO   complement(AAHY01110254.1:1..2777),gap(517),
CO   complement(AAHY01110255.1:1..5450),gap(20),
CO   complement(AAHY01110256.1:1..1873),gap(20),
CO   complement(AAHY01110257.1:1..1949),gap(20),
CO   complement(AAHY01110258.1:1..44184),gap(903),
CO   complement(AAHY01110259.1:1..8347),gap(76),
CO   complement(AAHY01110260.1:1..3588),gap(246),
CO   complement(AAHY01110261.1:1..934),gap(345),AAHY01110262.1:1..1782,gap(104),
CO   complement(AAHY01110263.1:1..1023),gap(395),AAHY01110264.1:1..1598,
CO   gap(1206),complement(AAHY01110265.1:1..3681),gap(20),
CO   complement(AAHY01110266.1:1..2425),gap(20),
CO   complement(AAHY01110267.1:1..5037),gap(351),AAHY01110268.1:1..6802,gap(48),
CO   AAHY01110269.1:1..4497,gap(119),complement(AAHY01110270.1:1..19389),
CO   gap(81),complement(AAHY01110271.1:1..13758),gap(20),
CO   complement(AAHY01110272.1:1..19579),gap(157),
CO   complement(AAHY01110273.1:1..14002),gap(20),
CO   complement(AAHY01110274.1:1..9818),gap(1167),
CO   complement(AAHY01110275.1:1..12138),gap(20),
CO   complement(AAHY01110276.1:1..4413),gap(485),
CO   complement(AAHY01110277.1:1..11615),gap(20),
CO   complement(AAHY01110278.1:1..6390),gap(689),
CO   complement(AAHY01110279.1:1..863),gap(1113),
CO   complement(AAHY01110280.1:1..772),gap(31),AAHY01110281.1:1..5489,gap(20),
CO   complement(AAHY01110282.1:1..4619),gap(20),
CO   complement(AAHY01110283.1:1..5897),gap(195),
CO   complement(AAHY01110284.1:1..8897),gap(20),AAHY01110285.1:1..1335,gap(20),
CO   complement(AAHY01110286.1:1..16069),gap(1619),
CO   complement(AAHY01110287.1:1..20412),gap(3435),
CO   complement(AAHY01110288.1:1..5237),gap(20),AAHY01110289.1:1..1540,gap(20),
CO   complement(AAHY01110290.1:1..1305),gap(20),AAHY01110291.1:1..2323,
CO   gap(1023),AAHY01110292.1:1..1200,gap(20),AAHY01110293.1:1..682,gap(371),
CO   complement(AAHY01110294.1:1..33134),gap(45),
CO   complement(AAHY01110295.1:1..4774),gap(109),
CO   complement(AAHY01110296.1:1..1137),gap(20),
CO   complement(AAHY01110297.1:1..10703),gap(155),AAHY01110298.1:1..32507,
CO   gap(20),complement(AAHY01110299.1:1..18507),gap(147),
CO   complement(AAHY01110300.1:1..39555),gap(313),AAHY01110301.1:1..2401,
CO   gap(288),complement(AAHY01110302.1:1..741),gap(245),
CO   complement(AAHY01110303.1:1..108847),gap(20),
CO   complement(AAHY01110304.1:1..53042),gap(20),
CO   complement(AAHY01110305.1:1..1100),gap(20),
CO   complement(AAHY01110306.1:1..2902),gap(20),
CO   complement(AAHY01110307.1:1..2110),gap(20),
CO   complement(AAHY01110308.1:1..7049),gap(20),AAHY01110309.1:1..7654,gap(20),
CO   AAHY01110310.1:1..1152,gap(8047),complement(AAHY01110311.1:1..3984),
CO   gap(3180),AAHY01110312.1:1..1541,gap(319),
CO   complement(AAHY01110313.1:1..17949),gap(353),
CO   complement(AAHY01110314.1:1..3511),gap(69),AAHY01110315.1:1..1208,gap(289),
CO   complement(AAHY01110316.1:1..2336),gap(6704),AAHY01110317.1:1..1589,
CO   gap(20),AAHY01110318.1:1..2572,gap(20),AAHY01110319.1:1..1992,gap(20),
CO   AAHY01110320.1:1..2105,gap(20),complement(AAHY01110321.1:1..1703),
CO   gap(6317),complement(AAHY01110322.1:1..19622),gap(6265),
CO   complement(AAHY01110323.1:1..1299),gap(4069),
CO   complement(AAHY01110324.1:1..1267),gap(20),
CO   complement(AAHY01110325.1:1..12264),gap(1030),
CO   complement(AAHY01110326.1:1..27690),gap(141),AAHY01110327.1:1..3974,
CO   gap(862),complement(AAHY01110328.1:1..10940),gap(1112),
CO   complement(AAHY01110329.1:1..8608),gap(20),
CO   complement(AAHY01110330.1:1..1289),gap(20),AAHY01110331.1:1..2153,gap(20),
CO   complement(AAHY01110332.1:1..5421),gap(271),
CO   complement(AAHY01110333.1:1..6581),gap(20),
CO   complement(AAHY01110334.1:1..17908),gap(118),
CO   complement(AAHY01110335.1:1..11709),gap(20),AAHY01110336.1:1..1277,gap(20),
CO   complement(AAHY01110337.1:1..16778),gap(20),
CO   complement(AAHY01110338.1:1..2276),gap(20),
CO   complement(AAHY01110339.1:1..13303),gap(237),
CO   complement(AAHY01110340.1:1..6293),gap(368),
CO   complement(AAHY01110341.1:1..3678),gap(130),
CO   complement(AAHY01110342.1:1..3842),gap(20),
CO   complement(AAHY01110343.1:1..7458),gap(20),AAHY01110344.1:1..1517,gap(20),
CO   complement(AAHY01110345.1:1..36139),gap(791),
CO   complement(AAHY01110346.1:1..1088),gap(423),
CO   complement(AAHY01110347.1:1..17886),gap(1309),AAHY01110348.1:1..3133,
CO   gap(20),complement(AAHY01110349.1:1..1693),gap(20),
CO   complement(AAHY01110350.1:1..5324),gap(20),AAHY01110351.1:1..2507,gap(20),
CO   AAHY01110352.1:1..1193,gap(20),AAHY01110353.1:1..5784,gap(380),
CO   complement(AAHY01110354.1:1..6251),gap(33),
CO   complement(AAHY01110355.1:1..21230),gap(20),
CO   complement(AAHY01110356.1:1..54146),gap(90),
CO   complement(AAHY01110357.1:1..12028),gap(20),
CO   complement(AAHY01110358.1:1..6372),gap(20),
CO   complement(AAHY01110359.1:1..1430),gap(20),AAHY01110360.1:1..4472,gap(665),
CO   complement(AAHY01110361.1:1..3187),gap(77),
CO   complement(AAHY01110362.1:1..11356),gap(27),AAHY01110363.1:1..13912,
CO   gap(680),complement(AAHY01110364.1:1..17526),gap(64),
CO   complement(AAHY01110365.1:1..24470),gap(20),
CO   complement(AAHY01110366.1:1..14557),gap(950),
CO   complement(AAHY01110367.1:1..2650),gap(199),
CO   complement(AAHY01110368.1:1..20080),gap(176),
CO   complement(AAHY01110369.1:1..3196),gap(215),
CO   complement(AAHY01110370.1:1..40111),gap(152),
CO   complement(AAHY01110371.1:1..21041),gap(20),
CO   complement(AAHY01110372.1:1..1136),gap(3244),
CO   complement(AAHY01110373.1:1..24053),gap(20),
CO   complement(AAHY01110374.1:1..24856),gap(20),
CO   complement(AAHY01110375.1:1..20085),gap(20),
CO   complement(AAHY01110376.1:1..35307),gap(20),
CO   complement(AAHY01110377.1:1..4422),gap(20),
CO   complement(AAHY01110378.1:1..13178),gap(339),
CO   complement(AAHY01110379.1:1..1267),gap(887),
CO   complement(AAHY01110380.1:1..5368),gap(20),
CO   complement(AAHY01110381.1:1..3204),gap(149),AAHY01110382.1:1..5832,
CO   gap(1085),complement(AAHY01110383.1:1..18801),gap(493),
CO   complement(AAHY01110384.1:1..3969),gap(49),
CO   complement(AAHY01110385.1:1..10354),gap(89),
CO   complement(AAHY01110386.1:1..2408),gap(63),
CO   complement(AAHY01110387.1:1..14993),gap(20),AAHY01110388.1:1..11951,
CO   gap(137),AAHY01110389.1:1..2240,gap(165),
CO   complement(AAHY01110390.1:1..13011),gap(136),
CO   complement(AAHY01110391.1:1..15972),gap(20),AAHY01110392.1:1..8522,gap(20),
CO   AAHY01110393.1:1..1531,gap(20),complement(AAHY01110394.1:1..1524),gap(941),
CO   complement(AAHY01110395.1:1..3180),gap(182),
CO   complement(AAHY01110396.1:1..3366),gap(128),
CO   complement(AAHY01110397.1:1..2355),gap(237),
CO   complement(AAHY01110398.1:1..19872),gap(40),
CO   complement(AAHY01110399.1:1..3396),gap(866),
CO   complement(AAHY01110400.1:1..4382),gap(407),
CO   complement(AAHY01110401.1:1..2774),gap(20),
CO   complement(AAHY01110402.1:1..1101),gap(20),AAHY01110403.1:1..1031,gap(20),
CO   AAHY01110404.1:1..20343,gap(20),complement(AAHY01110405.1:1..1768),gap(20),
CO   AAHY01110406.1:1..1429,gap(20),complement(AAHY01110407.1:1..16186),gap(20),
CO   complement(AAHY01110408.1:1..1336),gap(20),AAHY01110409.1:1..1867,gap(20),
CO   complement(AAHY01110410.1:1..6406),gap(20),
CO   complement(AAHY01110411.1:1..2204),gap(20),
CO   complement(AAHY01110412.1:1..2075),gap(20),
CO   complement(AAHY01110413.1:1..18314),gap(20),
CO   complement(AAHY01110414.1:1..6363),gap(20),
CO   complement(AAHY01110415.1:1..6403),gap(20),
CO   complement(AAHY01110416.1:1..40249),gap(20),
CO   complement(AAHY01110417.1:1..7204),gap(20),
CO   complement(AAHY01110418.1:1..1242),gap(371),
CO   complement(AAHY01110419.1:1..46562),gap(20),
CO   complement(AAHY01110420.1:1..36274),gap(6445),AAHY01110421.1:1..1118,
CO   gap(20),AAHY01110422.1:1..1178,gap(20),AAHY01110423.1:1..9787,gap(20),
CO   complement(AAHY01110424.1:1..33974),gap(20),
CO   complement(AAHY01110425.1:1..3289),gap(5640),
CO   complement(AAHY01110426.1:1..32018),gap(20),
CO   complement(AAHY01110427.1:1..1235),gap(20),
CO   complement(AAHY01110428.1:1..1391),gap(646),
CO   complement(AAHY01110429.1:1..78671),gap(133),
CO   complement(AAHY01110430.1:1..19826),gap(532),
CO   complement(AAHY01110431.1:1..40537),gap(20),AAHY01110432.1:1..3293,gap(65),
CO   AAHY01110433.1:1..6989,gap(331),complement(AAHY01110434.1:1..11459),
CO   gap(31),complement(AAHY01110435.1:1..1581),gap(214),
CO   complement(AAHY01110436.1:1..9672),gap(687),
CO   complement(AAHY01110437.1:1..13635),gap(20),AAHY01110438.1:1..1123,gap(20),
CO   complement(AAHY01110439.1:1..1194),gap(20),AAHY01110440.1:1..2731,gap(134),
CO   complement(AAHY01110441.1:1..6971),gap(20),AAHY01110442.1:1..1693,gap(20),
CO   AAHY01110443.1:1..1025,gap(20),AAHY01110444.1:1..1559,gap(20),
CO   complement(AAHY01110445.1:1..1439),gap(20),
CO   complement(AAHY01110446.1:1..1685),gap(20),
CO   complement(AAHY01110447.1:1..2886),gap(418),
CO   complement(AAHY01110448.1:1..4614),gap(165),
CO   complement(AAHY01110449.1:1..17027),gap(481),AAHY01110450.1:1..22534,
CO   gap(20),complement(AAHY01110451.1:1..1851),gap(680),
CO   complement(AAHY01110452.1:1..2163),gap(20),AAHY01110453.1:1..11050,
CO   gap(252),complement(AAHY01110454.1:1..13715),gap(20),
CO   AAHY01110455.1:1..22889,gap(20),AAHY01110456.1:1..1845,gap(20),
CO   AAHY01110457.1:1..30564,gap(20),AAHY01110458.1:1..15634,gap(71),
CO   AAHY01110459.1:1..6493,gap(20),complement(AAHY01110460.1:1..10454),gap(20),
CO   AAHY01110461.1:1..2187,gap(20),AAHY01110462.1:1..2445,gap(20),
CO   complement(AAHY01110463.1:1..1920),gap(20),
CO   complement(AAHY01110464.1:1..1695),gap(6236),
CO   complement(AAHY01110465.1:1..1822),gap(20),
CO   complement(AAHY01110466.1:1..24225),gap(42),AAHY01110467.1:1..2608,gap(20),
CO   complement(AAHY01110468.1:1..29770),gap(53),
CO   complement(AAHY01110469.1:1..52692),gap(4572),AAHY01110470.1:1..893,
CO   gap(309),AAHY01110471.1:1..718,gap(20),AAHY01110472.1:1..2063,gap(590),
CO   AAHY01110473.1:1..1318,gap(5073),complement(AAHY01110474.1:1..1395),
CO   gap(20),complement(AAHY01110475.1:1..2519),gap(20),AAHY01110476.1:1..1269,
CO   gap(186),complement(AAHY01110477.1:1..23554),gap(560),
CO   complement(AAHY01110478.1:1..2278),gap(20),
CO   complement(AAHY01110479.1:1..4112),gap(20),AAHY01110480.1:1..1194,gap(20),
CO   complement(AAHY01110481.1:1..1231),gap(20),
CO   complement(AAHY01110482.1:1..2273),gap(20),
CO   complement(AAHY01110483.1:1..1711),gap(20),AAHY01110484.1:1..1173,gap(20),
CO   complement(AAHY01110485.1:1..26435),gap(20),AAHY01110486.1:1..1922,gap(20),
CO   AAHY01110487.1:1..1047,gap(20),complement(AAHY01110488.1:1..8690),gap(20),
CO   complement(AAHY01110489.1:1..43351),gap(20),
CO   complement(AAHY01110490.1:1..35481),gap(2409),
CO   complement(AAHY01110491.1:1..1421),gap(280),
CO   complement(AAHY01110492.1:1..1475),gap(20),AAHY01110493.1:1..1312,gap(20),
CO   complement(AAHY01110494.1:1..8820),gap(20),
CO   complement(AAHY01110495.1:1..11310),gap(700),
CO   complement(AAHY01110496.1:1..3268),gap(2482),
CO   complement(AAHY01110497.1:1..25554),gap(20),AAHY01110498.1:1..1435,gap(20),
CO   complement(AAHY01110499.1:1..3420),gap(182),AAHY01110500.1:1..1667,gap(20),
CO   complement(AAHY01110501.1:1..15121),gap(20),
CO   complement(AAHY01110502.1:1..11488),gap(938),AAHY01110503.1:1..1424,
CO   gap(345),complement(AAHY01110504.1:1..16834),gap(63),
CO   AAHY01110505.1:1..3527,gap(175),AAHY01110506.1:1..3038,gap(362),
CO   complement(AAHY01110507.1:1..1458),gap(2842),
CO   complement(AAHY01110508.1:1..1214),gap(142),
CO   complement(AAHY01110509.1:1..3400),gap(920),
CO   complement(AAHY01110510.1:1..38412),gap(20),
CO   complement(AAHY01110511.1:1..6067),gap(272),
CO   complement(AAHY01110512.1:1..3162),gap(20),
CO   complement(AAHY01110513.1:1..3813),gap(20),
CO   complement(AAHY01110514.1:1..25668),gap(20),AAHY01110515.1:1..8453,
CO   gap(545),AAHY01110516.1:1..4380,gap(20),AAHY01110517.1:1..2918,gap(20),
CO   complement(AAHY01110518.1:1..6135),gap(1013),AAHY01110519.1:1..6328,
CO   gap(13162),complement(AAHY01110520.1:1..3922),gap(504),
CO   complement(AAHY01110521.1:1..1182),gap(2350),
CO   complement(AAHY01110522.1:1..32397),gap(83),AAHY01110523.1:1..4753,gap(20),
CO   complement(AAHY01110524.1:1..1486),gap(208),
CO   complement(AAHY01110525.1:1..2442),gap(20),
CO   complement(AAHY01110526.1:1..2215),gap(20),
CO   complement(AAHY01110527.1:1..1529),gap(20),AAHY01110528.1:1..3101,gap(267),
CO   complement(AAHY01110529.1:1..8797),gap(48),
CO   complement(AAHY01110530.1:1..64213),gap(383),AAHY01110531.1:1..7761,
CO   gap(20),complement(AAHY01110532.1:1..13927),gap(20),
CO   complement(AAHY01110533.1:1..1418),gap(20),AAHY01110534.1:1..1167,gap(20),
CO   AAHY01110535.1:1..3235,gap(20),complement(AAHY01110536.1:1..3954),gap(431),
CO   complement(AAHY01110537.1:1..1515),gap(163),
CO   complement(AAHY01110538.1:1..3585),gap(20),
CO   complement(AAHY01110539.1:1..1038),gap(20),
CO   complement(AAHY01110540.1:1..15042),gap(20),AAHY01110541.1:1..14731,
CO   gap(1634),AAHY01110542.1:1..2267,gap(20),AAHY01110543.1:1..1193,gap(20),
CO   AAHY01110544.1:1..1297,gap(20),AAHY01110545.1:1..1148,gap(20),
CO   complement(AAHY01110546.1:1..1087),gap(20),
CO   complement(AAHY01110547.1:1..1630),gap(20),AAHY01110548.1:1..1031,gap(20),
CO   complement(AAHY01110549.1:1..4156),gap(20),AAHY01110550.1:1..1400,gap(20),
CO   complement(AAHY01110551.1:1..6685),gap(279),
CO   complement(AAHY01110552.1:1..2116),gap(20),
CO   complement(AAHY01110553.1:1..3882),gap(20),
CO   complement(AAHY01110554.1:1..1818),gap(608),AAHY01110555.1:1..1493,
CO   gap(1347),complement(AAHY01110556.1:1..14715),gap(20),
CO   complement(AAHY01110557.1:1..2570),gap(131),
CO   complement(AAHY01110558.1:1..3716),gap(20),
CO   complement(AAHY01110559.1:1..18204),gap(20),
CO   complement(AAHY01110560.1:1..4384),gap(20),
CO   complement(AAHY01110561.1:1..38918),gap(20),
CO   complement(AAHY01110562.1:1..13344),gap(20),AAHY01110563.1:1..1184,gap(20),
CO   AAHY01110564.1:1..1194,gap(20),AAHY01110565.1:1..1267,gap(162),
CO   AAHY01110566.1:1..1347,gap(20),AAHY01110567.1:1..1458,gap(1293),
CO   complement(AAHY01110568.1:1..1175),gap(4681),
CO   complement(AAHY01110569.1:1..32749),gap(20),
CO   complement(AAHY01110570.1:1..33867),gap(20),
CO   complement(AAHY01110571.1:1..2595),gap(20),
CO   complement(AAHY01110572.1:1..4269),gap(107),
CO   complement(AAHY01110573.1:1..10459),gap(20),
CO   complement(AAHY01110574.1:1..4731),gap(43),
CO   complement(AAHY01110575.1:1..8520),gap(20),
CO   complement(AAHY01110576.1:1..31394),gap(6398),
CO   complement(AAHY01110577.1:1..1487),gap(20),
CO   complement(AAHY01110578.1:1..1098),gap(20),
CO   complement(AAHY01110579.1:1..19753),gap(220),
CO   complement(AAHY01110580.1:1..3297),gap(20),
CO   complement(AAHY01110581.1:1..5918),gap(530),
CO   complement(AAHY01110582.1:1..1248),gap(369),
CO   complement(AAHY01110583.1:1..3744),gap(20),AAHY01110584.1:1..1585,gap(20),
CO   complement(AAHY01110585.1:1..6246),gap(3115),
CO   complement(AAHY01110586.1:1..5584),gap(1831),
CO   complement(AAHY01110587.1:1..1667),gap(20),
CO   complement(AAHY01110588.1:1..16128),gap(1045),
CO   complement(AAHY01110589.1:1..38212),gap(3059),
CO   complement(AAHY01110590.1:1..1116),gap(412),
CO   complement(AAHY01110591.1:1..10297),gap(20),
CO   complement(AAHY01110592.1:1..6510),gap(20),
CO   complement(AAHY01110593.1:1..2168),gap(20),
CO   complement(AAHY01110594.1:1..2739),gap(20),
CO   complement(AAHY01110595.1:1..1467),gap(20),AAHY01110596.1:1..1569,gap(820),
CO   complement(AAHY01110597.1:1..1267),gap(20),
CO   complement(AAHY01110598.1:1..1405),gap(20),
CO   complement(AAHY01110599.1:1..26835),gap(20),
CO   complement(AAHY01110600.1:1..9001),gap(1240),AAHY01110601.1:1..1346,
CO   gap(20),AAHY01110602.1:1..1708,gap(27),complement(AAHY01110603.1:1..10733),
CO   gap(20),complement(AAHY01110604.1:1..17623),gap(268),
CO   complement(AAHY01110605.1:1..18418),gap(20),
CO   complement(AAHY01110606.1:1..4193),gap(26),AAHY01110607.1:1..2691,
CO   gap(1678),complement(AAHY01110608.1:1..1505),gap(20),
CO   complement(AAHY01110609.1:1..1132),gap(202),
CO   complement(AAHY01110610.1:1..1494),gap(20),AAHY01110611.1:1..1212,gap(20),
CO   AAHY01110612.1:1..1007,gap(20),complement(AAHY01110613.1:1..1213),gap(131),
CO   complement(AAHY01110614.1:1..4720),gap(20),
CO   complement(AAHY01110615.1:1..19030),gap(1306),
CO   complement(AAHY01110616.1:1..14817),gap(70),
CO   complement(AAHY01110617.1:1..1119),gap(35),
CO   complement(AAHY01110618.1:1..58707),gap(20),
CO   complement(AAHY01110619.1:1..1416),gap(20),
CO   complement(AAHY01110620.1:1..8750),gap(189),
CO   complement(AAHY01110621.1:1..1207),gap(20),
CO   complement(AAHY01110622.1:1..3326),gap(20),
CO   complement(AAHY01110623.1:1..26917),gap(20),
CO   complement(AAHY01110624.1:1..1771),gap(20),
CO   complement(AAHY01110625.1:1..20815),gap(20),AAHY01110626.1:1..1221,gap(20),
CO   complement(AAHY01110627.1:1..7197),gap(20),
CO   complement(AAHY01110628.1:1..1112),gap(20),
CO   complement(AAHY01110629.1:1..26875),gap(63),
CO   complement(AAHY01110630.1:1..1232),gap(20),
CO   complement(AAHY01110631.1:1..2017),gap(791),
CO   complement(AAHY01110632.1:1..16917),gap(155),
CO   complement(AAHY01110633.1:1..19471),gap(149),
CO   complement(AAHY01110634.1:1..1450),gap(1627),
CO   complement(AAHY01110635.1:1..9926),gap(20),
CO   complement(AAHY01110636.1:1..11055),gap(20),AAHY01110637.1:1..2694,gap(57),
CO   complement(AAHY01110638.1:1..12635),gap(20),AAHY01110639.1:1..24237,
CO   gap(57),complement(AAHY01110640.1:1..15534),gap(20),
CO   complement(AAHY01110641.1:1..5870),gap(168),AAHY01110642.1:1..1341,gap(20),
CO   AAHY01110643.1:1..1002,gap(20),AAHY01110644.1:1..1735,gap(84),
CO   complement(AAHY01110645.1:1..18572),gap(20),
CO   complement(AAHY01110646.1:1..16315),gap(308),
CO   complement(AAHY01110647.1:1..18905),gap(535),
CO   complement(AAHY01110648.1:1..10787),gap(3590),AAHY01110649.1:1..1607,
CO   gap(563),complement(AAHY01110650.1:1..29460),gap(20),
CO   complement(AAHY01110651.1:1..2472),gap(20),
CO   complement(AAHY01110652.1:1..4233),gap(342),
CO   complement(AAHY01110653.1:1..6475),gap(20),
CO   complement(AAHY01110654.1:1..1188),gap(20),
CO   complement(AAHY01110655.1:1..1833),gap(20),
CO   complement(AAHY01110656.1:1..21154),gap(73),
CO   complement(AAHY01110657.1:1..6139),gap(3309),
CO   complement(AAHY01110658.1:1..3860),gap(771),AAHY01110659.1:1..1207,
CO   gap(969),AAHY01110660.1:1..3608,gap(321),
CO   complement(AAHY01110661.1:1..46855),gap(20),
CO   complement(AAHY01110662.1:1..4484),gap(1437),
CO   complement(AAHY01110663.1:1..19761),gap(20),AAHY01110664.1:1..1028,gap(20),
CO   complement(AAHY01110665.1:1..1843),gap(20),
CO   complement(AAHY01110666.1:1..1199),gap(20),AAHY01110667.1:1..1077,gap(20),
CO   complement(AAHY01110668.1:1..14919),gap(560),
CO   complement(AAHY01110669.1:1..6109),gap(20),
CO   complement(AAHY01110670.1:1..1210),gap(20),
CO   complement(AAHY01110671.1:1..8175),gap(20),
CO   complement(AAHY01110672.1:1..10366),gap(682),
CO   complement(AAHY01110673.1:1..13799),gap(1386),
CO   complement(AAHY01110674.1:1..850),gap(753),AAHY01110675.1:1..1121,gap(20),
CO   complement(AAHY01110676.1:1..1294),gap(20),AAHY01110677.1:1..16618,gap(95),
CO   complement(AAHY01110678.1:1..27708),gap(20),
CO   complement(AAHY01110679.1:1..1596),gap(20),AAHY01110680.1:1..2371,gap(20),
CO   complement(AAHY01110681.1:1..9222),gap(20),
CO   complement(AAHY01110682.1:1..3541),gap(20),
CO   complement(AAHY01110683.1:1..3980),gap(20),
CO   complement(AAHY01110684.1:1..4284),gap(20),AAHY01110685.1:1..1178,gap(20),
CO   AAHY01110686.1:1..1588,gap(20),complement(AAHY01110687.1:1..3478),gap(20),
CO   complement(AAHY01110688.1:1..1642),gap(20),
CO   complement(AAHY01110689.1:1..1362),gap(20),AAHY01110690.1:1..1115,
CO   gap(3185),AAHY01110691.1:1..1116,gap(20),
CO   complement(AAHY01110692.1:1..1508),gap(3223),
CO   complement(AAHY01110693.1:1..11686),gap(20),
CO   complement(AAHY01110694.1:1..19752),gap(39),
CO   complement(AAHY01110695.1:1..3209),gap(537),AAHY01110696.1:1..1358,gap(92),
CO   complement(AAHY01110697.1:1..16613),gap(32),AAHY01110698.1:1..2500,gap(20),
CO   AAHY01110699.1:1..1464,gap(20),complement(AAHY01110700.1:1..7763),gap(369),
CO   complement(AAHY01110701.1:1..4509),gap(489),
CO   complement(AAHY01110702.1:1..10042),gap(20),AAHY01110703.1:1..1110,gap(20),
CO   complement(AAHY01110704.1:1..9970),gap(20),
CO   complement(AAHY01110705.1:1..15929),gap(20),
CO   complement(AAHY01110706.1:1..6127),gap(20),
CO   complement(AAHY01110707.1:1..6296),gap(20),
CO   complement(AAHY01110708.1:1..1812),gap(20),
CO   complement(AAHY01110709.1:1..3416),gap(20),
CO   complement(AAHY01110710.1:1..3165),gap(20),AAHY01110711.1:1..9239,gap(20),
CO   complement(AAHY01110712.1:1..1614),gap(4955),
CO   complement(AAHY01110713.1:1..6520),gap(1579),
CO   complement(AAHY01110714.1:1..11086),gap(20),
CO   complement(AAHY01110715.1:1..9668),gap(412),
CO   complement(AAHY01110716.1:1..20175),gap(285),
CO   complement(AAHY01110717.1:1..3347),gap(164),
CO   complement(AAHY01110718.1:1..4832),gap(20),AAHY01110719.1:1..1286,gap(20),
CO   AAHY01110720.1:1..8906,gap(696),AAHY01110721.1:1..704,gap(1322),
CO   complement(AAHY01110722.1:1..1471),gap(940),
CO   complement(AAHY01110723.1:1..12057),gap(20),AAHY01110724.1:1..990,gap(20),
CO   complement(AAHY01110725.1:1..4638),gap(20),
CO   complement(AAHY01110726.1:1..5794),gap(20),
CO   complement(AAHY01110727.1:1..28687),gap(20),
CO   complement(AAHY01110728.1:1..12681),gap(20),
CO   complement(AAHY01110729.1:1..2611),gap(20),AAHY01110730.1:1..1930,gap(20),
CO   complement(AAHY01110731.1:1..22193),gap(20),
CO   complement(AAHY01110732.1:1..2370),gap(20),AAHY01110733.1:1..15481,gap(92),
CO   complement(AAHY01110734.1:1..7267),gap(20),
CO   complement(AAHY01110735.1:1..11783),gap(20),
CO   complement(AAHY01110736.1:1..2182),gap(20),
CO   complement(AAHY01110737.1:1..2536),gap(20),
CO   complement(AAHY01110738.1:1..18890),gap(20),
CO   complement(AAHY01110739.1:1..21205),gap(20),AAHY01110740.1:1..2105,gap(20),
CO   complement(AAHY01110741.1:1..1365),gap(20),AAHY01110742.1:1..1354,
CO   gap(2010),complement(AAHY01110743.1:1..2209),gap(20),
CO   complement(AAHY01110744.1:1..1427),gap(20),
CO   complement(AAHY01110745.1:1..2293),gap(176),
CO   complement(AAHY01110746.1:1..25189),gap(20),
CO   complement(AAHY01110747.1:1..28253),gap(432),AAHY01110748.1:1..3983,
CO   gap(183),complement(AAHY01110749.1:1..1828),gap(20),
CO   complement(AAHY01110750.1:1..1495),gap(20),
CO   complement(AAHY01110751.1:1..3175),gap(20),
CO   complement(AAHY01110752.1:1..3170),gap(599),
CO   complement(AAHY01110753.1:1..4055),gap(20),
CO   complement(AAHY01110754.1:1..6395),gap(859),
CO   complement(AAHY01110755.1:1..12854),gap(272),
CO   complement(AAHY01110756.1:1..1548),gap(641),
CO   complement(AAHY01110757.1:1..20763),gap(752),
CO   complement(AAHY01110758.1:1..13075),gap(94),AAHY01110759.1:1..1605,gap(20),
CO   complement(AAHY01110760.1:1..20867),gap(200),
CO   complement(AAHY01110761.1:1..23076),gap(20),
CO   complement(AAHY01110762.1:1..2727),gap(20),
CO   complement(AAHY01110763.1:1..2273),gap(20),AAHY01110764.1:1..1858,gap(20),
CO   complement(AAHY01110765.1:1..3485),gap(20),
CO   complement(AAHY01110766.1:1..11152),gap(20),
CO   complement(AAHY01110767.1:1..8001),gap(20),
CO   complement(AAHY01110768.1:1..18033),gap(20),AAHY01110769.1:1..13004,
CO   gap(20),complement(AAHY01110770.1:1..21863),gap(20),
CO   complement(AAHY01110771.1:1..13473),gap(634),
CO   complement(AAHY01110772.1:1..6707),gap(20),
CO   complement(AAHY01110773.1:1..1998),gap(20),
CO   complement(AAHY01110774.1:1..24835),gap(20),
CO   complement(AAHY01110775.1:1..25536),gap(142),AAHY01110776.1:1..2716,
CO   gap(20),complement(AAHY01110777.1:1..8102),gap(20),
CO   complement(AAHY01110778.1:1..1142),gap(20),
CO   complement(AAHY01110779.1:1..1237),gap(20),
CO   complement(AAHY01110780.1:1..10168),gap(58),
CO   complement(AAHY01110781.1:1..2724),gap(20),
CO   complement(AAHY01110782.1:1..9523),gap(20),
CO   complement(AAHY01110783.1:1..2037),gap(20),AAHY01110784.1:1..1129,gap(20),
CO   AAHY01110785.1:1..1408,gap(20),AAHY01110786.1:1..1596,gap(20),
CO   complement(AAHY01110787.1:1..2034),gap(20),AAHY01110788.1:1..1568,gap(20),
CO   complement(AAHY01110789.1:1..3101),gap(20),
CO   complement(AAHY01110790.1:1..3329),gap(20),
CO   complement(AAHY01110791.1:1..2636),gap(20),
CO   complement(AAHY01110792.1:1..22767),gap(20),
CO   complement(AAHY01110793.1:1..25627),gap(363),
CO   complement(AAHY01110794.1:1..28404),gap(20),AAHY01110795.1:1..1968,gap(20),
CO   complement(AAHY01110796.1:1..16061),gap(177),AAHY01110797.1:1..15967,
CO   gap(831),AAHY01110798.1:1..3875,gap(20),complement(AAHY01110799.1:1..1286),
CO   gap(427),complement(AAHY01110800.1:1..1163),gap(20),AAHY01110801.1:1..1125,
CO   gap(20),complement(AAHY01110802.1:1..12337),gap(20),
CO   complement(AAHY01110803.1:1..3047),gap(20),
CO   complement(AAHY01110804.1:1..1218),gap(20),
CO   complement(AAHY01110805.1:1..14340),gap(20),
CO   complement(AAHY01110806.1:1..2366),gap(20),
CO   complement(AAHY01110807.1:1..12589),gap(1674),AAHY01110808.1:1..1558,
CO   gap(230),complement(AAHY01110809.1:1..1420),gap(20),
CO   complement(AAHY01110810.1:1..70652),gap(20),AAHY01110811.1:1..1079,
CO   gap(290),AAHY01110812.1:1..4227,gap(20),AAHY01110813.1:1..1411,gap(491),
CO   complement(AAHY01110814.1:1..19330),gap(117),
CO   complement(AAHY01110815.1:1..5366),gap(20),
CO   complement(AAHY01110816.1:1..39766),gap(1607),
CO   complement(AAHY01110817.1:1..1230),gap(20),
CO   complement(AAHY01110818.1:1..2674),gap(20),AAHY01110819.1:1..1396,
CO   gap(4823),complement(AAHY01110820.1:1..4164),gap(20),
CO   AAHY01110821.1:1..3409,gap(20),complement(AAHY01110822.1:1..2095),gap(343),
CO   complement(AAHY01110823.1:1..11968),gap(116),AAHY01110824.1:1..1622,
CO   gap(201),complement(AAHY01110825.1:1..10379),gap(20),
CO   complement(AAHY01110826.1:1..28871),gap(20),
CO   complement(AAHY01110827.1:1..7791),gap(558),AAHY01110828.1:1..15147,
CO   gap(20),complement(AAHY01110829.1:1..1379),gap(20),AAHY01110830.1:1..5954,
CO   gap(20),AAHY01110831.1:1..2250,gap(20),complement(AAHY01110832.1:1..9412),
CO   gap(20),complement(AAHY01110833.1:1..15729),gap(20),
CO   complement(AAHY01110834.1:1..4627),gap(20),
CO   complement(AAHY01110835.1:1..2077),gap(94),
CO   complement(AAHY01110836.1:1..1150),gap(20),
CO   complement(AAHY01110837.1:1..19175),gap(1838),
CO   complement(AAHY01110838.1:1..1350),gap(20),
CO   complement(AAHY01110839.1:1..1594),gap(20),
CO   complement(AAHY01110840.1:1..4647),gap(20),AAHY01110841.1:1..1229,gap(20),
CO   AAHY01110842.1:1..1519,gap(20),AAHY01110843.1:1..1211,gap(20),
CO   AAHY01110844.1:1..3034,gap(20),complement(AAHY01110845.1:1..2902),gap(772),
CO   AAHY01110846.1:1..1801,gap(20),complement(AAHY01110847.1:1..15906),gap(83),
CO   complement(AAHY01110848.1:1..4047),gap(56),
CO   complement(AAHY01110849.1:1..10696),gap(20),
CO   complement(AAHY01110850.1:1..38490),gap(20),
CO   complement(AAHY01110851.1:1..2153),gap(350),
CO   complement(AAHY01110852.1:1..27574),gap(660),
CO   complement(AAHY01110853.1:1..20764),gap(20),
CO   complement(AAHY01110854.1:1..1044),gap(20),
CO   complement(AAHY01110855.1:1..2959),gap(99),
CO   complement(AAHY01110856.1:1..21295),gap(20),AAHY01110857.1:1..1471,gap(20),
CO   AAHY01110858.1:1..1958,gap(568),AAHY01110859.1:1..4538,gap(20),
CO   complement(AAHY01110860.1:1..7377),gap(20),AAHY01110861.1:1..14744,gap(20),
CO   AAHY01110862.1:1..5302,gap(20),AAHY01110863.1:1..17566,gap(20),
CO   complement(AAHY01110864.1:1..8916),gap(20),
CO   complement(AAHY01110865.1:1..1106),gap(20),
CO   complement(AAHY01110866.1:1..29335),gap(772),
CO   complement(AAHY01110867.1:1..1043),gap(20),AAHY01110868.1:1..1096,gap(20),
CO   complement(AAHY01110869.1:1..9328),gap(20),
CO   complement(AAHY01110870.1:1..31230),gap(862),
CO   complement(AAHY01110871.1:1..1797),gap(20),AAHY01110872.1:1..12579,gap(20),
CO   complement(AAHY01110873.1:1..6067),gap(20),
CO   complement(AAHY01110874.1:1..24346),gap(20),AAHY01110875.1:1..19150,
CO   gap(20),AAHY01110876.1:1..1665,gap(20),AAHY01110877.1:1..1017,gap(20),
CO   complement(AAHY01110878.1:1..10105),gap(20),
CO   complement(AAHY01110879.1:1..1852),gap(20),AAHY01110880.1:1..1031,gap(20),
CO   AAHY01110881.1:1..38260,gap(1767),complement(AAHY01110882.1:1..37301),
CO   gap(247),AAHY01110883.1:1..861,gap(20),complement(AAHY01110884.1:1..1739),
CO   gap(36),complement(AAHY01110885.1:1..35588),gap(3021),
CO   complement(AAHY01110886.1:1..1409),gap(20),
CO   complement(AAHY01110887.1:1..5133),gap(37),
CO   complement(AAHY01110888.1:1..11644),gap(93),
CO   complement(AAHY01110889.1:1..2901),gap(20),AAHY01110890.1:1..1141,
CO   gap(2392),AAHY01110891.1:1..1302,gap(2238),AAHY01110892.1:1..4216,gap(572),
CO   complement(AAHY01110893.1:1..4890),gap(20),
CO   complement(AAHY01110894.1:1..20379),gap(20),
CO   complement(AAHY01110895.1:1..8748),gap(20),
CO   complement(AAHY01110896.1:1..1106),gap(20),AAHY01110897.1:1..3120,gap(20),
CO   complement(AAHY01110898.1:1..32424),gap(20),AAHY01110899.1:1..1229,gap(20),
CO   AAHY01110900.1:1..1631,gap(20),complement(AAHY01110901.1:1..3199),gap(747),
CO   complement(AAHY01110902.1:1..4065),gap(2387),
CO   complement(AAHY01110903.1:1..5755),gap(497),AAHY01110904.1:1..8816,
CO   gap(305),complement(AAHY01110905.1:1..8263),gap(20),
CO   complement(AAHY01110906.1:1..17667),gap(619),
CO   complement(AAHY01110907.1:1..3381),gap(838),
CO   complement(AAHY01110908.1:1..6279),gap(347),AAHY01110909.1:1..1347,gap(20),
CO   complement(AAHY01110910.1:1..8089),gap(1347),AAHY01110911.1:1..2551,
CO   gap(356),complement(AAHY01110912.1:1..5575),gap(20),AAHY01110913.1:1..2414,
CO   gap(93),complement(AAHY01110914.1:1..24249),gap(36),
CO   complement(AAHY01110915.1:1..3267),gap(20),
CO   complement(AAHY01110916.1:1..1476),gap(861),AAHY01110917.1:1..1087,gap(20),
CO   complement(AAHY01110918.1:1..1141),gap(20),
CO   complement(AAHY01110919.1:1..1178),gap(2836),
CO   complement(AAHY01110920.1:1..13614),gap(20),AAHY01110921.1:1..2082,gap(20),
CO   AAHY01110922.1:1..1413,gap(20),complement(AAHY01110923.1:1..2446),gap(20),
CO   AAHY01110924.1:1..1764,gap(20),complement(AAHY01110925.1:1..17576),gap(20),
CO   complement(AAHY01110926.1:1..1940),gap(1622),
CO   complement(AAHY01110927.1:1..3209),gap(20),
CO   complement(AAHY01110928.1:1..28127),gap(20),AAHY01110929.1:1..3031,gap(20),
CO   complement(AAHY01110930.1:1..3304),gap(20),
CO   complement(AAHY01110931.1:1..9405),gap(7751),
CO   complement(AAHY01110932.1:1..2883),gap(245),
CO   complement(AAHY01110933.1:1..34856),gap(25),
CO   complement(AAHY01110934.1:1..23819),gap(20),
CO   complement(AAHY01110935.1:1..8115),gap(201),
CO   complement(AAHY01110936.1:1..21919),gap(20),
CO   complement(AAHY01110937.1:1..4547),gap(521),
CO   complement(AAHY01110938.1:1..23779),gap(202),
CO   complement(AAHY01110939.1:1..34095),gap(45),
CO   complement(AAHY01110940.1:1..2872),gap(20),
CO   complement(AAHY01110941.1:1..1275),gap(20),
CO   complement(AAHY01110942.1:1..1263),gap(415),
CO   complement(AAHY01110943.1:1..1693),gap(332),
CO   complement(AAHY01110944.1:1..2970),gap(20),AAHY01110945.1:1..4790,gap(20),
CO   complement(AAHY01110946.1:1..13030),gap(20),AAHY01110947.1:1..5109,gap(20),
CO   AAHY01110948.1:1..2421,gap(20),complement(AAHY01110949.1:1..7174),gap(20),
CO   AAHY01110950.1:1..3062,gap(30),complement(AAHY01110951.1:1..7180),gap(20),
CO   AAHY01110952.1:1..1725,gap(20),complement(AAHY01110953.1:1..1519),gap(20),
CO   complement(AAHY01110954.1:1..10744),gap(1466),
CO   complement(AAHY01110955.1:1..10417),gap(20),
CO   complement(AAHY01110956.1:1..28195),gap(20),
CO   complement(AAHY01110957.1:1..20473),gap(713),
CO   complement(AAHY01110958.1:1..1028),gap(17976),
CO   complement(AAHY01110959.1:1..20283),gap(743),
CO   complement(AAHY01110960.1:1..1988),gap(20),
CO   complement(AAHY01110961.1:1..806),gap(20),
CO   complement(AAHY01110962.1:1..3417),gap(4350),
CO   complement(AAHY01110963.1:1..9744),gap(95),
CO   complement(AAHY01110964.1:1..7058),gap(688),
CO   complement(AAHY01110965.1:1..9376),gap(48),
CO   complement(AAHY01110966.1:1..1578),gap(20),AAHY01110967.1:1..1390,gap(20),
CO   complement(AAHY01110968.1:1..1495),gap(20),AAHY01110969.1:1..1474,gap(20),
CO   AAHY01110970.1:1..1053,gap(20),complement(AAHY01110971.1:1..9451),gap(20),
CO   complement(AAHY01110972.1:1..2491),gap(50),
CO   complement(AAHY01110973.1:1..6040),gap(20),
CO   complement(AAHY01110974.1:1..4724),gap(20),
CO   complement(AAHY01110975.1:1..1632),gap(20),AAHY01110976.1:1..7741,gap(20),
CO   complement(AAHY01110977.1:1..3408),gap(20),
CO   complement(AAHY01110978.1:1..33592),gap(506),
CO   complement(AAHY01110979.1:1..12165),gap(68),
CO   complement(AAHY01110980.1:1..1424),gap(886),AAHY01110981.1:1..1119,gap(20),
CO   AAHY01110982.1:1..1396,gap(20),AAHY01110983.1:1..1480,gap(1618),
CO   complement(AAHY01110984.1:1..925),gap(20),AAHY01110985.1:1..1126,gap(20),
CO   AAHY01110986.1:1..1225,gap(20),complement(AAHY01110987.1:1..1236),gap(257),
CO   AAHY01110988.1:1..2850,gap(20),complement(AAHY01110989.1:1..9504),gap(127),
CO   AAHY01110990.1:1..1070,gap(20),complement(AAHY01110991.1:1..1378),gap(20),
CO   AAHY01110992.1:1..2179,gap(20),AAHY01110993.1:1..3309,gap(20),
CO   complement(AAHY01110994.1:1..4928),gap(20),AAHY01110995.1:1..23335,
CO   gap(206),complement(AAHY01110996.1:1..15845),gap(1193),
CO   complement(AAHY01110997.1:1..8100),gap(322),
CO   complement(AAHY01110998.1:1..10963),gap(20),
CO   complement(AAHY01110999.1:1..1742))
//


spacer
spacer