Dbfetch

ID   CH466567; SV 2; linear; genomic DNA; CON; MUS; 16330283 BP.
XX
AC   CH466567;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 181000113617003 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-16330283
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-16330283
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-16330283
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 27b3af2eab4f8a224551c19e6ef67ae3.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000221.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000007617; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000012422; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021614; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021619; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021620; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021635; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021638; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021639; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021643; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021645; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021646; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021660; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021662; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021670; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021679; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021680; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021687; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021702; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021707; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034488; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041417; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041431; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041773; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041995; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042043; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048924; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069089; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020798; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020800; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020802; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020806; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020808; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020814; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020820; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020824; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020831; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020834; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020838; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020840; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020841; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020853; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020860; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020861; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020865; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020878; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020880; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020885; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020886; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020888; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020891; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020892; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020897; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020752; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020754; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020756; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020760; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020762; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020768; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020774; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020778; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020785; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020788; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020792; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020794; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020795; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020807; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020814; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020815; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020819; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020832; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020834; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020835; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020837; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020838; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020840; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020842; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020843; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020846; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020848; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020725; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020727; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020729; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020733; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020735; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020741; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020747; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020751; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020759; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020762; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020766; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020768; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020769; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020781; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020788; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020789; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020793; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020806; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020808; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020809; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020812; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020813; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020815; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020817; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020818; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020823; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020748; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020750; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020752; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020756; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020758; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020764; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020770; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020774; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020782; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020785; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020789; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020791; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020792; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020804; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020811; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020813; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020817; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020830; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020832; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020833; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020836; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020837; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020839; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020842; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020843; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020846; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020848; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020542; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020544; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020546; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020550; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020552; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020558; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020564; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020568; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020575; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020578; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020582; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020584; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020585; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020597; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020603; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020604; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020608; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020621; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020623; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020624; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020626; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020627; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020629; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020631; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020632; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020637; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021185; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021187; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021189; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021193; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021195; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021201; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021207; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021211; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021218; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021221; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021225; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021227; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021228; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021239; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021246; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021247; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021251; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021264; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021266; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021267; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021270; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021271; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021273; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021276; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021277; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021282; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020060; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020062; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020064; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020068; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020071; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020077; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020083; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020087; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020094; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020097; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020101; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020103; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020104; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020115; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020122; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020123; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020127; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020139; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020141; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020142; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020145; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020146; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020148; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020150; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020151; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020154; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020156; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020501; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020503; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020505; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020509; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020511; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020517; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020523; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020527; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020534; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020537; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020541; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020543; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020544; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020556; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020563; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020564; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020568; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020581; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020583; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020584; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020587; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020588; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020590; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020593; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020594; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020599; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020626; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020628; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020630; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020634; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020636; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020642; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020648; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020652; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020659; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020662; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020666; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020668; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020669; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020681; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020688; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020689; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020693; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020706; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020708; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020709; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020712; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020713; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020715; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020717; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020718; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020721; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020723; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020606; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020608; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020610; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020614; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020616; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020622; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020628; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020632; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020640; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020643; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020647; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020649; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020650; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020662; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020669; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020670; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020674; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020687; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020689; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020690; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020693; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020694; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020696; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020699; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020700; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020703; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020705; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020699; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020701; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020703; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020707; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020709; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020715; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020721; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020725; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020734; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020737; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020741; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020743; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020744; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020756; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020763; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020764; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020768; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020781; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020783; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020784; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020786; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020787; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020789; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020791; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020792; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020795; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020797; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020635; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020637; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020639; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020643; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020645; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020651; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020657; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020661; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020668; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020671; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020675; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020677; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020678; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020690; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020697; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020698; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020702; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020715; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020717; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020718; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020722; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020723; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020725; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020727; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020728; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020731; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020733; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021225; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021227; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021229; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021233; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021235; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021241; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021247; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021251; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021258; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021261; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021265; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021267; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021268; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021280; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021287; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021288; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021292; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021305; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021307; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021308; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021310; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021311; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021313; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021315; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021316; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021319; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021321; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019813; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019815; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019817; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019821; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019823; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019829; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019835; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019839; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019846; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019849; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019853; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019855; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019856; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019867; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019874; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019876; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019880; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019892; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019894; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019895; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019898; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019899; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019901; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019903; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019904; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019909; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020118; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020120; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020122; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020126; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020128; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020134; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020140; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020144; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020151; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020154; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020158; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020160; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020161; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020172; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020179; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020180; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020184; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020197; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020199; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020200; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020202; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020203; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020205; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020208; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020209; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020212; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020214; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022120; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022136; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022140; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022147; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022176; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022186; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022197; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022213; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022218; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041623; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045909; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046644; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055518; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069756; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081769; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102752; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109426; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132053; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134842; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145266; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152704; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159910; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160859; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161457; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170347; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177848; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000221025; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037734; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037743; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037756; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037764; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037774; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037803; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037814; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037819; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037845; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037849; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037872; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037875; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037876; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037898; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037927; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037928; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037939; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037962; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037969; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037988; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037998; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0038003; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0038009; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0038011; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0038025; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0037676; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037685; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037698; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037708; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037717; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037746; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037757; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037762; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037788; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037792; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037815; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037818; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037819; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037842; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037871; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037872; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037883; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037907; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037915; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037920; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037932; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037942; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037947; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037952; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037954; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037963; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037971; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0037641; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037650; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037663; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037671; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037680; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037709; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037720; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037725; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037753; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037758; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037781; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037784; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037785; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037807; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037836; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037837; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037848; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037873; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037881; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037886; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037899; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037909; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037914; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037919; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037920; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037933; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037689; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037698; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037711; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037721; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037730; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037758; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037769; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037774; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037801; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037806; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037829; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037832; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037833; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037856; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037885; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037887; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037898; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037918; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037925; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037930; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037943; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037953; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037958; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037964; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037965; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037974; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037982; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037444; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037453; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037466; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037474; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037483; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037511; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037522; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037527; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037554; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037559; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037582; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037585; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037586; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037608; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037636; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037637; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037648; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037671; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037679; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037684; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037696; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037706; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037711; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037716; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037717; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037733; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038148; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038157; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038170; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038178; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038188; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038220; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038231; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038236; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038262; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038267; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038289; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038292; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038293; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038314; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038344; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038345; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038356; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038381; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038389; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038394; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038405; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038415; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038420; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038426; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038427; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038441; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037406; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037415; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037429; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037439; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037450; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037479; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037490; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037496; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037522; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037526; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037549; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037553; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037554; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037576; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037606; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037607; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037619; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037646; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037654; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037659; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037670; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037679; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037684; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037689; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037691; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037700; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037705; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0037351; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037360; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037373; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037382; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037391; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037419; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037430; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037435; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037461; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037466; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037490; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037493; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037494; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037517; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037546; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037547; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037558; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037581; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037589; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037594; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037605; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037615; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037620; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037626; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037627; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037643; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0037496; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037505; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037518; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037526; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037535; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037563; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037574; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037579; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037605; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037610; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037633; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037636; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037637; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037660; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037689; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037690; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037701; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037724; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037732; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037737; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037750; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037760; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037765; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037770; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037771; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037780; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037788; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0037462; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037471; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037484; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037492; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037501; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037529; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037540; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037545; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037572; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037576; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037599; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037602; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037603; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037626; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037655; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037656; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037667; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037690; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037698; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037703; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037716; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037726; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037731; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037738; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037739; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037744; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037752; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0037614; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037623; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037636; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037644; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037654; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037683; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037694; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037699; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037727; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037732; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037755; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037758; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037759; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037782; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037811; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037812; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037823; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037848; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037856; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037861; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037873; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037883; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037888; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037893; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037895; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037904; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037906; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037453; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037462; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037475; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037484; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037493; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037522; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037533; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037539; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037565; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037569; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037592; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037595; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037596; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037619; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037648; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037649; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037660; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037685; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037692; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037697; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037711; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037721; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037726; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037731; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037732; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037738; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037746; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038203; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038212; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038225; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038233; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038243; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038272; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038283; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038288; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038314; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038318; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038341; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038344; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038345; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038368; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038397; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038398; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038409; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038432; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038439; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038444; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038456; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038466; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038471; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038476; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038477; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038486; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038494; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037040; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037049; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037063; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037074; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037084; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037113; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037124; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037130; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037154; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037159; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037182; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037186; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037187; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037210; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037240; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037242; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037254; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037281; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037289; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037294; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037307; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037317; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037322; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037327; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037329; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037343; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036849; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036858; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036871; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036881; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036891; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036920; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036931; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036936; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036963; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036968; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036991; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036994; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036995; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037016; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037045; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037046; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037057; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037077; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037085; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037090; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037100; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037109; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037114; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037120; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037121; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037129; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037137; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70978914.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..16330283
FT                   /organism="Mus musculus"
FT                   /chromosome="13"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    4065..4570
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    9109..9128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12970..12989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17349..17368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23151..23170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25898..25917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27933..27952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29384..29411
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    41831..42082
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    48249..48268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    76752..76771
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    79212..79576
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    87812..87927
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    107479..107498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    110767..110786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    136697..136716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    158155..160864
FT                   /estimated_length=2710
FT                   /gap_type="unknown"
FT   assembly_gap    163334..164520
FT                   /estimated_length=1187
FT                   /gap_type="unknown"
FT   assembly_gap    197339..197358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    205773..206469
FT                   /estimated_length=697
FT                   /gap_type="unknown"
FT   assembly_gap    237154..237173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    238406..238425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    247396..247638
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    273132..273380
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    291523..291542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    300677..303391
FT                   /estimated_length=2715
FT                   /gap_type="unknown"
FT   assembly_gap    310208..311311
FT                   /estimated_length=1104
FT                   /gap_type="unknown"
FT   assembly_gap    322502..323661
FT                   /estimated_length=1160
FT                   /gap_type="unknown"
FT   assembly_gap    346098..346242
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    354244..354263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    364893..364912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    408115..408920
FT                   /estimated_length=806
FT                   /gap_type="unknown"
FT   assembly_gap    410893..410961
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    442168..442368
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    469484..469995
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   assembly_gap    471160..471179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    472230..472249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    477251..477418
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    529053..529072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    548911..549059
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    560101..561671
FT                   /estimated_length=1571
FT                   /gap_type="unknown"
FT   gene            568848..569850
FT                   /pseudo
FT                   /locus_tag="mCG_119898"
FT                   /note="gene_id=mCG119898.1"
FT   mRNA            568848..569850
FT                   /pseudo
FT                   /locus_tag="mCG_119898"
FT                   /note="gene_id=mCG119898.1 transcript_id=mCT121076.1
FT                   created on 20-FEB-2003"
FT   assembly_gap    613595..613614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    623522..623812
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    676755..676946
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    678495..680324
FT                   /estimated_length=1830
FT                   /gap_type="unknown"
FT   assembly_gap    681919..681938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    683080..689751
FT                   /estimated_length=6672
FT                   /gap_type="unknown"
FT   assembly_gap    727314..727569
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    731291..731310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    742204..742223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    827158..827177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    831776..831795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    908173..908192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    935545..935564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    950390..950438
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    961478..961518
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    968247..968480
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    985796..985815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1006740..1006759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1020951..1021038
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    1037006..1037025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1074236..1074255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1169970..1169992
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    1246387..1246626
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    1251685..1251704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1265921..1265940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1281527..1282510
FT                   /estimated_length=984
FT                   /gap_type="unknown"
FT   assembly_gap    1283312..1284204
FT                   /estimated_length=893
FT                   /gap_type="unknown"
FT   assembly_gap    1317769..1317788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1333564..1334619
FT                   /pseudo
FT                   /locus_tag="mCG_119899"
FT                   /note="gene_id=mCG119899.1"
FT   mRNA            1333564..1334619
FT                   /pseudo
FT                   /locus_tag="mCG_119899"
FT                   /note="gene_id=mCG119899.1 transcript_id=mCT121077.1
FT                   created on 01-APR-2003"
FT   assembly_gap    1334798..1335271
FT                   /estimated_length=474
FT                   /gap_type="unknown"
FT   assembly_gap    1370422..1370441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1393641..1393838
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    1395713..1395747
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    1397544..1397563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1427741..1427760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1453681..1453832
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    1459179..1459198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1518857..1518876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1521519..1521538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1538367..1538386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1575402..1575421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1580435..1580454
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1610544..2102894
FT                   /gene="Edil3"
FT                   /locus_tag="mCG_142525"
FT                   /note="gene_id=mCG142525.0"
FT   mRNA            join(1610544..1611080,1734419..1734547,1763713..1763742,
FT                   1830794..1830922,1882859..1882972,1919973..1920154,
FT                   1959753..1959908,1962937..1963081,1967367..1967551,
FT                   2069514..2069669,2099704..2102894)
FT                   /gene="Edil3"
FT                   /locus_tag="mCG_142525"
FT                   /product="EGF-like repeats and discoidin I-like domains 3,
FT                   transcript variant mCT180639"
FT                   /note="gene_id=mCG142525.0 transcript_id=mCT180639.0
FT                   created on 20-FEB-2003"
FT   mRNA            join(1610672..1611080,1734419..1734547,1830794..1830922,
FT                   1882859..1882972,1919973..1920154,1959753..1959908,
FT                   1962937..1963081,1967367..1967551,2069514..2069669,
FT                   2099704..2102894)
FT                   /gene="Edil3"
FT                   /locus_tag="mCG_142525"
FT                   /product="EGF-like repeats and discoidin I-like domains 3,
FT                   transcript variant mCT180638"
FT                   /note="gene_id=mCG142525.0 transcript_id=mCT180638.0
FT                   created on 20-FEB-2003"
FT   CDS             join(1611014..1611080,1734419..1734547,1763713..1763742,
FT                   1830794..1830922,1882859..1882972,1919973..1920154,
FT                   1959753..1959908,1962937..1963081,1967367..1967551,
FT                   2069514..2069669,2099704..2099853)
FT                   /codon_start=1
FT                   /gene="Edil3"
FT                   /locus_tag="mCG_142525"
FT                   /product="EGF-like repeats and discoidin I-like domains 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG142525.0 transcript_id=mCT180639.0
FT                   protein_id=mCP103560.0 isoform=CRA_b"
FT                   /db_xref="GOA:O35474"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR029828"
FT                   /db_xref="MGI:MGI:1329025"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35474"
FT                   /protein_id="EDL00986.1"
FT                   /translation="MKHLVAAWLLVGLSLGVPQFGKGDICNPNPCENGGICLSGLADDS
FT                   FSCECPEGFAGPNCSSVVEVASDEEKPTSAGPCIPNPCHNGGTCEISEAYRGDTFIGYV
FT                   CKCPRGFNGIHCQHNINECEAEPCRNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLG
FT                   IEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQR
FT                   KMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEEMVFRGNVDNNTPY
FT                   ANSFTPPIKAQYVRLYPQICRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSV
FT                   FRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDF
FT                   GHVQFVGSYKLAYSNDGEHWMVHQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARFIRI
FT                   LPWSWYGRITLRSELLGCAEEE"
FT   CDS             join(1611014..1611080,1734419..1734547,1830794..1830922,
FT                   1882859..1882972,1919973..1920154,1959753..1959908,
FT                   1962937..1963081,1967367..1967551,2069514..2069669,
FT                   2099704..2099853)
FT                   /codon_start=1
FT                   /gene="Edil3"
FT                   /locus_tag="mCG_142525"
FT                   /product="EGF-like repeats and discoidin I-like domains 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG142525.0 transcript_id=mCT180638.0
FT                   protein_id=mCP103561.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8C4U8"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR029828"
FT                   /db_xref="MGI:MGI:1329025"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C4U8"
FT                   /protein_id="EDL00985.1"
FT                   /translation="MKHLVAAWLLVGLSLGVPQFGKGDICNPNPCENGGICLSGLADDS
FT                   FSCECPEGFAGPNCSSVVEVGPCIPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGI
FT                   HCQHNINECEAEPCRNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQ
FT                   ITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQ
FT                   GAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEEMVFRGNVDNNTPYANSFTPPIKA
FT                   QYVRLYPQICRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSVFRTLNMDMFT
FT                   WEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYK
FT                   LAYSNDGEHWMVHQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARFIRILPWSWYGRIT
FT                   LRSELLGCAEEE"
FT   assembly_gap    1627105..1627124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1632730..1633605
FT                   /pseudo
FT                   /locus_tag="mCG_1047136"
FT                   /note="gene_id=mCG1047136.1"
FT   mRNA            1632730..1633605
FT                   /pseudo
FT                   /locus_tag="mCG_1047136"
FT                   /note="gene_id=mCG1047136.1 transcript_id=mCT164840.1
FT                   created on 20-FEB-2003"
FT   assembly_gap    1639266..1639285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1640432..1640451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1642841..1642860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1644063..1644082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1645138..1645157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1646922..1646941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1648066..1648518
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   assembly_gap    1660540..1660782
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    1685864..1685935
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    1691663..1691693
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    1706969..1706988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1757690..1757709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1767049..1767578
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    1775736..1777306
FT                   /estimated_length=1571
FT                   /gap_type="unknown"
FT   assembly_gap    1779041..1779698
FT                   /estimated_length=658
FT                   /gap_type="unknown"
FT   assembly_gap    1780878..1781123
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    1783400..1783419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1788039..1788058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1789317..1789336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1798968..1798987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1946473..1946492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1962291..1962575
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    1974647..1974719
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    1999614..1999633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2020630..2020649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2082771..2082790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2108627..2108646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2110935..2110954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2115815..2115843
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    2128216..2128801
FT                   /estimated_length=586
FT                   /gap_type="unknown"
FT   assembly_gap    2149417..2149635
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    2166525..2166544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2221562..2221581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2227073..2228369
FT                   /estimated_length=1297
FT                   /gap_type="unknown"
FT   assembly_gap    2233461..2236073
FT                   /estimated_length=2613
FT                   /gap_type="unknown"
FT   assembly_gap    2264774..2265320
FT                   /estimated_length=547
FT                   /gap_type="unknown"
FT   assembly_gap    2310483..2310502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2319771..2320004
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   gene            2326088..2396222
FT                   /gene="Hapln1"
FT                   /locus_tag="mCG_141881"
FT                   /note="gene_id=mCG141881.0"
FT   mRNA            join(2326088..2326270,2326288..2327191,2370314..2370443,
FT                   2387231..2387602,2390984..2391286,2393647..2396222)
FT                   /gene="Hapln1"
FT                   /locus_tag="mCG_141881"
FT                   /product="hyaluronan and proteoglycan link protein 1"
FT                   /note="gene_id=mCG141881.0 transcript_id=mCT177265.0
FT                   created on 11-DEC-2002"
FT   assembly_gap    2330284..2330322
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    2336169..2336188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2337306..2337930
FT                   /estimated_length=625
FT                   /gap_type="unknown"
FT   assembly_gap    2356418..2356444
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   gene            complement(2363347..2365548)
FT                   /pseudo
FT                   /locus_tag="mCG_113535"
FT                   /note="gene_id=mCG113535.1"
FT   mRNA            complement(2363347..2365548)
FT                   /pseudo
FT                   /locus_tag="mCG_113535"
FT                   /note="gene_id=mCG113535.1 transcript_id=mCT114619.1
FT                   created on 20-FEB-2003"
FT   assembly_gap    2366335..2366354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(2370338..2370443,2387231..2387602,2390984..2391286,
FT                   2393647..2393936)
FT                   /codon_start=1
FT                   /gene="Hapln1"
FT                   /locus_tag="mCG_141881"
FT                   /product="hyaluronan and proteoglycan link protein 1"
FT                   /note="gene_id=mCG141881.0 transcript_id=mCT177265.0
FT                   protein_id=mCP100187.0"
FT                   /protein_id="EDL00984.1"
FT                   /translation="MRSLLLLVLISVCWADHHLSDSYTPPDQDRVIHIQAENGPRLLVE
FT                   AEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLREVDVFVSMGYHK
FT                   KTYGGYQGRVFLKGGSDNDASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALELQGVVF
FT                   PYFPRLGRYNLNFHEARQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPIT
FT                   KPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQAC
FT                   LNDGAQIAKVGQIFAAWKLLGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFP
FT                   DKKHKLYGVYCFRAYN"
FT   assembly_gap    2380777..2380983
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    2404426..2404820
FT                   /estimated_length=395
FT                   /gap_type="unknown"
FT   assembly_gap    2410270..2410295
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    2414080..2414276
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   gene            complement(2441297..2528289)
FT                   /locus_tag="mCG_116562"
FT                   /note="gene_id=mCG116562.1"
FT   mRNA            complement(join(2441297..2443338,2443483..2443665,
FT                   2447897..2448041,2464038..2464120,2465765..2465923,
FT                   2470365..2470478,2471044..2471157,2474250..2479466,
FT                   2498175..2498468,2507534..2507661,2507739..2507913,
FT                   2511255..2511629,2517425..2517500,2528038..2528289))
FT                   /locus_tag="mCG_116562"
FT                   /product="mCG116562, transcript variant mCT117685"
FT                   /note="gene_id=mCG116562.1 transcript_id=mCT117685.1
FT                   created on 11-DEC-2002"
FT   mRNA            complement(join(2443036..2443338,2443483..2443665,
FT                   2447897..2448041,2464038..2464120,2465765..2465923,
FT                   2470365..2470478,2471044..2471157,2498175..2498468,
FT                   2507534..2507661,2507739..2507913,2511255..2511629,
FT                   2517425..2517500,2528038..>2528209))
FT                   /locus_tag="mCG_116562"
FT                   /product="mCG116562, transcript variant mCT189364"
FT                   /note="gene_id=mCG116562.1 transcript_id=mCT189364.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(2443036..2443338,2443483..2443665,
FT                   2447897..2448041,2464038..2464120,2465765..2465923,
FT                   2470365..2470478,2471044..2471157,2474250..2479466,
FT                   2488883..2491762,2498175..2498468,2507534..2507661,
FT                   2507739..2507913,2511255..2511629,2517425..2517500,
FT                   2528038..>2528209))
FT                   /locus_tag="mCG_116562"
FT                   /product="mCG116562, transcript variant mCT189363"
FT                   /note="gene_id=mCG116562.1 transcript_id=mCT189363.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(2443211..2443338,2443483..2443665,
FT                   2447897..2448041,2464038..2464120,2465765..2465923,
FT                   2470365..2470478,2471044..2471157,2498175..2498468,
FT                   2507534..2507661,2507739..2507913,2511255..2511629,
FT                   2517425..2517500,2528038..>2528208))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116562"
FT                   /product="mCG116562, isoform CRA_c"
FT                   /note="gene_id=mCG116562.1 transcript_id=mCT189364.0
FT                   protein_id=mCP110351.0 isoform=CRA_c"
FT                   /protein_id="EDL00983.1"
FT                   /translation="ICRYQRILSPLQLCPALAAPFPRPPRFLCDLPGQRGALSHSSAVN
FT                   FHPENCSKPPFKDKMLINMKGILWMCSTLLLTHALHQAKMETSPPVKGSLSGKVVLPCH
FT                   FSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVP
FT                   THPDDVGDASLTMVKLRASDAGVYRCDVMYGIEDTQDTMSLAVDGVVFHYRAATSRYTL
FT                   NFAAAQQACLDIGAVIASPEQLFAAYEDGFEQCDAGWLSDQTVRYPIRAPREGCYGDMM
FT                   GKEGVRTYGFRSPQETYDVYCYVDHLDGDVFHITAPSKFTFEEAEAECTSRDARLATVG
FT                   ELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTCFPLPDSR
FT                   FDAYCFKRPDLCKTNPCLNGGTCYPTETSYVCTCAPGYSGDQCELDFDECHSNPCRNGA
FT                   TCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRL
FT                   QGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSALQYENWRPNQPDSF
FT                   FSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEI
FT                   NSLIRYHCKDGFIQRHLPTIRCLGNGRWAMPKITCMNPSAYQRTYSKKYLKNSSSAKDN
FT                   SINTSKHEHRWSRRRQETRR"
FT   CDS             complement(join(2443211..2443338,2443483..2443665,
FT                   2447897..2448041,2464038..2464120,2465765..2465923,
FT                   2470365..2470478,2471044..2471157,2474250..2479466,
FT                   2488883..2491762,2498175..2498468,2507534..2507661,
FT                   2507739..2507913,2511255..2511629,2517425..2517500,
FT                   2528038..>2528208))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116562"
FT                   /product="mCG116562, isoform CRA_b"
FT                   /note="gene_id=mCG116562.1 transcript_id=mCT189363.0
FT                   protein_id=mCP110350.0 isoform=CRA_b"
FT                   /protein_id="EDL00982.1"
FT                   /translation="ICRYQRILSPLQLCPALAAPFPRPPRFLCDLPGQRGALSHSSAVN
FT                   FHPENCSKPPFKDKMLINMKGILWMCSTLLLTHALHQAKMETSPPVKGSLSGKVVLPCH
FT                   FSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVP
FT                   THPDDVGDASLTMVKLRASDAGVYRCDVMYGIEDTQDTMSLAVDGVVFHYRAATSRYTL
FT                   NFAAAQQACLDIGAVIASPEQLFAAYEDGFEQCDAGWLSDQTVRYPIRAPREGCYGDMM
FT                   GKEGVRTYGFRSPQETYDVYCYVDHLDGDVFHITAPSKFTFEEAEAECTSRDARLATVG
FT                   ELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTCFPLPDSR
FT                   FDAYCFKPKQNISEATTIEMNILAETSSPSLSKEPHMVPDRATPVIPLATELPIFTTHF
FT                   PPAGNIVNSEQKSVVYSQAITGRLAMESPTTTRNTINSWDLNDSLASGSGPLGMPDISE
FT                   IKEEELRSTTVISQHATGSQAVITEDTQTHESVSQIEQIEVGPLVTSMEITNHISLKEL
FT                   PEKNKTPYESTEVTLEHTTEMPTVSASPELATTSHYGFTLREDDREDRTLTVRSDQSTR
FT                   VFSQIPEVITVSKTSEDTTYSQLGDLESISTSTITMLGTDRSLIDKEKEPKTNGKVTED
FT                   EFGQSQPTTTFPSQHLTEVELLPYSGDTTSVEGISTVIYPSLQTDVTQGRERTETPRPE
FT                   LKKDPYTVDEIPEKVTKDPFIGKTEEVFSGMPLSTSSSESSVERTESVSPALTIEKLTV
FT                   KPTEARDVEEMTTLTRLETDVTKSDKDVTRVHLTHSTLNVEVVTVSKWPGDEDNSTSKP
FT                   LPSTEHAGFTKLPPVPLSTIGINGKDKEIPSFTDGGGEYTLFPDGTPKPLEKVSEEDLA
FT                   SGELTVTFHTSTSIGSAEKSASGEPTTGDRFLPTTSTEDQVINATAEGSALGEDIEASK
FT                   PLFTGPPFVHTSDVEELAFVNYSSTQEPTTYVDISHTSPLSIIPKTEWSVLETSVSLED
FT                   EILGKSDQDILEQTHLEATMSPGALRTTGVSQGETQEEPQTPGSPFPTFSSTAVMAKET
FT                   TAFEEGEGSTYTPSEGRLMTGSERVPGLETTPVGTSYPPGAITDQEVEMDTMVTLMSTI
FT                   RPTVVSSTEPEVIYEAEGSSPTEFASTLRPFQTHVTQLMEETTEEGKKASLDYTDLGSG
FT                   LFEPRATELPKFPTTPSDISVFTAIDSLHRTPPLSPSSSFTEEQRVFEEESSEKTTGDI
FT                   LPGESVTQHPVTTLIDIVAMKTESDIDHMTSKPPVTQPTRPSVVERKTTSKTQELSTST
FT                   PAAGTKFHPDINVYIIEVRENKTGRLSDMIVSGHPIDSESKEEEPCSEETDPLHDLFAE
FT                   ILPELPDSFEIDIYHSEEDEDGEEDCVNATDVTTTPSVQYINGKQLVTTVPKDPEAAEA
FT                   RRGQYESVAPSQNFPDSSATDTHQFILAETESSTTMQFKKSKEGTELLEITWKPETYPE
FT                   TPDHVSSGEPDVFPTLSSHDGKTTRWSESITESSPNLENPVHKQPKPVPLFPEESSGEG
FT                   AIEQASQETILSRATEVALGKETDQSPTLSTSSILSSSVSVNVLEEEPLTLTGISQTDE
FT                   SMSTIESWVEITPSQTVKFSESSSAPIIEGSGEVEENKNKIFNMVTDLPQRDPTDTLSP
FT                   LDMSKIMITNHHIYIPATTAPLDSKLPSPDARPTQFGIQTATSEWVSDKSFEGRKREED
FT                   EEGAVNAAHQGEVRAATERSDHLLLTPELESSNVDASSDLATWEGFILETTPTESEKEM
FT                   ANSTPVFRETIGVANVEAQPFEHSSSSHPRVQEELTTLSGNPPSLFTDLGSGDASTGME
FT                   LITASLFTLDLESETKVKKELPSTPSPSVEISSSFEPTGLTPSTVLDIEIAGVMSQTSQ
FT                   KTLISEISGKPTSQSGVRDLYTGFPMGEDFSGDFSEYPTVSYPTMKEETVGMGGSDDER
FT                   VRDTQTSSSIPTTSDNIYPVPDSKGPDSTVASTTAFPWEEVMSSAEGSGEQLASVRSSV
FT                   GPVLPLAVDIFSGTESPYFDEEFEEVAAVTEANERPTVLPTAASGNTVDLTENGYIEVN
FT                   STMSLDFPQTMEPSKLWSKPEVNLDKQEIGRETVTKEKAQGQKTFESLHSSFAPEQTIL
FT                   ETQSLIETEFQTSDYSMLTTLKTYITNKEVEEEGMSIAHMSTPGPGIKDLESYTTHPEA
FT                   PGKSHSFSATALVTESGAARSVLMDSSTQEEESIKLFQKGVKLTNKESNADLSFSGLGS
FT                   GEALPPLPTTSVNLTDMKQIISTLYAETSHMESLGTSILGDKMEDHERMEDVSNEVRML
FT                   ISKTGSISQDSTEALDTTLSHTGTEEPTTSTLPFVKLMDLERSPKQTLRWEEETQTHRP
FT                   QTMSGLISNENSSASEAEEAATSPTAFLPQTYSVEMTKHFAPSESQPSDLFNVNSGEGS
FT                   GEVDTLDLVYTSGTTQASSQGDSMLASHGFLEKHPEVSKTEAGATDVSPTASAMFLHHS
FT                   EYKSSLYPTSTLPSTEPYKSPSEGIEDGLQDNIQFEGSTLKPSRRKTTESIIIDLDKED
FT                   SKDLGLTITESAIVEILPELTSDKNIIIDIDHTKPVYEYIPGIQTDLDPEIKLESHGSS
FT                   EESLQVQEKYEGAVTLSPTEESFEGSGDALLAGYTQAIYNESVTPNDGKQAEDISFSFA
FT                   TGIPVSSTETELHTFFPTASTLHIPSKLTTASPEIDKPNIEAISLDDIFESSTLSDGQA
FT                   IADQSEVISTLGHLEKTQEEYEEKKYGGPSFQPEFFSGVGEVLTDPPAYVSIGSTYLIA
FT                   QTLTELPNVVRPSDSTHYTEATPEVSSLAELSPQIPSSPFPVYVDNGVSKFPEVPHTSA
FT                   QPVSTVTSSQKSIESPFKEVHANIEETIKPLGGNVHRTEPPSMSRDPALDVSEDESKHK
FT                   LLEELETSPTKPETSQDFPNKAKDHIPGETVGMLAGIRTTESEPVITADDMELGGATQQ
FT                   PHSASAAFRVETGMVPQPIQQEPERPTFPSLEINHETHTSLFGESILATSEKQVSQKIL
FT                   DNSNQATVSSTLDLHTAHALSPFSILDNSNETAFLIGISEESVEGTAVYLPGPDLCKTN
FT                   PCLNGGTCYPTETSYVCTCAPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLP
FT                   SYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQM
FT                   FVNRVGHDYQWIGLNDKMFEHDFRWTDGSALQYENWRPNQPDSFFSAGEDCVVIIWHEN
FT                   GQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQR
FT                   HLPTIRCLGNGRWAMPKITCMNPSAYQRTYSKKYLKNSSSAKDNSINTSKHEHRWSRRR
FT                   QETRR"
FT   CDS             complement(join(2443211..2443338,2443483..2443665,
FT                   2447897..2448041,2464038..2464120,2465765..2465923,
FT                   2470365..2470478,2471044..2471157,2474250..2479466,
FT                   2498175..2498468,2507534..2507661,2507739..2507913,
FT                   2511255..2511629,2517425..2517494))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116562"
FT                   /product="mCG116562, isoform CRA_a"
FT                   /note="gene_id=mCG116562.1 transcript_id=mCT117685.1
FT                   protein_id=mCP51858.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3XA35"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR000538"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001304"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR018378"
FT                   /db_xref="InterPro:IPR033987"
FT                   /db_xref="InterPro:IPR035976"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="MGI:MGI:102889"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA35"
FT                   /protein_id="EDL00981.1"
FT                   /translation="MLINMKGILWMCSTLLLTHALHQAKMETSPPVKGSLSGKVVLPCH
FT                   FSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVP
FT                   THPDDVGDASLTMVKLRASDAGVYRCDVMYGIEDTQDTMSLAVDGVVFHYRAATSRYTL
FT                   NFAAAQQACLDIGAVIASPEQLFAAYEDGFEQCDAGWLSDQTVRYPIRAPREGCYGDMM
FT                   GKEGVRTYGFRSPQETYDVYCYVDHLDGDVFHITAPSKFTFEEAEAECTSRDARLATVG
FT                   ELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTCFPLPDSR
FT                   FDAYCFKRRLSDMIVSGHPIDSESKEEEPCSEETDPLHDLFAEILPELPDSFEIDIYHS
FT                   EEDEDGEEDCVNATDVTTTPSVQYINGKQLVTTVPKDPEAAEARRGQYESVAPSQNFPD
FT                   SSATDTHQFILAETESSTTMQFKKSKEGTELLEITWKPETYPETPDHVSSGEPDVFPTL
FT                   SSHDGKTTRWSESITESSPNLENPVHKQPKPVPLFPEESSGEGAIEQASQETILSRATE
FT                   VALGKETDQSPTLSTSSILSSSVSVNVLEEEPLTLTGISQTDESMSTIESWVEITPSQT
FT                   VKFSESSSAPIIEGSGEVEENKNKIFNMVTDLPQRDPTDTLSPLDMSKIMITNHHIYIP
FT                   ATTAPLDSKLPSPDARPTQFGIQTATSEWVSDKSFEGRKREEDEEGAVNAAHQGEVRAA
FT                   TERSDHLLLTPELESSNVDASSDLATWEGFILETTPTESEKEMANSTPVFRETIGVANV
FT                   EAQPFEHSSSSHPRVQEELTTLSGNPPSLFTDLGSGDASTGMELITASLFTLDLESETK
FT                   VKKELPSTPSPSVEISSSFEPTGLTPSTVLDIEIAGVMSQTSQKTLISEISGKPTSQSG
FT                   VRDLYTGFPMGEDFSGDFSEYPTVSYPTMKEETVGMGGSDDERVRDTQTSSSIPTTSDN
FT                   IYPVPDSKGPDSTVASTTAFPWEEVMSSAEGSGEQLASVRSSVGPVLPLAVDIFSGTES
FT                   PYFDEEFEEVAAVTEANERPTVLPTAASGNTVDLTENGYIEVNSTMSLDFPQTMEPSKL
FT                   WSKPEVNLDKQEIGRETVTKEKAQGQKTFESLHSSFAPEQTILETQSLIETEFQTSDYS
FT                   MLTTLKTYITNKEVEEEGMSIAHMSTPGPGIKDLESYTTHPEAPGKSHSFSATALVTES
FT                   GAARSVLMDSSTQEEESIKLFQKGVKLTNKESNADLSFSGLGSGEALPPLPTTSVNLTD
FT                   MKQIISTLYAETSHMESLGTSILGDKMEDHERMEDVSNEVRMLISKTGSISQDSTEALD
FT                   TTLSHTGTEEPTTSTLPFVKLMDLERSPKQTLRWEEETQTHRPQTMSGLISNENSSASE
FT                   AEEAATSPTAFLPQTYSVEMTKHFAPSESQPSDLFNVNSGEGSGEVDTLDLVYTSGTTQ
FT                   ASSQGDSMLASHGFLEKHPEVSKTEAGATDVSPTASAMFLHHSEYKSSLYPTSTLPSTE
FT                   PYKSPSEGIEDGLQDNIQFEGSTLKPSRRKTTESIIIDLDKEDSKDLGLTITESAIVEI
FT                   LPELTSDKNIIIDIDHTKPVYEYIPGIQTDLDPEIKLESHGSSEESLQVQEKYEGAVTL
FT                   SPTEESFEGSGDALLAGYTQAIYNESVTPNDGKQAEDISFSFATGIPVSSTETELHTFF
FT                   PTASTLHIPSKLTTASPEIDKPNIEAISLDDIFESSTLSDGQAIADQSEVISTLGHLEK
FT                   TQEEYEEKKYGGPSFQPEFFSGVGEVLTDPPAYVSIGSTYLIAQTLTELPNVVRPSDST
FT                   HYTEATPEVSSLAELSPQIPSSPFPVYVDNGVSKFPEVPHTSAQPVSTVTSSQKSIESP
FT                   FKEVHANIEETIKPLGGNVHRTEPPSMSRDPALDVSEDESKHKLLEELETSPTKPETSQ
FT                   DFPNKAKDHIPGETVGMLAGIRTTESEPVITADDMELGGATQQPHSASAAFRVETGMVP
FT                   QPIQQEPERPTFPSLEINHETHTSLFGESILATSEKQVSQKILDNSNQATVSSTLDLHT
FT                   AHALSPFSILDNSNETAFLIGISEESVEGTAVYLPGPDLCKTNPCLNGGTCYPTETSYV
FT                   CTCAPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDY
FT                   GWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLND
FT                   KMFEHDFRWTDGSALQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTC
FT                   KKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAMP
FT                   KITCMNPSAYQRTYSKKYLKNSSSAKDNSINTSKHEHRWSRRRQETRR"
FT   gene            2525424..2579040
FT                   /locus_tag="mCG_146978"
FT                   /note="gene_id=mCG146978.0"
FT   mRNA            join(2525424..2525555,2576483..2579040)
FT                   /locus_tag="mCG_146978"
FT                   /product="mCG146978"
FT                   /note="gene_id=mCG146978.0 transcript_id=mCT187241.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    2548531..2549279
FT                   /estimated_length=749
FT                   /gap_type="unknown"
FT   assembly_gap    2567552..2567624
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   CDS             2576882..2577052
FT                   /codon_start=1
FT                   /locus_tag="mCG_146978"
FT                   /product="mCG146978"
FT                   /note="gene_id=mCG146978.0 transcript_id=mCT187241.0
FT                   protein_id=mCP108193.0"
FT                   /protein_id="EDL00980.1"
FT                   /translation="MNLKNFYFLKWKSSHCRDNDFEVDFLHHPPRPLLISMYLLVFPPI
FT                   RSTYPWDANTF"
FT   assembly_gap    2631672..2631691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2637547..2639716
FT                   /estimated_length=2170
FT                   /gap_type="unknown"
FT   gene            complement(2642146..2879742)
FT                   /gene="Xrcc4"
FT                   /locus_tag="mCG_116563"
FT                   /note="gene_id=mCG116563.1"
FT   mRNA            complement(join(2642146..2642819,2729581..2729728,
FT                   2780407..2780498,2781789..2781941,2790249..2790415,
FT                   2852241..2852416,2861784..2861932,2879709..2879742))
FT                   /gene="Xrcc4"
FT                   /locus_tag="mCG_116563"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 4, transcript variant mCT117686"
FT                   /note="gene_id=mCG116563.1 transcript_id=mCT117686.1
FT                   created on 10-DEC-2002"
FT   CDS             complement(join(2642714..2642819,2729581..2729728,
FT                   2780407..2780498,2781789..2781941,2790249..2790415,
FT                   2852241..2852416,2861784..2861922))
FT                   /codon_start=1
FT                   /gene="Xrcc4"
FT                   /locus_tag="mCG_116563"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 4, isoform CRA_a"
FT                   /note="gene_id=mCG116563.1 transcript_id=mCT117686.1
FT                   protein_id=mCP51908.1 isoform=CRA_a"
FT                   /protein_id="EDL00978.1"
FT                   /translation="MERKVSRIYLASEPNVPYFLQVSWERTIGSGFVITLTDGHSAWTA
FT                   TVSELEISQEADDMAMEKGKYIDELRKALVPGSGAAGTYKFLFSKESRHFSLEKELKDV
FT                   SFRLGSFNLDKVSNSAEVIRELICYCLDTITEKQAKNEHLQKENERLLRDWNDVQGRFE
FT                   KCVSAKEALEADLYQRFILVLNEKKTKIRSLHKLLNEVQQLEESTKPERENPCSDKTPE
FT                   EHGLYDGSTDEESGAPVQAAETLHKDDSIFSSPDVTDIAPSRKRRHRMQKNLGTEPKMA
FT                   PQELPLQEKERLASSLPQTLKEESTSAENMSLETLRNSSPEDLFD"
FT   mRNA            complement(join(2642777..2642819,2687659..2687730,
FT                   2729577..2729728,2780407..2780498,2781789..2781941,
FT                   2790249..2790415,2852241..2852416,2861784..2861932,
FT                   2867213..2867302,2879709..2879731))
FT                   /gene="Xrcc4"
FT                   /locus_tag="mCG_116563"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 4, transcript variant mCT177123"
FT                   /note="gene_id=mCG116563.1 transcript_id=mCT177123.0
FT                   created on 10-DEC-2002"
FT   assembly_gap    2655845..2655864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2676745..2676764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2722284..2722303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(2729577..2729728,2780407..2780498,
FT                   2781789..2781941,2790249..2790415,2852241..2852416,
FT                   2861784..2861922))
FT                   /codon_start=1
FT                   /gene="Xrcc4"
FT                   /locus_tag="mCG_116563"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 4, isoform CRA_b"
FT                   /note="gene_id=mCG116563.1 transcript_id=mCT177123.0
FT                   protein_id=mCP100045.0 isoform=CRA_b"
FT                   /protein_id="EDL00979.1"
FT                   /translation="MERKVSRIYLASEPNVPYFLQVSWERTIGSGFVITLTDGHSAWTA
FT                   TVSELEISQEADDMAMEKGKYIDELRKALVPGSGAAGTYKFLFSKESRHFSLEKELKDV
FT                   SFRLGSFNLDKVSNSAEVIRELICYCLDTITEKQAKNEHLQKENERLLRDWNDVQGRFE
FT                   KCVSAKEALEADLYQRFILVLNEKKTKIRSLHKLLNEVQQLEESTKPERENPCSDKTPE
FT                   EHGLYDGSTDEESGAPVQAAETLHKDDSIFSSPDVTDIAPSRKRRHRMQKNLGTEPKMA
FT                   PQELPLQEKER"
FT   assembly_gap    2731136..2731273
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    2749960..2750168
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    2766564..2766933
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    2795859..2795878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2834500..2838735
FT                   /estimated_length=4236
FT                   /gap_type="unknown"
FT   assembly_gap    2843953..2843972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2867097..2867200
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   gene            2879945..2934157
FT                   /locus_tag="mCG_116561"
FT                   /note="gene_id=mCG116561.1"
FT   mRNA            join(2879945..2879995,2888575..2888684,2891121..2891155,
FT                   2909525..2909591,2918920..2919032,2933307..2934157)
FT                   /locus_tag="mCG_116561"
FT                   /product="mCG116561, transcript variant mCT177122"
FT                   /note="gene_id=mCG116561.1 transcript_id=mCT177122.0
FT                   created on 10-DEC-2002"
FT   mRNA            join(2879945..2879995,2888575..2888684,2891121..2891155,
FT                   2894590..2897537)
FT                   /locus_tag="mCG_116561"
FT                   /product="mCG116561, transcript variant mCT117684"
FT                   /note="gene_id=mCG116561.1 transcript_id=mCT117684.0
FT                   created on 10-DEC-2002"
FT   CDS             join(2879993..2879995,2888575..2888684,2891121..2891155,
FT                   2909525..2909547)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116561"
FT                   /product="mCG116561, isoform CRA_b"
FT                   /note="gene_id=mCG116561.1 transcript_id=mCT177122.0
FT                   protein_id=mCP100044.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR009653"
FT                   /db_xref="MGI:MGI:1913324"
FT                   /db_xref="UniProtKB/TrEMBL:E0CY07"
FT                   /protein_id="EDL00977.1"
FT                   /translation="MSAIFNFQSLLTVILLLICTCAYIRSLAPSILDRNKTGLLGIFWK
FT                   CARIESRLELQ"
FT   CDS             join(2879993..2879995,2888575..2888684,2891121..2891155,
FT                   2894590..2894660)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116561"
FT                   /product="mCG116561, isoform CRA_a"
FT                   /note="gene_id=mCG116561.1 transcript_id=mCT117684.0
FT                   protein_id=mCP51857.1 isoform=CRA_a"
FT                   /protein_id="EDL00976.1"
FT                   /translation="MSAIFNFQSLLTVILLLICTCAYIRSLAPSILDRNKTGLLGIFWK
FT                   CARIGERKSPYVAICCIVMAFSILFIQ"
FT   assembly_gap    2920295..2921124
FT                   /estimated_length=830
FT                   /gap_type="unknown"
FT   assembly_gap    2953377..2953400
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    2972493..2972512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2983126..2985406
FT                   /estimated_length=2281
FT                   /gap_type="unknown"
FT   assembly_gap    2986382..2986422
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    3007815..3008138
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    3080332..3082953
FT                   /estimated_length=2622
FT                   /gap_type="unknown"
FT   assembly_gap    3084152..3084171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3085660..3085679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3087482..3087501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3092082..3092123
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    3094478..3094497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3095524..3095543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3098974..3099284
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    3100347..3100366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3125881..3126416
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    3160079..3160098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3208031..3208050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3209164..3209183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3210521..3210540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3211681..3212139
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   assembly_gap    3213154..3215184
FT                   /estimated_length=2031
FT                   /gap_type="unknown"
FT   assembly_gap    3217503..3217522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3223723..3224039
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    3235831..3235850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3244757..3245024
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    3253578..3253730
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    3259130..3259589
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    3261306..3261325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3262570..3262589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3279999..3280146
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    3284069..3284088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3313466..3314187
FT                   /estimated_length=722
FT                   /gap_type="unknown"
FT   assembly_gap    3331434..3331520
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    3354747..3354766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3369411..3369430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3403684..3403703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3407321..3407340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3408518..3408537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3409741..3409760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3412411..3412430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3414556..3414970
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    3416509..3416528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3419736..3419755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3421214..3421403
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    3422877..3423405
FT                   /estimated_length=529
FT                   /gap_type="unknown"
FT   assembly_gap    3425078..3425097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3427713..3427732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3433522..3433541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3447416..3447639
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    3450369..3450388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3478312..3478331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3499817..3501152
FT                   /estimated_length=1336
FT                   /gap_type="unknown"
FT   assembly_gap    3513323..3513538
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    3527850..3528664
FT                   /estimated_length=815
FT                   /gap_type="unknown"
FT   assembly_gap    3568071..3568416
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    3573414..3573433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3581198..3581217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3582274..3582293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3583987..3584006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3589279..3589298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3591523..3591542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3593216..3593843
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    3595640..3596498
FT                   /estimated_length=859
FT                   /gap_type="unknown"
FT   assembly_gap    3603197..3603442
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    3619198..3619217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3621103..3621122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3623279..3623298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3627354..3627373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3688931..3689625
FT                   /estimated_length=695
FT                   /gap_type="unknown"
FT   assembly_gap    3695432..3695501
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    3705252..3705341
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    3706904..3706923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3714799..3714818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3738510..3738529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3739782..3739801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3741687..3741706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3743279..3743298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3744358..3744721
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   gene            <3744874..3746015
FT                   /locus_tag="mCG_113987"
FT                   /note="gene_id=mCG113987.1"
FT   mRNA            join(<3744874..3745037,3745617..3745737,3745828..3746015)
FT                   /locus_tag="mCG_113987"
FT                   /product="mCG113987"
FT                   /note="gene_id=mCG113987.1 transcript_id=mCT115077.1
FT                   created on 20-FEB-2003"
FT   CDS             join(<3744874..3745037,3745617..3745737,3745828..3745974)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113987"
FT                   /product="mCG113987"
FT                   /note="gene_id=mCG113987.1 transcript_id=mCT115077.1
FT                   protein_id=mCP51727.1"
FT                   /protein_id="EDL00975.1"
FT                   /translation="LGKCRGLRTARKLRSHRRDQKWHDKQYKKAHLGTALKANPFGGAS
FT                   HAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAG
FT                   FGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS"
FT   assembly_gap    3747615..3748216
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   assembly_gap    3749816..3749835
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3756650..4042462)
FT                   /gene="Atg10"
FT                   /locus_tag="mCG_113985"
FT                   /note="gene_id=mCG113985.1"
FT   mRNA            complement(join(3756650..3757519,3757838..3757953,
FT                   3758543..3758640,3844695..3844792,3973597..3973692,
FT                   4026805..4026920,4042432..4042462))
FT                   /gene="Atg10"
FT                   /locus_tag="mCG_113985"
FT                   /product="autophagy-related 10 (yeast), transcript variant
FT                   mCT177121"
FT                   /note="gene_id=mCG113985.1 transcript_id=mCT177121.0
FT                   created on 01-APR-2003"
FT   mRNA            complement(join(3756650..3757411,3757838..3757953,
FT                   3758543..3758640,3844695..3844792,3861030..3861168,
FT                   3973597..3973692,4026805..4026920,4042432..4042462))
FT                   /gene="Atg10"
FT                   /locus_tag="mCG_113985"
FT                   /product="autophagy-related 10 (yeast), transcript variant
FT                   mCT177120"
FT                   /note="gene_id=mCG113985.1 transcript_id=mCT177120.0
FT                   created on 01-APR-2003"
FT   mRNA            complement(join(3756650..3757519,3757838..3757953,
FT                   3758543..3758640,3844695..3844792,3861030..3861168,
FT                   3973597..3973692,4026805..4026920,4042432..4042462))
FT                   /gene="Atg10"
FT                   /locus_tag="mCG_113985"
FT                   /product="autophagy-related 10 (yeast), transcript variant
FT                   mCT115075"
FT                   /note="gene_id=mCG113985.1 transcript_id=mCT115075.1
FT                   created on 01-APR-2003"
FT   CDS             complement(join(3757854..3757953,3758543..3758640,
FT                   3844695..3844792,3861030..3861168,3973597..3973692,
FT                   4026805..4026909))
FT                   /codon_start=1
FT                   /gene="Atg10"
FT                   /locus_tag="mCG_113985"
FT                   /product="autophagy-related 10 (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG113985.1 transcript_id=mCT115075.1
FT                   protein_id=mCP51719.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0R4J029"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="MGI:MGI:1914045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J029"
FT                   /protein_id="EDL00972.1"
FT                   /translation="MEDEFFGEKSFQHYCAEFIRHSQQIGDGWEWRTAKECSDGYMCKT
FT                   QFRIKNETLTPHASVLTCLPTEENLELPMDDSEVTRPAAVAEVIKHEYHVLYSCSYQVP
FT                   VLYFRASFLDGRPLALEDIWEGVHECYKPRLLQGPWDTITQQEHPILGQPFFVLHPCKT
FT                   NEFMTAVLKNSQKINRNVNYITSWLSLVGPVVGLNLPLSYAKATSQSE"
FT   CDS             complement(join(3757854..3757953,3758543..3758640,
FT                   3844695..3844792,3861030..3861168,3973597..3973692,
FT                   4026805..4026909))
FT                   /codon_start=1
FT                   /gene="Atg10"
FT                   /locus_tag="mCG_113985"
FT                   /product="autophagy-related 10 (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG113985.1 transcript_id=mCT177120.0
FT                   protein_id=mCP100043.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0R4J029"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="MGI:MGI:1914045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J029"
FT                   /protein_id="EDL00973.1"
FT                   /translation="MEDEFFGEKSFQHYCAEFIRHSQQIGDGWEWRTAKECSDGYMCKT
FT                   QFRIKNETLTPHASVLTCLPTEENLELPMDDSEVTRPAAVAEVIKHEYHVLYSCSYQVP
FT                   VLYFRASFLDGRPLALEDIWEGVHECYKPRLLQGPWDTITQQEHPILGQPFFVLHPCKT
FT                   NEFMTAVLKNSQKINRNVNYITSWLSLVGPVVGLNLPLSYAKATSQSE"
FT   assembly_gap    3764359..3764395
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    3789609..3789628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3790284..3790863
FT                   /pseudo
FT                   /locus_tag="mCG_113984"
FT                   /note="gene_id=mCG113984.1"
FT   mRNA            3790284..3790863
FT                   /pseudo
FT                   /locus_tag="mCG_113984"
FT                   /note="gene_id=mCG113984.1 transcript_id=mCT115074.0
FT                   created on 20-FEB-2003"
FT   assembly_gap    3790864..3790883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3844161..3844180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(3844778..3844792,3973597..3973692,
FT                   4026805..4026909))
FT                   /codon_start=1
FT                   /gene="Atg10"
FT                   /locus_tag="mCG_113985"
FT                   /product="autophagy-related 10 (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG113985.1 transcript_id=mCT177121.0
FT                   protein_id=mCP100042.0 isoform=CRA_b"
FT                   /protein_id="EDL00974.1"
FT                   /translation="MEDEFFGEKSFQHYCAEFIRHSQQIGDGWEWRTAKECSDGYMCKT
FT                   QFRIKNETLTPHASVLTCLPTEMGDR"
FT   assembly_gap    3848095..3848114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3866297..3866407
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    3887890..3887909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3901637..3901787
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    3937298..3937441
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    3969644..3969663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3993812..3993831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3995779..3995991
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   gene            4038958..4039380
FT                   /pseudo
FT                   /locus_tag="mCG_1047101"
FT                   /note="gene_id=mCG1047101.1"
FT   mRNA            4038958..4039380
FT                   /pseudo
FT                   /locus_tag="mCG_1047101"
FT                   /note="gene_id=mCG1047101.1 transcript_id=mCT164805.1
FT                   created on 20-FEB-2003"
FT   assembly_gap    4054543..4054625
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    4068606..4068644
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    4076969..4078258
FT                   /estimated_length=1290
FT                   /gap_type="unknown"
FT   gene            <4078905..4094518
FT                   /locus_tag="mCG_145871"
FT                   /note="gene_id=mCG145871.0"
FT   mRNA            join(<4078905..4078969,4081119..4081234,4093793..4094518)
FT                   /locus_tag="mCG_145871"
FT                   /product="mCG145871"
FT                   /note="gene_id=mCG145871.0 transcript_id=mCT185979.0
FT                   created on 03-JUL-2003"
FT   gene            complement(4079491..4081308)
FT                   /pseudo
FT                   /locus_tag="mCG_113986"
FT                   /note="gene_id=mCG113986.1"
FT   mRNA            complement(4079491..4081308)
FT                   /pseudo
FT                   /locus_tag="mCG_113986"
FT                   /note="gene_id=mCG113986.1 transcript_id=mCT115076.1
FT                   created on 20-FEB-2003"
FT   CDS             join(<4081186..4081234,4093793..4093980)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145871"
FT                   /product="mCG145871"
FT                   /note="gene_id=mCG145871.0 transcript_id=mCT185979.0
FT                   protein_id=mCP107345.0"
FT                   /protein_id="EDL00971.1"
FT                   /translation="GHPPPSSAGRQGLRTLSWKELSTSRRAEHSIQAQDAGRWLERGLR
FT                   DAEEWEDCFETATWLMMGVTRKEENTKRARKEK"
FT   assembly_gap    4090865..4090884
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4093261..4093280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4114542..4114561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4131691..4132011
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    4142839..4143005
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    4147298..4147506
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    4148735..4149225
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    4150598..4152492
FT                   /estimated_length=1895
FT                   /gap_type="unknown"
FT   assembly_gap    4159792..4159811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4182279..4182346
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    4184537..4184556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4187911..>4206965)
FT                   /locus_tag="mCG_1047223"
FT                   /note="gene_id=mCG1047223.1"
FT   mRNA            complement(join(4187911..4190345,4192116..4192280,
FT                   4206758..>4206965))
FT                   /locus_tag="mCG_1047223"
FT                   /product="mCG1047223"
FT                   /note="gene_id=mCG1047223.1 transcript_id=mCT164927.1
FT                   created on 01-APR-2003"
FT   CDS             complement(join(4190054..4190345,4192116..>4192138))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047223"
FT                   /product="mCG1047223"
FT                   /note="gene_id=mCG1047223.1 transcript_id=mCT164927.1
FT                   protein_id=mCP51803.1"
FT                   /protein_id="EDL00970.1"
FT                   /translation="NHPEVRLRAQPSDEVGGRNINFNSCFLTPAVSLPKNKFWRVLFET
FT                   KREFWGREKLVGSRAAAQRSREQDVCSYHAACKPLPGAGKEQSNLKAPLSAPCACSFPP
FT                   "
FT   assembly_gap    4196184..4196203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4212363..4212382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4214676..4214695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4216970..4216989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4222109..4222374
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    4223577..4223596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4235861..4235880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4249113..4249185
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    4251962..4251981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4253122..4253141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4276642..4276784
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    4279327..4279583
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    4281396..4282401
FT                   /estimated_length=1006
FT                   /gap_type="unknown"
FT   assembly_gap    4298486..4298505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4300585..4301044)
FT                   /pseudo
FT                   /locus_tag="mCG_1047100"
FT                   /note="gene_id=mCG1047100.1"
FT   mRNA            complement(4300585..4301044)
FT                   /pseudo
FT                   /locus_tag="mCG_1047100"
FT                   /note="gene_id=mCG1047100.1 transcript_id=mCT164804.1
FT                   created on 20-FEB-2003"
FT   assembly_gap    4314925..4315213
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    4329170..4329201
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    4330326..4330439
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    4335083..4335102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4347564..4527470
FT                   /gene="Ssbp2"
FT                   /locus_tag="mCG_131444"
FT                   /note="gene_id=mCG131444.1"
FT   mRNA            join(<4347564..4347636,4362535..4362596,4387341..4387425,
FT                   4489169..4489228,4494722..4494788,4495440..4495510,
FT                   4500106..4500173,4505631..4505679,4509310..4509345,
FT                   4510839..4510893,4514404..4514474,4516445..4516523,
FT                   4518616..4518644,4519604..4519702,4526263..4527470)
FT                   /gene="Ssbp2"
FT                   /locus_tag="mCG_131444"
FT                   /product="single-stranded DNA binding protein 2, transcript
FT                   variant mCT132779"
FT                   /note="gene_id=mCG131444.1 transcript_id=mCT132779.1
FT                   created on 09-DEC-2002"
FT   mRNA            join(<4347564..4347636,4362535..4362596,4387341..4387425,
FT                   4467228..4467317,4489169..4489228,4494722..4494788,
FT                   4495440..4495510,4500106..4500173,4505631..4505679,
FT                   4509310..4509345,4510839..4510893,4514404..4514474,
FT                   4516445..4516523,4518616..4518644,4519604..4519702,
FT                   4526263..4526716)
FT                   /gene="Ssbp2"
FT                   /locus_tag="mCG_131444"
FT                   /product="single-stranded DNA binding protein 2, transcript
FT                   variant mCT177126"
FT                   /note="gene_id=mCG131444.1 transcript_id=mCT177126.0
FT                   created on 09-DEC-2002"
FT   CDS             join(<4347565..4347636,4362535..4362596,4387341..4387425,
FT                   4467228..4467317,4489169..4489228,4494722..4494788,
FT                   4495440..4495510,4500106..4500173,4505631..4505679,
FT                   4509310..4509345,4510839..4510893,4514404..4514474,
FT                   4516445..4516523,4518616..4518644,4519604..4519702,
FT                   4526263..4526292)
FT                   /codon_start=1
FT                   /gene="Ssbp2"
FT                   /locus_tag="mCG_131444"
FT                   /product="single-stranded DNA binding protein 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG131444.1 transcript_id=mCT177126.0
FT                   protein_id=mCP100048.0 isoform=CRA_a"
FT                   /protein_id="EDL00968.1"
FT                   /translation="LALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWC
FT                   VFWDLYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNMPPGDGMPVGPVPPGFFQP
FT                   FMSPRYPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGM
FT                   VPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPTNANSIPYSSASPGNYVGP
FT                   PGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPNRPNFPMGPGSDGPMGGLGGMES
FT                   HHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQSESYSPSMTMSV
FT                   "
FT   CDS             join(<4347565..4347636,4362535..4362596,4387341..4387425,
FT                   4489169..4489228,4494722..4494788,4495440..4495510,
FT                   4500106..4500173,4505631..4505679,4509310..4509345,
FT                   4510839..4510893,4514404..4514474,4516445..4516523,
FT                   4518616..4518644,4519604..4519702,4526263..4526292)
FT                   /codon_start=1
FT                   /gene="Ssbp2"
FT                   /locus_tag="mCG_131444"
FT                   /product="single-stranded DNA binding protein 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG131444.1 transcript_id=mCT132779.1
FT                   protein_id=mCP51984.1 isoform=CRA_b"
FT                   /protein_id="EDL00969.1"
FT                   /translation="LALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWC
FT                   VFWDLYCAAPERRETCEHSSEAKAFHDYPFMSPRYPGGPRPPLRIPNQALGGVPGSQPL
FT                   LPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMG
FT                   PGGGRPWPNPTNANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMN
FT                   AVPPGPNRPNFPMGPGSDGPMGGLGGMESHHMNGSLGSGDMDSISKNSPNNMSLSNQPG
FT                   TPRDDGEMGGNFLNPFQSESYSPSMTMSV"
FT   assembly_gap    4353725..4353744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4357653..4358251
FT                   /estimated_length=599
FT                   /gap_type="unknown"
FT   assembly_gap    4361635..4361654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4363996..4364015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4365574..4365593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4378103..4378591
FT                   /estimated_length=489
FT                   /gap_type="unknown"
FT   assembly_gap    4432156..4432175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4438444..4439008
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   assembly_gap    4448256..4448371
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    4454880..4455132
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    4477607..4477626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4486971..4487005
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    4506040..4506059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4511068..4511087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4512927..4512946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4535745..4535764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4537641..4537660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4542277..4542296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4544982..4545001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4546324..4546343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4547781..4547800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4549143..4549162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4563445..4608138
FT                   /gene="Acot12"
FT                   /locus_tag="mCG_131446"
FT                   /note="gene_id=mCG131446.1"
FT   mRNA            join(4563445..4563584,4572159..4572228,4579505..4579565,
FT                   4581944..4582045,4584903..4585038,4592076..4592232,
FT                   4592831..4592950,4593710..4593860,4594411..4594466,
FT                   4594746..4594809,4596817..4596900,4603156..4603289,
FT                   4604881..4605009,4606262..4606388,4606612..4608138)
FT                   /gene="Acot12"
FT                   /locus_tag="mCG_131446"
FT                   /product="acyl-CoA thioesterase 12"
FT                   /note="gene_id=mCG131446.1 transcript_id=mCT132781.0
FT                   created on 09-DEC-2002"
FT   CDS             join(4563455..4563584,4572159..4572228,4579505..4579565,
FT                   4581944..4582045,4584903..4585038,4592076..4592232,
FT                   4592831..4592950,4593710..4593860,4594411..4594466,
FT                   4594746..4594809,4596817..4596900,4603156..4603289,
FT                   4604881..4605009,4606262..4606388,4606612..4606761)
FT                   /codon_start=1
FT                   /gene="Acot12"
FT                   /locus_tag="mCG_131446"
FT                   /product="acyl-CoA thioesterase 12"
FT                   /note="gene_id=mCG131446.1 transcript_id=mCT132781.0
FT                   protein_id=mCP51679.1"
FT                   /db_xref="GOA:A2RSC2"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="MGI:MGI:1921406"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSC2"
FT                   /protein_id="EDL00967.1"
FT                   /translation="MESMVAPGEVLMSQAIQPAHADSRGELSAGQLLKWMDTTACLAAE
FT                   KHAGISCVTASMDDILFEDTARIGQIITIRAKVTRAFSTSMEISIKVIVQDKFTGIQKL
FT                   LCVAFSTFVAKPVGKEKVHLKPVLLQTEQEQVEHNLASERRKVRLQHENTFNNIMKESS
FT                   RFSDSICNEEEGTATTMGTSVQSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLC
FT                   HGHPFLKSVDMFKFRGPSTVGDRLVFSAIVNNTFQNSVEVGVRVEAFDCQEWAEGQGRH
FT                   INSAFLIYNAVDDQEKLITFPRIQPISKDDFRRYQGAIARRRIRLGRKYVISHKKEVPL
FT                   SAQWDISKKGSLSNTNVEALKNLASKSGWEITTTLEKIKIYTLEEQDAISVKVEKLVGS
FT                   PAHIAYHLLSDLTKRPLWDPHYISCEVIDQVSEDDQIYYITCSVVNGDKPKDFVVLVSR
FT                   RKPLKDNNTYTVALRSVVLPSVPSSPQYIRSEVICAGFLIQAVDSNSCTVTYLNQMSDS
FT                   ILPYFAGNIGGWSKSIEEAAASCIKFIENATPDGLKSVL"
FT   assembly_gap    4604627..4604646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4613017..4613322
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   gene            complement(4618213..4630156)
FT                   /gene="Zcchc9"
FT                   /locus_tag="mCG_131447"
FT                   /note="gene_id=mCG131447.1"
FT   mRNA            complement(join(4618213..4619423,4620992..4621060,
FT                   4622780..4622872,4623035..4623185,4627856..4628265,
FT                   4629715..4630156))
FT                   /gene="Zcchc9"
FT                   /locus_tag="mCG_131447"
FT                   /product="zinc finger, CCHC domain containing 9, transcript
FT                   variant mCT132782"
FT                   /note="gene_id=mCG131447.1 transcript_id=mCT132782.0
FT                   created on 09-DEC-2002"
FT   mRNA            complement(join(4618706..4619423,4620992..4623185,
FT                   4627856..4628265,4629715..>4629810))
FT                   /gene="Zcchc9"
FT                   /locus_tag="mCG_131447"
FT                   /product="zinc finger, CCHC domain containing 9, transcript
FT                   variant mCT189352"
FT                   /note="gene_id=mCG131447.1 transcript_id=mCT189352.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(4619305..4619423,4620992..4621060,
FT                   4622780..4622872,4623035..4623185,4627856..4628239))
FT                   /codon_start=1
FT                   /gene="Zcchc9"
FT                   /locus_tag="mCG_131447"
FT                   /product="zinc finger, CCHC domain containing 9, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG131447.1 transcript_id=mCT132782.0
FT                   protein_id=mCP51688.1 isoform=CRA_a"
FT                   /protein_id="EDL00965.1"
FT                   /translation="MTRWARVTTSNSKRPLSATSWEDMKKGSVERADQSLPNRKQCQSS
FT                   RLPLRNDSPQAKRKKNKKKKEYLNEDVNGFMEYLKQNSQVLHNGQLIAADSQEVREEIA
FT                   VALKKDSRREGRRLKRQAAKKNAMVCFHCRQPGHGIADCPAVLESQDMGTGICYRCGST
FT                   EHEMSKCRANVDPALGEFPFAKCFVCGEMGHLSRSCPDNTKGVYADGGSCKLCGSVGHF
FT                   KKDCRENQNSDRIITVGRWAKGMSADYEDVLDVPKLQKPKTKVPKVVNF"
FT   CDS             complement(join(4622991..4623185,4627856..>4628260))
FT                   /codon_start=1
FT                   /gene="Zcchc9"
FT                   /locus_tag="mCG_131447"
FT                   /product="zinc finger, CCHC domain containing 9, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG131447.1 transcript_id=mCT189352.0
FT                   protein_id=mCP110353.0 isoform=CRA_b"
FT                   /protein_id="EDL00966.1"
FT                   /translation="WSTSDPTMTRWARVTTSNSKRPLSATSWEDMKKGSVERADQSLPN
FT                   RKQCQSSRLPLRNDSPQAKRKKNKKKKEYLNEDVNGFMEYLKQNSQVLHNGQLIAADSQ
FT                   EVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRQPGHGIADCPAVLESQDMGTGI
FT                   CYRCGSTEHEMSKCRANVDPALGMFSCSFLLGAEGR"
FT   assembly_gap    4625713..4626451
FT                   /estimated_length=739
FT                   /gap_type="unknown"
FT   gene            complement(4668821..4692281)
FT                   /gene="Ckmt2"
FT                   /locus_tag="mCG_131443"
FT                   /note="gene_id=mCG131443.1"
FT   mRNA            complement(join(4668821..4669081,4671169..4671294,
FT                   4673644..4673778,4674628..4674751,4675292..4675377,
FT                   4676571..4676792,4677186..4677281,4678572..4678770,
FT                   4680621..4680792,4692237..4692281))
FT                   /gene="Ckmt2"
FT                   /locus_tag="mCG_131443"
FT                   /product="creatine kinase, mitochondrial 2"
FT                   /note="gene_id=mCG131443.1 transcript_id=mCT132778.1
FT                   created on 20-FEB-2003"
FT   CDS             complement(join(4668962..4669081,4671169..4671294,
FT                   4673644..4673778,4674628..4674751,4675292..4675377,
FT                   4676571..4676792,4677186..4677281,4678572..4678770,
FT                   4680621..4680772))
FT                   /codon_start=1
FT                   /gene="Ckmt2"
FT                   /locus_tag="mCG_131443"
FT                   /product="creatine kinase, mitochondrial 2"
FT                   /note="gene_id=mCG131443.1 transcript_id=mCT132778.1
FT                   protein_id=mCP51981.1"
FT                   /protein_id="EDL00963.1"
FT                   /translation="MASAFSKLLTGRNASLLFTTLGTSALTTGYLLNRQKVSADAREQH
FT                   KLFPPSADYPDLRKHNNCMAECLTPTIYAKLRNKMTPSGYTLDQCIQTGVDNPGHPFIK
FT                   TVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHPTDLDASKITHGQFDERYVLSS
FT                   RVRTGRSIRGLSLPPACSRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLI
FT                   DDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMK
FT                   RVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDP
FT                   RFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEK
FT                   KLERGQDIKVPPPLPQFGRK"
FT   gene            <4676864..4677475
FT                   /locus_tag="mCG_145861"
FT                   /note="gene_id=mCG145861.0"
FT   mRNA            join(<4676864..4676939,4677057..4677200,4677361..4677475)
FT                   /locus_tag="mCG_145861"
FT                   /product="mCG145861"
FT                   /note="gene_id=mCG145861.0 transcript_id=mCT185969.0
FT                   created on 03-JUL-2003"
FT   CDS             join(<4676935..4676939,4677057..4677200,4677361..4677442)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145861"
FT                   /product="mCG145861"
FT                   /note="gene_id=mCG145861.0 transcript_id=mCT185969.0
FT                   protein_id=mCP107346.0"
FT                   /protein_id="EDL00964.1"
FT                   /translation="VRAYDEVGHFSRYISPREHLIGFLFCLWIQEILHHGKKKWSLEPT
FT                   LDASRARGTGWMASCEIHAPCGTCIEEYTSR"
FT   gene            complement(<4699850..>4932425)
FT                   /gene="Rasgrf2"
FT                   /locus_tag="mCG_131441"
FT                   /note="gene_id=mCG131441.1"
FT   mRNA            complement(join(<4699850..4699942,4701066..4701134,
FT                   4701774..4701891,4703054..4703133,4705993..4706190,
FT                   4709168..4709252,4711472..4711575,4711827..4711887,
FT                   4717984..4718096,4735650..4735753,4784563..4784652,
FT                   4787813..4787917,4798267..4798529,4799126..4799374,
FT                   4803633..4803715,4816907..4817043,4817546..4817612,
FT                   4818818..4818978,4823972..4824090,4824774..4824883,
FT                   4829675..4829868,4830203..4830282,4831855..4832108,
FT                   4837073..4837162,4839316..4839463,4854685..4854791,
FT                   4932138..>4932425))
FT                   /gene="Rasgrf2"
FT                   /locus_tag="mCG_131441"
FT                   /product="RAS protein-specific guanine nucleotide-releasing
FT                   factor 2"
FT                   /note="gene_id=mCG131441.1 transcript_id=mCT132776.0
FT                   created on 09-DEC-2002"
FT   CDS             complement(join(4699850..4699942,4701066..4701134,
FT                   4701774..4701891,4703054..4703133,4705993..4706190,
FT                   4709168..4709252,4711472..4711575,4711827..4711887,
FT                   4717984..4718096,4735650..4735753,4784563..4784652,
FT                   4787813..4787917,4798267..4798529,4799126..4799374,
FT                   4803633..4803715,4816907..4817043,4817546..4817612,
FT                   4818818..4818978,4823972..4824090,4824774..4824883,
FT                   4829675..4829868,4830203..4830282,4831855..4832108,
FT                   4837073..4837162,4839316..4839463,4854685..4854791,
FT                   4932138..4932425))
FT                   /codon_start=1
FT                   /gene="Rasgrf2"
FT                   /locus_tag="mCG_131441"
FT                   /product="RAS protein-specific guanine nucleotide-releasing
FT                   factor 2"
FT                   /note="gene_id=mCG131441.1 transcript_id=mCT132776.0
FT                   protein_id=mCP51960.0"
FT                   /protein_id="EDL00962.1"
FT                   /translation="MQKSVRYNEGHALYLAMLARKEGTKRGFLSKKAAEASRWHEKWFA
FT                   LYQNVLFYFEGEQSGRPAGMYLLEGCSCERTPAPPRTNAGPAGARDALDKQYYFTVLFG
FT                   HDGQKPLELRCEEEQAGKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIATNQ
FT                   LRHQLEDQDTEIERLKSEIVALNKTKERMRPYHVHQEEEDPDIKKIKKVQSFMRGWLCR
FT                   RKWKTIVQDYICSPHAESMRKRNQIVFTMVEAETEYVHQLYILVNGFLRPLRMAASSKK
FT                   PPINHDDVSSIFLNSETIMFLHEIFHQGLKARLANWPTLVLADLFDILLPMLNIYQEFV
FT                   RNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELL
FT                   AHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQ
FT                   TFIRQGSLIQVPSVERGKLSKVRLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLK
FT                   TGGVLSLIQCTLIEEPDGSDDDPKGSGHMFGHLDFKIVVEPPDAASFTVVLLAPSRQEK
FT                   AAWMSDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCK
FT                   VPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTATVVLAKLSDIYKRPFTSIP
FT                   VRSLELFFATSQNNREHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSSLNSR
FT                   IGALDLTNSSSSSSPTTTTHSPAASPPPHTAVLESAPADKAGDSADMSPCRSPTTPRHL
FT                   RYRQPGGQVADSAHCSVSPASAFAIATAAAGHGSPPGFNNERTCDKEFIIRRTATNRVL
FT                   NVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKATANILRALSQDDQDD
FT                   IHLKLEDIIQMTDCPKAECFETLSAMELAEQITLLDHIVFRSIPYEEFLGQGWMKLDKN
FT                   ERTPYIMKTSQHFNEMSNLVASQIMNYADISSRANAIEKWVAVADICRCLHNYNGVLEI
FT                   TSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLG
FT                   MYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTAYRIDQQPKVIQYLLD
FT                   KALVIDEDSLYELSLKIEPRLPA"
FT   assembly_gap    4719376..4720501
FT                   /estimated_length=1126
FT                   /gap_type="unknown"
FT   assembly_gap    4766277..4767756
FT                   /estimated_length=1480
FT                   /gap_type="unknown"
FT   assembly_gap    4768838..4768888
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    4788907..4788955
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    4806032..4806051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4811714..4811889
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    4814132..4814479
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    4862816..4862974
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    4876830..4876939
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    4925261..4925325
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    4953761..4953849
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    4992623..4992904
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    4993885..4996531
FT                   /estimated_length=2647
FT                   /gap_type="unknown"
FT   assembly_gap    5006522..5006541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5008171..5008199
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    5012945..5012964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5014114..5014390
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   gene            complement(5016707..5149429)
FT                   /locus_tag="mCG_131439"
FT                   /note="gene_id=mCG131439.2"
FT   mRNA            complement(join(5016707..5017371,5020295..5020466,
FT                   5025800..5025929,5027954..5028140,5040382..5040539,
FT                   5063294..5063462,5064072..5064259,5075738..5075870,
FT                   5089135..5089244,5090256..5090340,5099427..5099541,
FT                   5102556..5102668,5135249..5135415,5137959..5138085,
FT                   5138174..5138223,5139362..5139852,5140331..5140447,
FT                   5143542..5143730,5145624..5145753,5147636..5147753,
FT                   5149189..>5149425))
FT                   /locus_tag="mCG_131439"
FT                   /product="mCG131439, transcript variant mCT189351"
FT                   /note="gene_id=mCG131439.2 transcript_id=mCT189351.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(5016709..5017371,5020295..5020466,
FT                   5025800..5025929,5027954..5028140,5040382..5040536,
FT                   5063294..5063462,5064072..5064259,5075738..5075870,
FT                   5089135..5089244,5090256..5090340,5099427..5099541,
FT                   5102556..5102668,5135249..5135415,5137959..5138104,
FT                   5139735..5139852,5140331..5140447,5143542..5143730,
FT                   5145624..5145844,5147636..5147753,5149189..5149429))
FT                   /locus_tag="mCG_131439"
FT                   /product="mCG131439, transcript variant mCT176663"
FT                   /note="gene_id=mCG131439.2 transcript_id=mCT176663.0
FT                   created on 06-DEC-2002"
FT   CDS             complement(join(5017260..5017371,5020295..5020466,
FT                   5025800..5025929,5027954..5028140,5040382..5040536,
FT                   5063294..5063462,5064072..5064259,5075738..5075870,
FT                   5089135..5089244,5090256..5090340,5099427..5099541,
FT                   5102556..5102668,5135249..5135415,5137959..5138104,
FT                   5139735..5139852,5140331..5140447,5143542..5143730,
FT                   5145624..5145844,5147636..5147753,5149189..5149326))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131439"
FT                   /product="mCG131439, isoform CRA_c"
FT                   /note="gene_id=mCG131439.2 transcript_id=mCT176663.0
FT                   protein_id=mCP99585.0 isoform=CRA_c"
FT                   /protein_id="EDL00961.1"
FT                   /translation="MPRGKSASGGSTAAGPGPGRQTVLSRFFRSAGSLRSSASSTEPAE
FT                   KVTEGDSRKRSLGNGGPTKKKARKVPEKEEENISVASHHPEAKKCLRPRIVLKSLEKLK
FT                   EFCCDSALPQNRVQTEALRERLEVLPRCTDFEDITLQRAKNAVLSEDSKSQANQKDSQF
FT                   GPCPEVFQKTSDCKPFNKRSKSVYTPLELQYLDMKQQHKDAVLCVECGYKYRFFGEDAE
FT                   IAARELNIYCHLDHNFMTASIPTHRLFVHVRRLVAKGYKVGVVKQTETAALKAIGDNKS
FT                   SVFSRKLTALYTKSTLIGEDVNPLIRLDDSVNIDEVMTDTSTNYLLCIYEEKENIKDKK
FT                   KGNLSVGVVGVQPATGEVVFDCFQDSASRLELETRISSLQPVELLLPSDLSVPTEMLIQ
FT                   RATNVSVRDDRIRVERMNNTYFEYSHAFQTVTEFYAREIVDSQGSQSLSGVINLEKPVI
FT                   CALAAVIRYLKEFNLEKMLSKPESFKQLSSGMEFMRINGTTLRNLEILQNQTDMKTKGS
FT                   LLWVLDHTKTSFGRRKLKNWVTQPLLKLREINARLDAVSDVLHSESSVFEQIENLLRKL
FT                   PDVERGLCSIYHKKCSTQEFFLIVKSLCQLKSELQALMPAVNSHVQSDLLRALIVEAPE
FT                   LLSPVEHYLKVLNGPAAKVGDKTELFKDLSDFPLIKKRKNEIQEVIHSIQMRLQEFRKI
FT                   LKLPSLQYVTVSGQEDSERVMIITGPNMGGKSSYIKQVALVTIMAQIGSYVPAEEATIG
FT                   IVDGIFTRMGAADNIYKGRSTFMEELTDTAEIIRRASPQSLVILDELGRGTSTHDGIAI
FT                   AYATLEYFIRDVKSLTLFVTHYPPVCELEKCYPEQVGNYHMGFLVNEDESKQDSGDMEQ
FT                   MPDSVTFLYQITRGIAARSYGLNVAKLADVPREVLQKAAHKSKELEGLVSLRRKRLECF
FT                   TDLWTTHSVKDLHTWADKLEMEEIQTSLPH"
FT   CDS             complement(join(5017260..5017371,5020295..5020466,
FT                   5025800..5025929,5027954..5028140,5040382..5040539,
FT                   5063294..5063462,5064072..5064259,5075738..5075870,
FT                   5089135..5089244,5090256..5090340,5099427..5099541,
FT                   5102556..5102668,5135249..5135415,5137959..5138085,
FT                   5138174..5138223,5139362..>5139472))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131439"
FT                   /product="mCG131439, isoform CRA_b"
FT                   /note="gene_id=mCG131439.2 transcript_id=mCT189351.0
FT                   protein_id=mCP110352.0 isoform=CRA_b"
FT                   /protein_id="EDL00960.1"
FT                   /translation="VSRALLAPQKLANVRPERNFLTSCETNSRDEIKTQLNFSEETPCN
FT                   CDCPWKNAALDDSVNIDEVMTDTSTNYLLCIYEEKENIKDKKKGNLSVGVVGVQPATGE
FT                   VVFDCFQDSASRLELETRISSLQPVELLLPSDLSVPTEMLIQRATNVSVRDDRIRVERM
FT                   NNTYFEYSHAFQTVTEFYAREIVDSQGSQSLSGVINLEKPVICALAAVIRYLKEFNLEK
FT                   MLSKPESFKQLSSGMEFMRINGTTLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKL
FT                   KNWVTQPLLKLREINARLDAVSDVLHSESSVFEQIENLLRKLPDVERGLCSIYHKKCST
FT                   QEFFLIVKSLCQLKSELQALMPAVNSHVQSDLLRALIVEAPELLSPVEHYLKVLNGPAA
FT                   KVGDKTELFKDLSDFPLIKKRKNEIQEVIHSIQMRLQEFRKILKLPSLQYVTVSGQEQD
FT                   SERVMIITGPNMGGKSSYIKQVALVTIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIY
FT                   KGRSTFMEELTDTAEIIRRASPQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVKSLT
FT                   LFVTHYPPVCELEKCYPEQVGNYHMGFLVNEDESKQDSGDMEQMPDSVTFLYQITRGIA
FT                   ARSYGLNVAKLADVPREVLQKAAHKSKELEGLVSLRRKRLECFTDLWTTHSVKDLHTWA
FT                   DKLEMEEIQTSLPH"
FT   assembly_gap    5034530..5034578
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    5049911..5062311
FT                   /estimated_length=12401
FT                   /gap_type="unknown"
FT   assembly_gap    5069532..5069622
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    5072147..5072166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5123653..5123672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(<5133762..5133828,5135249..5135415,
FT                   5137959..5138102,5139733..5139852,5140331..5140447,
FT                   5143542..5143730,5145624..5145844,5147636..5147753,
FT                   5148419..5148942))
FT                   /locus_tag="mCG_131439"
FT                   /product="mCG131439, transcript variant mCT132774"
FT                   /note="gene_id=mCG131439.2 transcript_id=mCT132774.1
FT                   created on 06-DEC-2002"
FT   CDS             complement(join(5133762..5133828,5135249..5135415,
FT                   5137959..5138102,5139733..5139852,5140331..5140447,
FT                   5143542..5143730,5145624..5145844,5147636..5147753,
FT                   5148419..5148460))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131439"
FT                   /product="mCG131439, isoform CRA_a"
FT                   /note="gene_id=mCG131439.2 transcript_id=mCT132774.1
FT                   protein_id=mCP51949.1 isoform=CRA_a"
FT                   /protein_id="EDL00959.1"
FT                   /translation="MFPTLAGNVSHLFRVTEGDSRKRSLGNGGPTKKKARKVPEKEEEN
FT                   ISVASHHPEAKKCLRPRIVLKSLEKLKEFCCDSALPQNRVQTEALRERLEVLPRCTDFE
FT                   DITLQRAKNAVLSEDSKSQANQKDSQFGPCPEVFQKTSDCKPFNKRSKSVYTPLELQYL
FT                   DMKQQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMTASIPTHRLFVHVRR
FT                   LVAKGYKVGVVKQTETAALKAIGDNKSSVFSRKLTALYTKSTLIGEDVNPLIRLDDSVN
FT                   IDEVMTDTSTNYLLCIYEEKENIKDKKKGNLSVGVVGVQPATGEVVFDCFQDSASRLEL
FT                   ETRISSLQPVELLLPSDLSVPTEMLIQRATNVRLKTVRKLKTPFLFLILFCVQH"
FT   assembly_gap    5142151..5142170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5149630..5179743
FT                   /gene="Dhfr"
FT                   /locus_tag="mCG_131438"
FT                   /note="gene_id=mCG131438.1"
FT   mRNA            join(5149630..5149770,5150076..5150125,5152353..5152458,
FT                   5159835..5159961,5162355..5162470,5178784..5179743)
FT                   /gene="Dhfr"
FT                   /locus_tag="mCG_131438"
FT                   /product="dihydrofolate reductase"
FT                   /note="gene_id=mCG131438.1 transcript_id=mCT132773.0
FT                   created on 05-DEC-2002"
FT   CDS             join(5149685..5149770,5150076..5150125,5152353..5152458,
FT                   5159835..5159961,5162355..5162470,5178784..5178862)
FT                   /codon_start=1
FT                   /gene="Dhfr"
FT                   /locus_tag="mCG_131438"
FT                   /product="dihydrofolate reductase"
FT                   /note="gene_id=mCG131438.1 transcript_id=mCT132773.0
FT                   protein_id=mCP51948.1"
FT                   /db_xref="GOA:Q544T5"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="MGI:MGI:94890"
FT                   /db_xref="UniProtKB/TrEMBL:Q544T5"
FT                   /protein_id="EDL00958.1"
FT                   /translation="MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVE
FT                   GKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQP
FT                   ELASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEY
FT                   PGVLSEVQEEKGIKYKFEVYEKKD"
FT   assembly_gap    5165903..5166131
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    5187003..5191031
FT                   /estimated_length=4029
FT                   /gap_type="unknown"
FT   gene            <5219687..5234647
FT                   /gene="6430502M16Rik"
FT                   /locus_tag="mCG_144921"
FT                   /note="gene_id=mCG144921.0"
FT   mRNA            join(<5219687..5219920,5220795..5220939,5222489..5222571,
FT                   5226507..5226565,5231956..5234647)
FT                   /gene="6430502M16Rik"
FT                   /locus_tag="mCG_144921"
FT                   /product="RIKEN cDNA 6430502M16"
FT                   /note="gene_id=mCG144921.0 transcript_id=mCT184345.0
FT                   created on 05-JUN-2003"
FT   CDS             <5231970..5233505
FT                   /codon_start=1
FT                   /gene="6430502M16Rik"
FT                   /locus_tag="mCG_144921"
FT                   /product="RIKEN cDNA 6430502M16"
FT                   /note="gene_id=mCG144921.0 transcript_id=mCT184345.0
FT                   protein_id=mCP105300.0"
FT                   /protein_id="EDL00957.1"
FT                   /translation="LLKMDEGSEVSTDGNSLIKAVHQSRLRLTRLLLEGGAYINESNDR
FT                   GETPLMIACKTKHVDQQSVGRAKMVKYLLENSADPNIQDKSGKSALMHACLERAGPEVV
FT                   SLLLKSGADLSLQDHSGYSALVYAINAEDRDTLKVLLSACQAKGKEVIIITTAKSPSGR
FT                   HTTQHHLNMPPADMDGSHPPATPSEIDIKTASLPLSYSSETDLTLFGFKDKELCGGSDN
FT                   TWDPDSPPRKPVIATNGPKLSQAPAWIKSTPSLKHQARVASLQEELQDITPEEEIAYKT
FT                   NALALSKRFITRHQSIDVKDTAHLLRAFDQVNSRKMSYDEINYHSLFPEGSQTSVEIPT
FT                   DRDPDSNQIFASTLKSIVQKRNSGANHYSSDSQLAEGVTPPTVEDGKAAKKKIFAPSPS
FT                   LLSGSKELVEPAPPGPLSRRNHAVLERRGSGAFPLDHSLAQSRPGFLPPLNVNPHPPIT
FT                   DIGVNNKICGLLSCGQKALMPTAPIFPKEFKTKKMLLRRQSLQTEQIKQLVNF"
FT   gene            complement(5243348..5280621)
FT                   /locus_tag="mCG_131442"
FT                   /note="gene_id=mCG131442.1"
FT   mRNA            complement(join(5243348..5243977,5263667..5263802,
FT                   5264635..5264852,5270655..5270820,5274570..5274695,
FT                   5280455..5280621))
FT                   /locus_tag="mCG_131442"
FT                   /product="mCG131442"
FT                   /note="gene_id=mCG131442.1 transcript_id=mCT132777.0
FT                   created on 20-FEB-2003"
FT   CDS             complement(join(5243809..5243977,5263667..5263802,
FT                   5264635..5264852,5270655..5270820,5274570..5274695,
FT                   5280455..5280602))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131442"
FT                   /product="mCG131442"
FT                   /note="gene_id=mCG131442.1 transcript_id=mCT132777.0
FT                   protein_id=mCP51977.1"
FT                   /protein_id="EDL00956.1"
FT                   /translation="MRTFYITGAEVPVRSSGFRQEDNQETANLVHLRRSLRLSVTMAAC
FT                   AGGPGSWSENILKYFLRNNQITAEDGAEILWSHAANHKSQMNEALKSAAHMIEADVLLP
FT                   SDGSEHGQPIMAHPPETSSDNTLQEWLAEVVKSNKGIKLDFKSLAAVRASMLFLDNVKQ
FT                   HLQRPVWINADILPGPNGSSKVVDAKAFLDTVTSFFPDVTFSLGWTTGWHPEKVNEGYS
FT                   WSMVKEMDYICSELTQPVTFPVRAALVRQSCPQLLWLLTKSNRYSLTVWTGKDDIYSTE
FT                   DLLYIRDYFNKTQVFYDISEPQNHEFKQAIGIRGHSLRI"
FT   assembly_gap    5247404..5247423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5252934..5252953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5253985..5254004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5255392..5255411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5258874..5258944
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    5271865..5272046
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   gene            complement(5284280..5328057)
FT                   /gene="Zfyve16"
FT                   /locus_tag="mCG_131445"
FT                   /note="gene_id=mCG131445.1"
FT   mRNA            complement(join(5284280..5285153,5289759..5289926,
FT                   5291112..5291217,5292189..5292351,5297467..5297547,
FT                   5301201..5301348,5301738..5301842,5302922..5303004,
FT                   5305385..5305609,5306154..5306309,5307264..5307386,
FT                   5308741..5309119,5311050..5311192,5313794..5313955,
FT                   5316726..5316822,5318374..5320589,5321488..5321596,
FT                   5327958..5328057))
FT                   /gene="Zfyve16"
FT                   /locus_tag="mCG_131445"
FT                   /product="zinc finger, FYVE domain containing 16"
FT                   /note="gene_id=mCG131445.1 transcript_id=mCT132780.1
FT                   created on 20-FEB-2003"
FT   CDS             complement(join(5284992..5285153,5289759..5289926,
FT                   5291112..5291217,5292189..5292351,5297467..5297547,
FT                   5301201..5301348,5301738..5301842,5302922..5303004,
FT                   5305385..5305609,5306154..5306309,5307264..5307386,
FT                   5308741..5309119,5311050..5311192,5313794..5313955,
FT                   5316726..5316822,5318374..5320589,5321488..5321557))
FT                   /codon_start=1
FT                   /gene="Zfyve16"
FT                   /locus_tag="mCG_131445"
FT                   /product="zinc finger, FYVE domain containing 16"
FT                   /note="gene_id=mCG131445.1 transcript_id=mCT132780.1
FT                   protein_id=mCP51987.1"
FT                   /protein_id="EDL00955.1"
FT                   /translation="MDSYFKAAVSGLDKLLDDFEQNPDKQDYLPDAYAFNQCSVSSESA
FT                   SPQLALLSKDQRCISTCASSEACCEDANETFLEGKIHEGLTSRPNEKNVAGLDLLSSVD
FT                   ASTSDEIQPSCMRRCSKPVCDLISDMGNLVHATNSEEDIKQLLPDDPKSSADTLITLDS
FT                   SSVSEALTVSSVDCGSNAVREEQNNINAGIKNRDISIKELGVKVDMALFDSCKYNRTEN
FT                   LKDKIISNELETVDFDMPSVLMEQSSEMSNTKDNPQYKRLPCELLKDDGCLAEEKVAVA
FT                   VNNTECLEEGGGSNTIAMPCKLPENEGISPSDPASKDENFKLPDFPLQENRTSVFMKQT
FT                   VKEDSRNLDLKDNNDIVHVSGDDVPPSLSCLSLSGSLCGSLIHNNEHSDILPPNESEGQ
FT                   NNDAVTIHEEIQKSDVLDGETDLSKKETCRSIFLQPVNEKKGEGKVEVEEMVISGESLE
FT                   SPEDASSAAAAGSPVALSAASVPEAPGPCEGLTFPSSDMDGQELDYFNIDESMRSGILI
FT                   SDAELDAFLKEQCLSNSNTMSAGENVNDSQLQMNQITMKGLHDENAGDIYFNAEAGAAG
FT                   ENGGVGNCETSDKENTENNGLSIGEKGAIPTERELSACQPDIRDELPVPSIKTQAVGGA
FT                   RPKQLLSLPPGTRSSKELNKPDVVDVPESEPCTANATAVSTCSADHIPDSQVSFNSNYI
FT                   DIESNFEDGSSFVTANKDSLPENKRKESLVLGQKQPTWVPDSEAPNCMNCQVKFTFTKR
FT                   RHHCRACGKVFCGVCCNRKCKLQYLEKEARVCVICYETINKAQAFERMMSPGGSCLKSN
FT                   HSNECATDQPLQETQTSSTPSPTTLPISALKQPNVEGPCSKEQKRVWFADGILPNGEVA
FT                   DTTKLSSGSKRCSDDFSPVLPDVPTMINKVDRTHSPTVEKPNNGLGDIIRSEISQSPTC
FT                   HTAPVERLPGNTGTEGLPMPGPFTLEDDVFVDSEEPSTPTVVPANSGLPVASISDYRLL
FT                   CSVAKCVCNNISLLPDDDIGLPPLLATSGEDGSVPVVQERPSHEQIILLLEGEGFPPAT
FT                   FVLNANLLVNVKLVLYSSEKYWYFSTNGLHGLGQAEIIVLLQCLPNEDTVPKDIFRLFI
FT                   TIYKDALKGKYIENLDNLTFTESFLNSKDHGGFLFITPTFQNLDGLPVPRSPFLCGILI
FT                   QKLEIPWAKVFPMRLMLRLGAEYKAYPAPLTSVRGRKPLFGEIGHTIMNLLVDLRNYQY
FT                   TLHNIDQLLIHMEMGKSCIKIPRKKYSDVMKVIHSSNEHVISIGASFSTEADSHLVCVQ
FT                   SDGVYQTQANSATGQPRKVTGASFVVFNGALKTSSGFLAKSSIVEDGLMVQITPETMEG
FT                   LRLALREQKDFRIQCGKVDAVDLREYVDICWVDSEERKNKGVISSVDGMSVEGFPSEKI
FT                   KLETDFETEEKTVKCTEVFYFLKDQDISILSSSYQFAKEIAVACSAALCPHLRTLKSNR
FT                   MNKIGLRVSIDTDMVEFQAGCEGQLLPQHYLNDLDSALIPVIHGGTSNSSLPLEIELAF
FT                   FILENLSE"
FT   assembly_gap    5299010..5299032
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    5339218..5339749
FT                   /estimated_length=532
FT                   /gap_type="unknown"
FT   assembly_gap    5341056..5341075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5342152..5342171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5343226..5343245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5344306..5344325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5345531..5345550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5349542..5349561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5356138..5380100
FT                   /locus_tag="mCG_1047212"
FT                   /note="gene_id=mCG1047212.1"
FT   mRNA            join(<5356138..5356163,5379530..5380100)
FT                   /locus_tag="mCG_1047212"
FT                   /product="mCG1047212"
FT                   /note="gene_id=mCG1047212.1 transcript_id=mCT164916.0
FT                   created on 20-FEB-2003"
FT   assembly_gap    5360361..5360380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5367014..5371805
FT                   /estimated_length=4792
FT                   /gap_type="unknown"
FT   assembly_gap    5373037..5373056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5375081..5375100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5377483..5379043)
FT                   /gene="Spz1"
FT                   /locus_tag="mCG_131440"
FT                   /note="gene_id=mCG131440.1"
FT   mRNA            complement(5377483..5379043)
FT                   /gene="Spz1"
FT                   /locus_tag="mCG_131440"
FT                   /product="spermatogenic Zip 1"
FT                   /note="gene_id=mCG131440.1 transcript_id=mCT132775.1
FT                   created on 05-DEC-2002"
FT   CDS             complement(5377679..5378815)
FT                   /codon_start=1
FT                   /gene="Spz1"
FT                   /locus_tag="mCG_131440"
FT                   /product="spermatogenic Zip 1"
FT                   /note="gene_id=mCG131440.1 transcript_id=mCT132775.1
FT                   protein_id=mCP51956.0"
FT                   /protein_id="EDL00954.1"
FT                   /translation="MSDTDNSAEMPARCPSPNPAPGAKQEPPNSGITISLLEIGSLPTV
FT                   CYHSFPPPKNSICPVEKRGRVQKFSNLLKDVKDVLKNIAGVEEKSTVGEPFDDAYIPED
FT                   LSELNVRGVEKKNKIRFKDDLFIHFDPEREQNTMKQMLLKNQSAKNMVPKFARDLCNAE
FT                   ETRGFDGMLLSVKRPRNGSLHLRGEYRKLRNNMEQLLQEADHWSKQHNELSELMRSYQE
FT                   CQNETQETTDKDRACLQNQPNNGLSTKQKLEEQVKKLSHDTHALHLIAALLENECQVLQ
FT                   QRVDILKDFHLHEAGLGHEKPLQMSCEQDKKCPKLAEADKTDAFKHTTRATEGTIRKPK
FT                   ILRSPDVCFTKKARNNRFNARVAKKSLVGKRRTVSSFR"
FT   CDS             <5379572..5379763
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047212"
FT                   /product="mCG1047212"
FT                   /note="gene_id=mCG1047212.1 transcript_id=mCT164916.0
FT                   protein_id=mCP51765.0"
FT                   /protein_id="EDL00953.1"
FT                   /translation="SCWRKCITYGVGFEGSESLLQAQSIRLFLLPADPDVELSVPSPAP
FT                   CLPACHRASRCDNNGLNL"
FT   assembly_gap    5387281..5387300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5388812..5388924
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   gene            5407700..5503906
FT                   /gene="Serinc5"
FT                   /locus_tag="mCG_114978"
FT                   /note="gene_id=mCG114978.1"
FT   mRNA            join(5407700..5407848,5452976..5453143,5474711..5474892,
FT                   5475312..5475394,5477101..5477194,5480563..5480774,
FT                   5482888..5482983,5485416..5485542,5493621..5493687,
FT                   5497450..5497489,5498081..5498225,5499947..5503906)
FT                   /gene="Serinc5"
FT                   /locus_tag="mCG_114978"
FT                   /product="serine incorporator 5"
FT                   /note="gene_id=mCG114978.1 transcript_id=mCT116076.1
FT                   created on 20-FEB-2003"
FT   CDS             join(5407822..5407848,5452976..5453143,5474711..5474892,
FT                   5475312..5475394,5477101..5477194,5480563..5480774,
FT                   5482888..5482983,5485416..5485542,5493621..5493687,
FT                   5497450..5497489,5498081..5498225,5499947..5500091)
FT                   /codon_start=1
FT                   /gene="Serinc5"
FT                   /locus_tag="mCG_114978"
FT                   /product="serine incorporator 5"
FT                   /note="gene_id=mCG114978.1 transcript_id=mCT116076.1
FT                   protein_id=mCP51904.1"
FT                   /protein_id="EDL00952.1"
FT                   /translation="MSARCCAGQLACCCGSAGCSLCCGCCPKFRQSRTTRFMYLFYFIL
FT                   VIALCCVMMTPSVMKQVKDHIPFFEEFCKKTQAGGDACENLVGYSAVYRVCFGMACFFA
FT                   LFCLLTLKVNNSKSCRAYIHNGFWFFKLLLLGAMCSGAFFIPDQETFLKVWRYVGAGGS
FT                   FLFICIQLLLIVQFAHKWNKNWTAGTVRNKLWYASLSLVTLIMYSVAVGGLALMAVFYT
FT                   QWDDCMDNKILLGVHGGLCVLISLVAISPCVQNRQPHSGLLQSGLISCYVTYLTFSALT
FT                   SKPEKKVLDEHGKNVTICAPDFGQDLHRDENMVTWLGTLLLIVCISYSCLTSTTRSSSD
FT                   ALQSRYGAPELEVARCCFCFGPDGEDTEEQQNVKKGPRVIYDEKKGTVYSYSYFHFVFF
FT                   LASLYVMMTLTSWFHYENATIKTFFSGWSVFWVKMASCWMCVLLYLQTLVAPLCCPSRQ
FT                   FSV"
FT   assembly_gap    5410160..5410314
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    5413365..5413384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5429307..5429326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5430395..5430414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5433527..5435294
FT                   /estimated_length=1768
FT                   /gap_type="unknown"
FT   assembly_gap    5436623..5436642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5446834..5446853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5543587..5586461)
FT                   /gene="Thbs4"
FT                   /locus_tag="mCG_114974"
FT                   /note="gene_id=mCG114974.1"
FT   mRNA            complement(join(5543587..5543808,5544348..5544487,
FT                   5546270..5546442,5547091..5547287,5547371..5547419,
FT                   5548410..5548588,5549920..5550113,5552535..5552587,
FT                   5553468..5553586,5554773..5554932,5555189..5555296,
FT                   5555542..5555646,5559149..5559301,5561529..5561597,
FT                   5564881..5565018,5566405..5566607,5566841..5566892,
FT                   5567207..5567289,5567823..5567931,5568589..5568836,
FT                   5582382..5582585,5586283..5586461))
FT                   /gene="Thbs4"
FT                   /locus_tag="mCG_114974"
FT                   /product="thrombospondin 4"
FT                   /note="gene_id=mCG114974.1 transcript_id=mCT116072.0
FT                   created on 04-DEC-2002"
FT   CDS             complement(join(5543747..5543808,5544348..5544487,
FT                   5546270..5546442,5547091..5547287,5547371..5547419,
FT                   5548410..5548588,5549920..5550113,5552535..5552587,
FT                   5553468..5553586,5554773..5554932,5555189..5555296,
FT                   5555542..5555646,5559149..5559301,5561529..5561597,
FT                   5564881..5565018,5566405..5566607,5566841..5566892,
FT                   5567207..5567289,5567823..5567931,5568589..5568836,
FT                   5582382..5582585,5586283..5586376))
FT                   /codon_start=1
FT                   /gene="Thbs4"
FT                   /locus_tag="mCG_114974"
FT                   /product="thrombospondin 4"
FT                   /note="gene_id=mCG114974.1 transcript_id=mCT116072.0
FT                   protein_id=mCP51771.1"
FT                   /db_xref="GOA:B2RTL6"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR008859"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017897"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR024665"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="MGI:MGI:1101779"
FT                   /db_xref="UniProtKB/TrEMBL:B2RTL6"
FT                   /protein_id="EDL00951.1"
FT                   /translation="MPAPRAAAAAFLLLHLVLQPWQRTSAQATPQVFDLLPSSSQRLNP
FT                   SALQPVLTDPTLHEVYLISTFKLQSKSSATIFGLYSSSDNSKYFEFTVMGRLNKAILRY
FT                   LKNDGKIHLVVFNNLQLADGRRHRVLLRLSNLQRGDGSVELYLDCAQADSVRNLPRAFS
FT                   GLTQNPESIELRTFQRKPQDFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATSTGDFN
FT                   RQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVPIAP
FT                   PAPPTRPTRHCDSSPCFRGVRCTDTRDGFQCGPCPDGYTGNGITCSDVDECKYHPCYPG
FT                   VRCVNLAPGFRCDACPVGFTGPMVQGVGINFAKTNKQVCTDVDECQNGACVLNSICINT
FT                   LGSYRCGPCKPGYTGDQTRGCKTERSCRNPEQNPCSVHAQCIEERQGDVTCVCGVGWAG
FT                   DGYVCGKDVDIDSYPDEELPCSARNCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDG
FT                   ILNEQDNCVLTHNIDQRNSDKDIFGDACDNCRMVLNNDQKDTDGDGRGDACDDDMDGDG
FT                   IKNILDNCPRVPNRDQQDRDGDDVGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDG
FT                   DGHQDSTDNCPTVINSSQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQE
FT                   DSNNDGVGDICEADFDQDQVIDHIDVCPENAEITLTDFRAYQTVVLDPEGDAQIDPNWV
FT                   VLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYV
FT                   VMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKD
FT                   SRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQ
FT                   ENIIWSNLKYRCNDTIPEDFQEFQTQSFDRLDN"
FT   assembly_gap    5592331..5592350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5595103..5595169
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    5596278..5596317
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    5602994..5603911
FT                   /estimated_length=918
FT                   /gap_type="unknown"
FT   assembly_gap    5608575..5608594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5625062..5629083
FT                   /estimated_length=4022
FT                   /gap_type="unknown"
FT   gene            5634011..5638389
FT                   /locus_tag="mCG_114980"
FT                   /note="gene_id=mCG114980.1"
FT   mRNA            join(5634011..5634950,5636114..5636206,5636791..5636973,
FT                   5637070..5637665)
FT                   /locus_tag="mCG_114980"
FT                   /product="mCG114980, transcript variant mCT180640"
FT                   /note="gene_id=mCG114980.1 transcript_id=mCT180640.0
FT                   created on 20-FEB-2003"
FT   mRNA            join(<5634040..5634120,5634459..5634528,5634874..5634950,
FT                   5636114..5636206,5636791..5636973,5637070..5637146,
FT                   5638171..5638389)
FT                   /locus_tag="mCG_114980"
FT                   /product="mCG114980, transcript variant mCT116078"
FT                   /note="gene_id=mCG114980.1 transcript_id=mCT116078.1
FT                   created on 20-FEB-2003"
FT   CDS             join(5634040..5634120,5634459..5634528,5634874..5634950,
FT                   5636114..5636206,5636791..5636973,5637070..5637146,
FT                   5638171..5638375)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114980"
FT                   /product="mCG114980, isoform CRA_a"
FT                   /note="gene_id=mCG114980.1 transcript_id=mCT116078.1
FT                   protein_id=mCP51849.1 isoform=CRA_a"
FT                   /protein_id="EDL00949.1"
FT                   /translation="MAAPMELSCWGGGWGLPSVHSESLVVLAYAKFSGAPLKINIIDNT
FT                   WRGSRGDVPILTTEDSIVSKPAKILNFLRKQKYNADCELSAKQGADTLAYIALLEEKLL
FT                   PAVLHTFWVENENYFTVTKPWFASRIPFPLSLILPGRMSRGALNRILLTRGEPPLYHVQ
FT                   EVEAQIYRDARECLNLLSNRLGTSQFFFGDTPSTLDAYVFGFLAPLYKVSFPKVHLQKH
FT                   LKQLCNLCRFCDDILDSYFRPGPGGESAFHQLMLIQIVS"
FT   CDS             5634040..5634375
FT                   /codon_start=1
FT                   /locus_tag="mCG_114980"
FT                   /product="mCG114980, isoform CRA_b"
FT                   /note="gene_id=mCG114980.1 transcript_id=mCT180640.0
FT                   protein_id=mCP103562.0 isoform=CRA_b"
FT                   /protein_id="EDL00950.1"
FT                   /translation="MAAPMELSCWGGGWGLPSVHSESLVVLVRPPRGPGRGRTGLASRG
FT                   LRWRPAGRLQASGPGGPAALFLQLEKHTRGPATSGPASCIRGPQERGACASPTADGGGA
FT                   WAASGCL"
FT   assembly_gap    5661970..5664269
FT                   /estimated_length=2300
FT                   /gap_type="unknown"
FT   assembly_gap    5667681..5667932
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    5669786..5669805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5672426..5672445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5677732..5683661
FT                   /estimated_length=5930
FT                   /gap_type="unknown"
FT   assembly_gap    5684716..5684735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5690808..5691291
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   gene            <5692578..5702553
FT                   /locus_tag="mCG_1047209"
FT                   /note="gene_id=mCG1047209.1"
FT   mRNA            join(<5692578..5692608,5693712..5693913,5702374..5702553)
FT                   /locus_tag="mCG_1047209"
FT                   /product="mCG1047209"
FT                   /note="gene_id=mCG1047209.1 transcript_id=mCT164913.0
FT                   created on 20-FEB-2003"
FT   CDS             join(<5693796..5693913,5702374..5702501)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047209"
FT                   /product="mCG1047209"
FT                   /note="gene_id=mCG1047209.1 transcript_id=mCT164913.0
FT                   protein_id=mCP51965.0"
FT                   /protein_id="EDL00948.1"
FT                   /translation="TICPSFFPGCRFIRGVLQIPQLLVSPLITHIRTMGRFSNGYLKQP
FT                   HKSVCQRPRSRTGPLEALLDLTLAHTDSLRGFRGFG"
FT   assembly_gap    5729271..5729525
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    5753327..5753346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5763682..5763701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5764784..5764803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5770767..5770786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5774355..5774374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5775620..5775639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5777279..5777298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5786236..5786370
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    5796880..5796899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5798741..5799561
FT                   /estimated_length=821
FT                   /gap_type="unknown"
FT   assembly_gap    5825745..5825910
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    5840084..5840103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5841961..5900744)
FT                   /locus_tag="mCG_114979"
FT                   /note="gene_id=mCG114979.1"
FT   mRNA            complement(join(5841961..5842807,5847115..5847288,
FT                   5850124..5850223,5851379..5851512,5864727..5864810,
FT                   5865779..5865926,5871633..5871774,5885448..5885681,
FT                   5886842..5886937,5891860..5892707,5892906..5900744))
FT                   /locus_tag="mCG_114979"
FT                   /product="mCG114979"
FT                   /note="gene_id=mCG114979.1 transcript_id=mCT116077.0
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(5842561..5842807,5847115..5847288,
FT                   5850124..5850223,5851379..5851512,5864727..5864810,
FT                   5865779..5865926,5871633..5871774,5885448..5885681,
FT                   5886842..5886937,5891860..5892707,5892906..5900676))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114979"
FT                   /product="mCG114979"
FT                   /note="gene_id=mCG114979.1 transcript_id=mCT116077.0
FT                   protein_id=mCP51844.1"
FT                   /protein_id="EDL00945.1"
FT                   /translation="MVAVQREDSGITWETNSSRSSTPWASGESQTSGICSLEGSALTSP
FT                   PGSVSFIMDEVKRTRKRTQKSKRGSPSLRRKGSKKRNSLESQDVLTNQEDGPSISESPV
FT                   LNIENEKSSIGTYDKTRRKKTASNTPPITGAIYKEHKPLVLKPVYIGTVQYKIKMFNSV
FT                   KEELIPLQFYGTLPKGYVIKEIHYRRGKDSSISLEPDLSNGGSNIVPQRKFAQSPEEDK
FT                   VRELAPPWRGTLSKGSRTSLFSHEEQKKTYADSYLNVPSSTEHAFPSSARNDTADQEEN
FT                   LSLPQMMPQQPADESKTHRMEPPSTPATMVLERAKEELEQNAQGKESSEDDASVLTGSA
FT                   DDVQQEGLVSVNHSMPWEAEKESLETGPPRPAPAIQEKFEPDMEGLEPISTEKTEQASE
FT                   YVTSSEPIVYREEEHAPEPIVHREEEHAPEPIVHREEEHAPEPIVHREEEHAPESIVHR
FT                   EEEHAPESIVQREEEHAPEPESIVHREEEHAPGPVPIVHREEEHVPELESIVHRGEEHA
FT                   PEPIVHRDEGHAPEPIVHREEEHVPEPIVHRDEGHAPEPIVHREEEHVPEPESIVHREE
FT                   EHAPEPMVLRKAQLERGVETSTPITDTTEPEDSSLEEEIIELDYPESPLASKETSPSPL
FT                   SPEVEHRKEPILPTQMTFTPERITLSEEEREENESVSTDSAFVSEYSVLQDLNHTPEKL
FT                   EVEAVSVSDVKSSNEPAVFSEDDEERESYSPAMTSVSEQSLSPSTTEKTSAIQSPLFST
FT                   VSPVLSGDEASENVCHSPESESAAEYSVPAHAQELLLKTGDHKLPLKSQRVSEPIIQAE
FT                   DEKEDIGLLPPAALSQAVLSEDESLGSGSFASDSKLPFKPSVSQNATRESPQKTIDDMP
FT                   QFKPRGLSDPATLLEEEKEAIGVGLSSSNEVSAVECALPPQTTELLSESHAPPPWAISS
FT                   EQVVQSEEGSRDQQRGSFSSTPELGHTSLLLKGASSPTGLSEQGQEEDNIGPLSPDSAF
FT                   ASEFSFSPYPTQELEKRELGRDSPLCLTSPSEQTVLSEEDTEEADLFSPDSASQVSIPP
FT                   YRIAETEQNKVEPDELLPTRSAPDYPYFSEADEEEAGSSVVTPVPEHSEPSQEREESSP
FT                   CRPVFEDLSLPPSADKTGQAETMSDVPTISTSVSEYLILARQAKTQASLEPEAEDLVPP
FT                   PTSGWEKRDAKSSLPAVTIAASSSALSSVVKEETTSVLPTSQPSVSPESTCVLKPEQEP
FT                   TAPLTLTSADEQMALPRVGREKAVLDSQEATAHKSQDQTPEPRLPNVPGSGMKYSVLSD
FT                   LGDEPKADVKLNLAPTVTSELEQRMLSKNEPEVAKPHSPPEETSISGPKVLSAVKTEVK
FT                   QESKITRELPAASSGRERGAEHSPPVPPALPALTEETGKDTEASSSATTVPVTKLDSNS
FT                   TKLGRDEVLTDPSLASPVEHPGLKGIGKSELGSGLPLPSMSASEVLRPEPKLPVNSGVE
FT                   VEREDNEPPPLQVSPTSKPTVPNDKHEEITRSPDSENLVSDDLAPTLLAFRHEMNRQAE
FT                   ETSSPVPGSFLSGEQELIKLPPEPEKHKQLSEVPTAGSELIDSRDRDRSLGIEPVKPIG
FT                   TEPGPSILEKGPAELQRRGKEQEENRKLPVPASAPLETASFDLPIEQKEPKRTLHEGQA
FT                   VEVPDESSSSADKPELGVKQLAEKKENLEQPKPFVTTERASVTGSKVKESLISPKDNIW
FT                   MLEKPDGLVNQHEDRKPGTGQLESSESTDLMSEKLGAASLDTDHTSETRNQETSKAPVS
FT                   GEKLSQEPRRVQSKAVDDSEEGRKLASGNVEVLTQSKSVPAVKAKATPQPPETPEVTQK
FT                   PSEKSLVTEQGLPAEKGKKGISSFKSWMSSLLFGSSIPDSKVSDNEDLETRPGPSVEKA
FT                   VPAIEPKGTVPAEVNIAEKPAVHSLPEVTVKLAEEPKGVSVKSSISQDLKEKLTFLSNE
FT                   DVLKQPKSNSENYGQKELPGFSEGMGESLATSVGDKHPGIHPCSPMGEKVGMEEAQNMA
FT                   PLHITESQRRQKPEVSPPSMWNISARKEEPSSDHKETWLSSSDVVDRMPQKPKSAQSAF
FT                   TRMNSEEPASMILPVESKGSLSDLGEDRLRQEMPKPTSLEHCEEEVERPTEEKDGWETR
FT                   SFSLAGKRGLAEKQEIMAPLELRENEAVGELQRMPESRPFKLEESKAAERLEQRISPTE
FT                   KLMEKPSKTLALDRREKEVQEWVFSEGEKQEYPPAAMPVPGASAVSLDKAQPHLLAKPT
FT                   PVVEKPEHIVTEVYPEIRERKAAETQPHPQEEGKTLVEKTKVSRVESPHGEETDGHSLT
FT                   QEGNLELEKSGESRVDLKEERRRFVMPELPLGASVAAEDGSVQPRPLSKDAARASDMTD
FT                   ETKHLGTPPTQPSAVEPQTLVLGTSVEHAVKKQETWSDRPTVHTFQTSKDDTEEMLKQS
FT                   VLISKHHLEAVEDVHRNEPPSSAASNYAQFMLSASEISADGVPPMGGTAQEPEGTSVKD
FT                   EEFSVTSKPAGLSEDQKSAFSIISEGCEILNIHAPAFIPSVDQEESEQMQDKLQYLEEK
FT                   ASFKSISVHDEKKAAASHKTQKSKLEVPDRKITSLKENKTKETHKTKEEIATDSGMGDF
FT                   TPIQPTVSEKDDSKLSHAEMQKSLAIQKPDDRNAPKGISRDVDSRSPGMPLFDVEEGVL
FT                   SKRQIFPTTPKAVNPELLEEPPALSFFYKDLYEGACGEKNEGETASEGDSVDSETSFPR
FT                   RHSDTDDGPGMYFEKYILKDDILHDESVTQEDQGQGLEEKPVGEEDSQQLRVAEREIRR
FT                   KPETSFWEKNLEEQHKVVGREGEPTGHMETLDEAAMQQKAPITEQVRAVTQKMSYAVPF
FT                   QDTRCVLESEPSSQGNEAGNASPDVNLNVPVQVSFPEEESAAGATYAPEVLQERLVQLG
FT                   EFLENLQEKSLRIEAFVSEIESFFNTIEEKCSKNEKRLEMQNEEMMKRVLAQYDEKAQS
FT                   FEEVKKKKMEFLHDQMVHFLQSMDTAKDTLETIVREAEELDETVFLAPPRLEPQEPSSA
FT                   TSTTIAVYWSVNKEDVVDSFQVYCVEEPQDDQEINAPSTPVIHVEDCTVCWNTATVRWR
FT                   PANPEATETYTLEYCRQHSPEGEGLRWRPANPEATETYTLEYCRQHSPEGEGLRSFSGI
FT                   KGLQLKVNLPPNDNYFFYVRATNASGTSEQSEAALISTRGTRFLLLRETAHPALQISAN
FT                   GTVISFSERRRLTEIPSVLGEELPACGQHYWETTVADSPAYRLGICTSSAVRAGALGQG
FT                   ETSWYMHCSEPQRYTFFYSGIVSEVHATERPARVGILLDYTNQRLLFINAESGQLLFIV
FT                   RHRFNEGVHPAFALEKPGRCTLHLGLEPPDSVRHK"
FT   assembly_gap    5853018..5853348
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    5855827..5856482
FT                   /estimated_length=656
FT                   /gap_type="unknown"
FT   gene            complement(5861427..5863717)
FT                   /locus_tag="mCG_146986"
FT                   /note="gene_id=mCG146986.0"
FT   mRNA            complement(join(5861427..5862233,5862280..5863717))
FT                   /locus_tag="mCG_146986"
FT                   /product="mCG146986"
FT                   /note="gene_id=mCG146986.0 transcript_id=mCT187249.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(5862746..5862904)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146986"
FT                   /product="mCG146986"
FT                   /note="gene_id=mCG146986.0 transcript_id=mCT187249.0
FT                   protein_id=mCP108200.0"
FT                   /protein_id="EDL00947.1"
FT                   /translation="MRKASSQERSACSQGSDVTHLLWHAPPAGIYINHFSTVGYSNQQK
FT                   SENLETQ"
FT   assembly_gap    5865571..5865590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5875623..5877075
FT                   /gene="C920025J10"
FT                   /locus_tag="mCG_144920"
FT                   /note="gene_id=mCG144920.0"
FT   mRNA            join(<5875623..5875816,5875961..5875994,5876392..5877075)
FT                   /gene="C920025J10"
FT                   /locus_tag="mCG_144920"
FT                   /product="hypothetical protein C920025J10"
FT                   /note="gene_id=mCG144920.0 transcript_id=mCT184344.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<5875816..5875816,5875961..5875994,5876392..5876653)
FT                   /codon_start=1
FT                   /gene="C920025J10"
FT                   /locus_tag="mCG_144920"
FT                   /product="hypothetical protein C920025J10"
FT                   /note="gene_id=mCG144920.0 transcript_id=mCT184344.0
FT                   protein_id=mCP105295.0"
FT                   /protein_id="EDL00946.1"
FT                   /translation="GMSVLTPLPSVREKKIPVLKNRIKEEGTFSSIDFISSVPAPAESQ
FT                   SFNGDAPHHRAGATSPALFQSLALNPFSLHASSLSYKKRNKAGKRAAKFRRGK"
FT   assembly_gap    5883457..5883533
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    5888595..5888664
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   gene            <5897149..5901282
FT                   /locus_tag="mCG_145870"
FT                   /note="gene_id=mCG145870.0"
FT   mRNA            join(<5897149..5897480,5898028..5898053,5898169..5898365,
FT                   5898847..5901282)
FT                   /locus_tag="mCG_145870"
FT                   /product="mCG145870"
FT                   /note="gene_id=mCG145870.0 transcript_id=mCT185978.0
FT                   created on 03-JUL-2003"
FT   CDS             <5898910..5899470
FT                   /codon_start=1
FT                   /locus_tag="mCG_145870"
FT                   /product="mCG145870"
FT                   /note="gene_id=mCG145870.0 transcript_id=mCT185978.0
FT                   protein_id=mCP107344.0"
FT                   /protein_id="EDL00944.1"
FT                   /translation="LCLSKNHGFRRMLLLSVDYGLRLRHMLLLSVNYGLRCMPLISVDY
FT                   GLRHMLLLSVDYGLRCMPLISVDYGLRRMLLPSVDYGLKLRHMLLLSVDYGHRPRRMLL
FT                   LSVDYGLRLRRMLLLSLNYGLRRMLLLSVDYGFRRMLLLSVDYGLRRMLLLSVDYGLRR
FT                   MLLLSVDYGLRRMLLLSVDYGLR"
FT   assembly_gap    5913057..5916942
FT                   /estimated_length=3886
FT                   /gap_type="unknown"
FT   assembly_gap    5928241..5928260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5939356..5939409
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   gene            complement(5947901..5993280)
FT                   /gene="Papd4"
FT                   /locus_tag="mCG_114981"
FT                   /note="gene_id=mCG114981.1"
FT   mRNA            complement(join(5947901..5949282,5950499..5950578,
FT                   5952290..5952381,5956531..5956667,5960520..5960563,
FT                   5968899..5969027,5969364..5969440,5972821..5972890,
FT                   5975643..5975721,5976522..5976613,5976701..5976815,
FT                   5985056..5985293,5986790..5986879,5987285..5987458,
FT                   5993033..5993062,5993155..5993280))
FT                   /gene="Papd4"
FT                   /locus_tag="mCG_114981"
FT                   /product="PAP associated domain containing 4, transcript
FT                   variant mCT176662"
FT                   /note="gene_id=mCG114981.1 transcript_id=mCT176662.0
FT                   created on 04-DEC-2002"
FT   mRNA            complement(join(5947901..5949282,5950499..5950578,
FT                   5952290..5952381,5956531..5956667,5960520..5960563,
FT                   5968899..5969027,5969364..5969440,5972821..5972890,
FT                   5975643..5975721,5976522..5976613,5976701..5976815,
FT                   5985056..5985293,5986790..5986879,5987285..5987458,
FT                   5993033..5993222))
FT                   /gene="Papd4"
FT                   /locus_tag="mCG_114981"
FT                   /product="PAP associated domain containing 4, transcript
FT                   variant mCT116079"
FT                   /note="gene_id=mCG114981.1 transcript_id=mCT116079.1
FT                   created on 04-DEC-2002"
FT   CDS             complement(join(5949208..5949282,5950499..5950578,
FT                   5952290..5952381,5956531..5956667,5960520..5960563,
FT                   5968899..5969027,5969364..5969440,5972821..5972890,
FT                   5975643..5975721,5976522..5976613,5976701..5976815,
FT                   5985056..5985293,5986790..5986879,5987285..5987421))
FT                   /codon_start=1
FT                   /gene="Papd4"
FT                   /locus_tag="mCG_114981"
FT                   /product="PAP associated domain containing 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG114981.1 transcript_id=mCT116079.1
FT                   protein_id=mCP51853.1 isoform=CRA_a"
FT                   /protein_id="EDL00941.1"
FT                   /translation="MFPNSILGRPPFTPTHQQHNNFFALSPTLYSHQQLIDAQFNFQNV
FT                   DLSRAVSLQPLTYGTVSPIQTSTSPLFRGRKRISDEKAFPLDGKRQRFHSPHQEPTIIN
FT                   QLVPLSGDRRYSMPPLFHTHYIPDIVRCVPPLREIPLLEPREITLPEAKDKLSQQILEL
FT                   FETCQQQASDLKKKELCRAQLQREIQLLFPQSRLFLVGSSLNGFGARSSDGDLCLVVKE
FT                   EPCFFQVNQKTEARHILTLVHKHFCTRLSGYIERPQLIRAKVPIVKFRDKVSCVEFDLN
FT                   VNNTVGIRNTFLLRTYAYLENRVRPLVLVIKKWASHHDINDASRGTLSSYSLVLMVLHY
FT                   LQTLPEPILPSLQKIYPESFSTSVQLHLVHHAPCNVPPYLSKNESSLGDLLLGFLKYYA
FT                   TEFDWNTQMISVREAKAIPRPDDMEWRNKYICVEEPFDGTNTARAVHEKQKFDMIKDQF
FT                   LKSWQRLKNKRDLNSVLPLRAATLKR"
FT   CDS             complement(join(5949208..5949282,5950499..5950578,
FT                   5952290..5952381,5956531..5956667,5960520..5960563,
FT                   5968899..5969027,5969364..5969440,5972821..5972890,
FT                   5975643..5975721,5976522..5976613,5976701..5976815,
FT                   5985056..5985293,5986790..5986879,5987285..5987421))
FT                   /codon_start=1
FT                   /gene="Papd4"
FT                   /locus_tag="mCG_114981"
FT                   /product="PAP associated domain containing 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG114981.1 transcript_id=mCT176662.0
FT                   protein_id=mCP99584.0 isoform=CRA_a"
FT                   /protein_id="EDL00942.1"
FT                   /translation="MFPNSILGRPPFTPTHQQHNNFFALSPTLYSHQQLIDAQFNFQNV
FT                   DLSRAVSLQPLTYGTVSPIQTSTSPLFRGRKRISDEKAFPLDGKRQRFHSPHQEPTIIN
FT                   QLVPLSGDRRYSMPPLFHTHYIPDIVRCVPPLREIPLLEPREITLPEAKDKLSQQILEL
FT                   FETCQQQASDLKKKELCRAQLQREIQLLFPQSRLFLVGSSLNGFGARSSDGDLCLVVKE
FT                   EPCFFQVNQKTEARHILTLVHKHFCTRLSGYIERPQLIRAKVPIVKFRDKVSCVEFDLN
FT                   VNNTVGIRNTFLLRTYAYLENRVRPLVLVIKKWASHHDINDASRGTLSSYSLVLMVLHY
FT                   LQTLPEPILPSLQKIYPESFSTSVQLHLVHHAPCNVPPYLSKNESSLGDLLLGFLKYYA
FT                   TEFDWNTQMISVREAKAIPRPDDMEWRNKYICVEEPFDGTNTARAVHEKQKFDMIKDQF
FT                   LKSWQRLKNKRDLNSVLPLRAATLKR"
FT   assembly_gap    5958908..5959751
FT                   /estimated_length=844
FT                   /gap_type="unknown"
FT   gene            complement(5964680..5967154)
FT                   /locus_tag="mCG_146985"
FT                   /note="gene_id=mCG146985.0"
FT   mRNA            complement(join(5964680..5965448,5965560..5967154))
FT                   /locus_tag="mCG_146985"
FT                   /product="mCG146985"
FT                   /note="gene_id=mCG146985.0 transcript_id=mCT187248.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    5965468..5965556
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   CDS             complement(5966025..5966180)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146985"
FT                   /product="mCG146985"
FT                   /note="gene_id=mCG146985.0 transcript_id=mCT187248.0
FT                   protein_id=mCP108199.0"
FT                   /protein_id="EDL00943.1"
FT                   /translation="MFLGLAIIVFFFFFPEDRVSLCSPGCPGTHFVDHAGLKLEIRLPL
FT                   PPEYWD"
FT   assembly_gap    5994032..5994051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6020733..6020752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6024215..6024257
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    6033820..6034257
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    6036347..6036503
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    6041505..6041524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6050027..6050046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6052124..6052239
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    6061143..6061162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6062577..6062596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6077179..6079334
FT                   /estimated_length=2156
FT                   /gap_type="unknown"
FT   gene            6089813..6091028
FT                   /pseudo
FT                   /locus_tag="mCG_114976"
FT                   /note="gene_id=mCG114976.1"
FT   mRNA            6089813..6091028
FT                   /pseudo
FT                   /locus_tag="mCG_114976"
FT                   /note="gene_id=mCG114976.1 transcript_id=mCT116074.1
FT                   created on 19-FEB-2003"
FT   assembly_gap    6100034..6100457
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   gene            6100823..6200059
FT                   /gene="Homer1"
FT                   /locus_tag="mCG_114977"
FT                   /note="gene_id=mCG114977.1"
FT   mRNA            join(6100823..6101326,6137565..6137721,6142378..6142509,
FT                   6145014..6145106,6151748..6151887,6182119..6182154,
FT                   6183298..6183454,6187473..6187583,6188958..6189038,
FT                   6197971..6198228)
FT                   /gene="Homer1"
FT                   /locus_tag="mCG_114977"
FT                   /product="homer homolog 1 (Drosophila), transcript variant
FT                   mCT176660"
FT                   /note="gene_id=mCG114977.1 transcript_id=mCT176660.0
FT                   created on 03-DEC-2002"
FT   mRNA            join(6101082..6101326,6137565..6137721,6142378..6142509,
FT                   6145014..6145106,6151748..6152266)
FT                   /gene="Homer1"
FT                   /locus_tag="mCG_114977"
FT                   /product="homer homolog 1 (Drosophila), transcript variant
FT                   mCT116075"
FT                   /note="gene_id=mCG114977.1 transcript_id=mCT116075.0
FT                   created on 03-DEC-2002"
FT   mRNA            join(<6101183..6101326,6137565..6137721,6142378..6142509,
FT                   6145014..6145106,6151748..6151887,6183298..6183454,
FT                   6187473..6187583,6188958..6189038,6197971..6198342)
FT                   /gene="Homer1"
FT                   /locus_tag="mCG_114977"
FT                   /product="homer homolog 1 (Drosophila), transcript variant
FT                   mCT189356"
FT                   /note="gene_id=mCG114977.1 transcript_id=mCT189356.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<6101286..6101326,6137565..6137721,6142378..6142509,
FT                   6145014..6145106,6151748..6151887,6183298..6183454,
FT                   6187473..6187583,6188958..6189038,6197971..6198159)
FT                   /codon_start=1
FT                   /gene="Homer1"
FT                   /locus_tag="mCG_114977"
FT                   /product="homer homolog 1 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG114977.1 transcript_id=mCT189356.0
FT                   protein_id=mCP110343.0 isoform=CRA_c"
FT                   /protein_id="EDL00939.1"
FT                   /translation="EQKLQSKFSLGKMGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVT
FT                   VSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSS
FT                   EHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDE
FT                   RTPDVTQNSEPRAEPTQNALPFPHSSAISKHWEAELATLKGNNAKLTAALLESTANVKQ
FT                   WKQQLAAYQEEAERLHKRVTELECVSSQANAVHSHKTELNQTVQELEETLKVKEEEIER
FT                   LKQEIDNARELQEQRDSLTQKLQEVEIRNKDLEGQLSDLEQRLEKSQNEQEAFRSNLKT
FT                   LLEILDGKIFELTELRDNLAKLLECS"
FT   CDS             join(6101322..6101326,6137565..6137721,6142378..6142509,
FT                   6145014..6145106,6151748..6151887,6182119..6182154,
FT                   6183298..6183454,6187473..6187583,6188958..6189038,
FT                   6197971..6198159)
FT                   /codon_start=1
FT                   /gene="Homer1"
FT                   /locus_tag="mCG_114977"
FT                   /product="homer homolog 1 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG114977.1 transcript_id=mCT176660.0
FT                   protein_id=mCP99582.0 isoform=CRA_b"
FT                   /protein_id="EDL00938.1"
FT                   /translation="MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVY
FT                   RIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQ
FT                   EFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPR
FT                   AEPTQNALPFPHSAGDRTQALSHASSAISKHWEAELATLKGNNAKLTAALLESTANVKQ
FT                   WKQQLAAYQEEAERLHKRVTELECVSSQANAVHSHKTELNQTVQELEETLKVKEEEIER
FT                   LKQEIDNARELQEQRDSLTQKLQEVEIRNKDLEGQLSDLEQRLEKSQNEQEAFRSNLKT
FT                   LLEILDGKIFELTELRDNLAKLLECS"
FT   CDS             join(6101322..6101326,6137565..6137721,6142378..6142509,
FT                   6145014..6145106,6151748..6151921)
FT                   /codon_start=1
FT                   /gene="Homer1"
FT                   /locus_tag="mCG_114977"
FT                   /product="homer homolog 1 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG114977.1 transcript_id=mCT116075.0
FT                   protein_id=mCP51899.1 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR000697"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1347345"
FT                   /db_xref="UniProtKB/TrEMBL:Q5D052"
FT                   /protein_id="EDL00937.1"
FT                   /translation="MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVY
FT                   RIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQ
FT                   EFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPR
FT                   AEPTQNALPFPHRYTFNSAIMIK"
FT   mRNA            join(6104060..6104386,6137565..6137721,6142378..6142509,
FT                   6145014..6145106,6151748..6151887,6183298..6183454,
FT                   6187473..6187583,6188958..6189038,6197971..6200059)
FT                   /gene="Homer1"
FT                   /locus_tag="mCG_114977"
FT                   /product="homer homolog 1 (Drosophila), transcript variant
FT                   mCT176661"
FT                   /note="gene_id=mCG114977.1 transcript_id=mCT176661.0
FT                   created on 03-DEC-2002"
FT   CDS             join(6104334..6104386,6137565..6137721,6142378..6142509,
FT                   6145014..6145106,6151748..6151887,6183298..6183454,
FT                   6187473..6187583,6188958..6189038,6197971..6198159)
FT                   /codon_start=1
FT                   /gene="Homer1"
FT                   /locus_tag="mCG_114977"
FT                   /product="homer homolog 1 (Drosophila), isoform CRA_d"
FT                   /note="gene_id=mCG114977.1 transcript_id=mCT176661.0
FT                   protein_id=mCP99583.0 isoform=CRA_d"
FT                   /protein_id="EDL00940.1"
FT                   /translation="MLIHHHNRRALCKGSPTTEQPIFSTRAHVFQIDPNTKKNWVPTSK
FT                   HAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGL
FT                   GFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESING
FT                   TDDERTPDVTQNSEPRAEPTQNALPFPHSSAISKHWEAELATLKGNNAKLTAALLESTA
FT                   NVKQWKQQLAAYQEEAERLHKRVTELECVSSQANAVHSHKTELNQTVQELEETLKVKEE
FT                   EIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKDLEGQLSDLEQRLEKSQNEQEAFRS
FT                   NLKTLLEILDGKIFELTELRDNLAKLLECS"
FT   assembly_gap    6136421..6137294
FT                   /estimated_length=874
FT                   /gap_type="unknown"
FT   assembly_gap    6153983..6154002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6188834..6188853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6230834..6293363)
FT                   /gene="Jmy"
FT                   /locus_tag="mCG_114973"
FT                   /note="gene_id=mCG114973.1"
FT   mRNA            complement(join(6230834..6231326,6235352..6235662,
FT                   6237140..6237357,6237632..6237982,6238947..6239042,
FT                   6249168..6249254,6249749..6249936,6250289..6250454,
FT                   6255996..6256165,6260943..6261093,6268997..6269170,
FT                   6292233..6293363))
FT                   /gene="Jmy"
FT                   /locus_tag="mCG_114973"
FT                   /product="junction-mediating and regulatory protein"
FT                   /note="gene_id=mCG114973.1 transcript_id=mCT116071.0
FT                   created on 03-DEC-2002"
FT   assembly_gap    6236101..6236567
FT                   /estimated_length=467
FT                   /gap_type="unknown"
FT   assembly_gap    6237612..6237631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(6237710..6237982,6238947..6239042,
FT                   6249168..6249254,6249749..6249936,6250289..6250454,
FT                   6255996..6256165,6260943..6261093,6268997..6269170,
FT                   6292233..6293237))
FT                   /codon_start=1
FT                   /gene="Jmy"
FT                   /locus_tag="mCG_114973"
FT                   /product="junction-mediating and regulatory protein"
FT                   /note="gene_id=mCG114973.1 transcript_id=mCT116071.0
FT                   protein_id=mCP51757.1"
FT                   /protein_id="EDL00936.1"
FT                   /translation="MSFALEETLESDWVAVRPHVFDEREKHKFVFIVAWNEIEGKFAIT
FT                   CHNRTAQRQRSGSREQAGTPASDGSRGPGSPAARGRSEAAASATAALRSPGPRKSQAWA
FT                   EGGSPRSARSLKGDPPRGPAGRGPESPLRSPARAKASPLRRSAESRDATASATPAPPAP
FT                   PVPPVSSVRVVSASGAVSEEIEVLEMVREDEAPQPLPDSEQPPSAAELESPAEECSWAG
FT                   LFSFQDLRAVHQQLCSVNSQLEPCLPVFPEEPSGMWTVLFGGAPEMTEQEIDALCYQLQ
FT                   VYLGHGLDTCGWKILSQVLFTETDDPEEYYESLSELRQKGYEEVLQRARRRIQELLDKH
FT                   KTIESMVELLDLYQMEDEAYSSLAEATTELYQYLLQPFRDMRELAMLRRQQIKISMEND
FT                   YLGPRRIESLQKEDADWQRKAHMAVLSIQDLTVKYFEITAKAQKAVYDRMRADQKKFGK
FT                   ASWAAAAERMEKLQYAVSKETLQMMRAKEICLEQKKHALKEEMQSLQGGTEAIARLDQL
FT                   ESDYYDLQLQLYEVQFEILKCEELLLTAQLESIKRLISEKRDEVVYYDTYESMEAMLEK
FT                   EEMAASVHAQREELQKLQQKARQLEARRGRVSAKKAYLRNKKEICIAKHHEKFQQRFQS
FT                   EDEYRAHHTIQIKRDKLHDEEERKSAWVSQERQRTLDRLRTFKQRYPGQVILKSTRLRV
FT                   AHSRRKSTASPVPCEEQCHSLPTVLQGQEKTEVGGGGSQLGPSQTAEPQSLVQLEDTSS
FT                   EQLESTSLPSSCCRQL"
FT   gene            6244779..6245246
FT                   /pseudo
FT                   /locus_tag="mCG_114975"
FT                   /note="gene_id=mCG114975.1"
FT   mRNA            6244779..6245246
FT                   /pseudo
FT                   /locus_tag="mCG_114975"
FT                   /note="gene_id=mCG114975.1 transcript_id=mCT116073.0
FT                   created on 19-FEB-2003"
FT   assembly_gap    6301484..6301503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6308980..6310282
FT                   /estimated_length=1303
FT                   /gap_type="unknown"
FT   assembly_gap    6312736..6312755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6316285..6316304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6317495..6317514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6329009..6329028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6330410..6330429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6334805..6336515
FT                   /estimated_length=1711
FT                   /gap_type="unknown"
FT   assembly_gap    6379809..6379828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6391906..6422884
FT                   /locus_tag="mCG_1050921"
FT                   /note="gene_id=mCG1050921.0"
FT   mRNA            join(6391906..6391963,6419087..6419199,6421535..6422884)
FT                   /locus_tag="mCG_1050921"
FT                   /product="mCG1050921"
FT                   /note="gene_id=mCG1050921.0 transcript_id=mCT194710.0
FT                   created on 27-JAN-2005"
FT   assembly_gap    6408663..6408791
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    6409791..6410342
FT                   /estimated_length=552
FT                   /gap_type="unknown"
FT   gene            complement(6410376..6432212)
FT                   /locus_tag="mCG_114098"
FT                   /note="gene_id=mCG114098.1"
FT   mRNA            complement(join(6410376..6411361,6413784..6414012,
FT                   6415096..6415186,6421546..6421614,6427482..6427614,
FT                   6431715..6432212))
FT                   /locus_tag="mCG_114098"
FT                   /product="mCG114098, transcript variant mCT176309"
FT                   /note="gene_id=mCG114098.1 transcript_id=mCT176309.0
FT                   created on 27-NOV-2002"
FT   mRNA            complement(join(6410590..6411361,6413784..6414012,
FT                   6415096..6415278,6418516..6418663,6418999..6419190,
FT                   6420950..6421068,6427482..6427614,6431715..6432212))
FT                   /locus_tag="mCG_114098"
FT                   /product="mCG114098, transcript variant mCT115189"
FT                   /note="gene_id=mCG114098.1 transcript_id=mCT115189.1
FT                   created on 27-NOV-2002"
FT   mRNA            complement(join(6410590..6411114,6411241..6411361,
FT                   6420946..6421068,6427482..6427614,6431715..6432212))
FT                   /locus_tag="mCG_114098"
FT                   /product="mCG114098, transcript variant mCT176308"
FT                   /note="gene_id=mCG114098.1 transcript_id=mCT176308.0
FT                   created on 27-NOV-2002"
FT   mRNA            complement(join(6410602..6411361,6413784..6414012,
FT                   6415096..6415278,6418516..6418663,6418999..6419190,
FT                   6420950..6420998,6421546..6421614,6427482..6427614,
FT                   6431715..6432212))
FT                   /locus_tag="mCG_114098"
FT                   /product="mCG114098, transcript variant mCT176307"
FT                   /note="gene_id=mCG114098.1 transcript_id=mCT176307.0
FT                   created on 27-NOV-2002"
FT   CDS             complement(join(6411175..6411361,6413784..6414012,
FT                   6415096..6415278,6418516..6418663,6418999..6419190,
FT                   6420950..6421068,6427482..6427614,6431715..6431747))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114098"
FT                   /product="mCG114098, isoform CRA_a"
FT                   /note="gene_id=mCG114098.1 transcript_id=mCT115189.1
FT                   protein_id=mCP51681.1 isoform=CRA_a"
FT                   /protein_id="EDL00931.1"
FT                   /translation="MAPVAGKKAKKGILERLNAGEVVIGDGGFVFALEKRGYVKAGPWT
FT                   PEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVAEKISGQKVNEAAC
FT                   DIARQVADEGDALVAGGVSQTPSYLSCKSEVEVKKIFRQQLEVFMKKNVDFLIAEYFEH
FT                   VEEAVWAVEALKASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIVGVNCHFDPS
FT                   VSLQTVKLMKEGLEAARLKAYLMSQPLAYHTPDCGKQGFIDLPEFPFGLEPRVATRWDI
FT                   QKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTK
FT                   PWIRARARKEYWQNLRIASGRPYNPSMSRPDAWGVTKGAAELMQQKEATTEQQLRELFE
FT                   KQKFKSAQ"
FT   CDS             complement(join(6411175..6411361,6413784..6414012,
FT                   6415096..6415186,6421546..6421551))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114098"
FT                   /product="mCG114098, isoform CRA_c"
FT                   /note="gene_id=mCG114098.1 transcript_id=mCT176309.0
FT                   protein_id=mCP99229.0 isoform=CRA_c"
FT                   /protein_id="EDL00933.1"
FT                   /translation="MQLKAYLMSQPLAYHTPDCGKQGFIDLPEFPFGLEPRVATRWDIQ
FT                   KYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKP
FT                   WIRARARKEYWQNLRIASGRPYNPSMSRPDAWGVTKGAAELMQQKEATTEQQLRELFEK
FT                   QKFKSAQ"
FT   CDS             complement(join(6411175..6411361,6413784..6414012,
FT                   6415096..6415278,6418516..6418663,6418999..6419031))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114098"
FT                   /product="mCG114098, isoform CRA_b"
FT                   /note="gene_id=mCG114098.1 transcript_id=mCT176307.0
FT                   protein_id=mCP99230.0 isoform=CRA_b"
FT                   /protein_id="EDL00932.1"
FT                   /translation="MKKNVDFLIAEYFEHVEEAVWAVEALKASGKPVAATMCIGPEGDL
FT                   HGVPPGECAVRLVKAGASIVGVNCHFDPSVSLQTVKLMKEGLEAARLKAYLMSQPLAYH
FT                   TPDCGKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIA
FT                   EELAPERGFLPPASEKHGSWGSGLDMHTKPWIRARARKEYWQNLRIASGRPYNPSMSRP
FT                   DAWGVTKGAAELMQQKEATTEQQLRELFEKQKFKSAQ"
FT   CDS             complement(join(6411327..6411361,6420946..6421068,
FT                   6427482..6427614,6431715..6431747))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114098"
FT                   /product="mCG114098, isoform CRA_d"
FT                   /note="gene_id=mCG114098.1 transcript_id=mCT176308.0
FT                   protein_id=mCP99231.0 isoform=CRA_d"
FT                   /protein_id="EDL00934.1"
FT                   /translation="MAPVAGKKAKKGILERLNAGEVVIGDGGFVFALEKRGYVKAGPWT
FT                   PEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVAEKISVRPERNTGR
FT                   ICE"
FT   assembly_gap    6421498..6421517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             6422162..6422272
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050921"
FT                   /product="mCG1050921"
FT                   /note="gene_id=mCG1050921.0 transcript_id=mCT194710.0
FT                   protein_id=mCP115739.0"
FT                   /protein_id="EDL00935.1"
FT                   /translation="MSCSLMGREAIGPQAEGFQVLTGWRRGRAVPAVEQP"
FT   gene            complement(6450493..6468534)
FT                   /gene="Bhmt2"
FT                   /locus_tag="mCG_114097"
FT                   /note="gene_id=mCG114097.1"
FT   mRNA            complement(join(6450493..6451377,6456506..6456734,
FT                   6457350..6457532,6457878..6458025,6460779..6460970,
FT                   6463504..6463595,6465662..6465794,6468487..6468534))
FT                   /gene="Bhmt2"
FT                   /locus_tag="mCG_114097"
FT                   /product="betaine-homocysteine methyltransferase 2,
FT                   transcript variant mCT115188"
FT                   /note="gene_id=mCG114097.1 transcript_id=mCT115188.0
FT                   created on 27-NOV-2002"
FT   mRNA            complement(join(6450493..6451377,6456506..6456734,
FT                   6457350..6457373,6460800..6460894,6466729..6466761))
FT                   /gene="Bhmt2"
FT                   /locus_tag="mCG_114097"
FT                   /product="betaine-homocysteine methyltransferase 2,
FT                   transcript variant mCT176306"
FT                   /note="gene_id=mCG114097.1 transcript_id=mCT176306.0
FT                   created on 27-NOV-2002"
FT   CDS             complement(join(6451296..6451377,6456506..6456734,
FT                   6457350..6457532,6457878..6458025,6460779..6460970,
FT                   6463504..6463595,6465662..6465794,6468487..6468519))
FT                   /codon_start=1
FT                   /gene="Bhmt2"
FT                   /locus_tag="mCG_114097"
FT                   /product="betaine-homocysteine methyltransferase 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG114097.1 transcript_id=mCT115188.0
FT                   protein_id=mCP51677.1 isoform=CRA_a"
FT                   /protein_id="EDL00929.1"
FT                   /translation="MAPAGSTRAKKGILERLDSGEVVVGDGGFLFTLEKRGFVKAGLWT
FT                   PEAVVEHPSAVRQLHTEFLRAGADVLQTFTFSATEDNMASKWEAVNAAACDLAQEVAGG
FT                   GGALVAGGICQTSLYKYHKDETRIKNIFRLQLEVFARKNVDFLIAEYFEHVEEAVWAVE
FT                   VLREVGAPVAVTMCIGPEGDMHDVTPGECAVKLARAGADIIGVNCRFGPWTSLQTMKLM
FT                   KEGLRDASLQAHLMVQCLGFHTPDCGKGGFVDLPEYPFGLEPRVATRWDIQKYAREAYN
FT                   LGIRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLNMHTKPWIRARARR
FT                   EYWENLLPASGRPFCPSLSKPDA"
FT   CDS             complement(join(6456537..6456734,6457350..6457373,
FT                   6460800..6460894,6466729..6466756))
FT                   /codon_start=1
FT                   /gene="Bhmt2"
FT                   /locus_tag="mCG_114097"
FT                   /product="betaine-homocysteine methyltransferase 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG114097.1 transcript_id=mCT176306.0
FT                   protein_id=mCP99228.0 isoform=CRA_b"
FT                   /protein_id="EDL00930.1"
FT                   /translation="MDAALPEKPGICQTSLYKYHKDETRIKNIFRLQLEVFARKNWTSQ
FT                   SIPLAWSQELPPDGIFKNTPERPTTWGSGTLAAAADLSPTTSGRLQRNWPQKGDFCHRL
FT                   QRNMAAGEVV"
FT   gene            6468685..6548968
FT                   /gene="Dmgdh"
FT                   /locus_tag="mCG_114102"
FT                   /note="gene_id=mCG114102.1"
FT   mRNA            join(6468685..6468781,6471284..6471452,6481061..6481159,
FT                   6482646..6482810,6486000..6486204,6497978..6498226,
FT                   6500908..6501106,6502950..6503119,6503459..6503612,
FT                   6505569..6505734,6506322..6506452,6509733..6509951,
FT                   6513872..6514029,6516876..6516935,6540658..6540792,
FT                   6548364..6548968)
FT                   /gene="Dmgdh"
FT                   /locus_tag="mCG_114102"
FT                   /product="dimethylglycine dehydrogenase precursor"
FT                   /note="gene_id=mCG114102.1 transcript_id=mCT115193.1
FT                   created on 27-NOV-2002"
FT   CDS             join(6468696..6468781,6471284..6471452,6481061..6481159,
FT                   6482646..6482810,6486000..6486204,6497978..6498226,
FT                   6500908..6501106,6502950..6503119,6503459..6503612,
FT                   6505569..6505734,6506322..6506452,6509733..6509874)
FT                   /codon_start=1
FT                   /gene="Dmgdh"
FT                   /locus_tag="mCG_114102"
FT                   /product="dimethylglycine dehydrogenase precursor"
FT                   /note="gene_id=mCG114102.1 transcript_id=mCT115193.1
FT                   protein_id=mCP51847.1"
FT                   /protein_id="EDL00927.1"
FT                   /translation="MLRPGALRLRGLALRGSPRRPSSAGLREGQESPASPPEWKDRAET
FT                   VIIGGGCVGVSLAYHLAKAGMRDVVLMEKSELTAGSTWHAAGLTTYFHPGINLKKIHYD
FT                   SIKLYERLEEETGQVVGFHQPGSIRLATTPVRVDEFKYQMTRTNWHATEQYIIEPEKIH
FT                   ELFPLLNMNKILAGLYNPGDGHIDPYSLTMALAAGARKYGALLKYPAPVTSLKPRPDGT
FT                   WDVETPQGSVRANRIVNAAGFWAREVGKMIGLDHPLIPVQHQYVVTSTIPEVKALKREL
FT                   PVLRDLEGSYYLRQERDGLLFGPYESQEKMKLQASWVTHGVPPGFGKELFESDLDRISD
FT                   HLEAAMEMIPVLKKADIINVVNGPITYSPDILPMVGPHQGVRNYWVATGFGYGIIHAGG
FT                   VGKFLSDWILHGEPPFDLIELDPNRYGKWTTTQYTEAKARESYGFNNIVGYPKEERFAG
FT                   RPTQRVSGLYKTLKSKCSMGFHAGWEQPHWFYKPGQDTQYRPSFRRTNWFEPVGSEYKQ
FT                   VMQRVGVIDLSPFGKFNIKGRDSTQLLDHLFANVIPKVGFTNISHMLTPRGRVYAELTV
FT                   SQQSPGEFLLITGSGSELHDLRWIEEAAFRGGYDVEIQNITDEFGVLGVAGPYARRVLQ
FT                   KLTFRRSQR"
FT   assembly_gap    6475404..6475438
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    6476104..6476627
FT                   /estimated_length=524
FT                   /gap_type="unknown"
FT   assembly_gap    6477983..6478079
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   gene            complement(6500441..>6515494)
FT                   /locus_tag="mCG_145862"
FT                   /note="gene_id=mCG145862.0"
FT   mRNA            complement(join(6500441..6500796,6509710..6509948,
FT                   6515201..>6515494))
FT                   /locus_tag="mCG_145862"
FT                   /product="mCG145862"
FT                   /note="gene_id=mCG145862.0 transcript_id=mCT185970.0
FT                   created on 03-JUL-2003"
FT   CDS             complement(join(6500546..6500796,6509710..>6509752))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145862"
FT                   /product="mCG145862"
FT                   /note="gene_id=mCG145862.0 transcript_id=mCT185970.0
FT                   protein_id=mCP107347.0"
FT                   /protein_id="EDL00928.1"
FT                   /translation="RLLLQSICIGIISLDTKRGAAEMTQRAKVPSTKSDNLSSFPRTHV
FT                   VGGEERTVSSRSSSDPCTSVMTSEYPHTHTDQSVSQSVSQSVSQSINQCKKY"
FT   assembly_gap    6511301..6511320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6512641..6512660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6522434..6523166
FT                   /estimated_length=733
FT                   /gap_type="unknown"
FT   assembly_gap    6543012..6543031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6544803..6544822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6559220..6559239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6567279..6752427
FT                   /gene="Arsb"
FT                   /locus_tag="mCG_114100"
FT                   /note="gene_id=mCG114100.1"
FT   mRNA            join(<6567279..6567687,6585348..6585534,6589229..6589419,
FT                   6602572..6602752,6659230..6659473,6688170..6688240,
FT                   6748642..6748764,6749878..6752427)
FT                   /gene="Arsb"
FT                   /locus_tag="mCG_114100"
FT                   /product="arylsulfatase B"
FT                   /note="gene_id=mCG114100.1 transcript_id=mCT115191.1
FT                   created on 19-FEB-2003"
FT   CDS             join(<6567280..6567687,6585348..6585534,6589229..6589419,
FT                   6602572..6602752,6659230..6659473,6688170..6688240,
FT                   6748642..6748764,6749878..6750143)
FT                   /codon_start=1
FT                   /gene="Arsb"
FT                   /locus_tag="mCG_114100"
FT                   /product="arylsulfatase B"
FT                   /note="gene_id=mCG114100.1 transcript_id=mCT115191.1
FT                   protein_id=mCP51834.0"
FT                   /protein_id="EDL00926.1"
FT                   /translation="PRWMKSCWGARPLSSRFCRGCPQHGLCRLLRMGKLSPCTGRSRPG
FT                   GPGPQLPLLLLLLQLLLLLLSPARASGATQPPHVVFVLADDLGWNDLGFHGSVIRTPHL
FT                   DALAAGGVVLDNYYVQPLCTPSRSQLLTGRYQIHLGLQHYLIMTCQPSCVPLDEKLLPQ
FT                   LLKEAGYATHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYTHEACAPIESLNGT
FT                   RCALDLRDGEEPAKEYNNIYSTNIFTKRATTVIANHPPEKSVHDPLQVPEEYMEPYGFI
FT                   QDKHRRIYAGMVSLMDEAVGNVTKALKSHGLWNNTVFIFSTDNGGQTRSGGNNWPLRGR
FT                   KGTLWEGGIRGTGFVASPLLKQKGVKSRELMHITDWLPTLVDLAGGSTNGTKPLDGFNM
FT                   WKTISEGHPSPRVELLHNIDQDFFDGLPCPGKNMTPAKDDSFPLEHSAFNTSIHAGIRY
FT                   KNWKLLTGHPGCGYWFPPPSQSNVSEIPPVDPPTKTLWLFDINQDPEERHDVSREHPHI
FT                   VQNLLSRLQYYHEHSVPSHFPPLDPRCDPKSTGVWSPWM"
FT   assembly_gap    6572446..6573315
FT                   /estimated_length=870
FT                   /gap_type="unknown"
FT   assembly_gap    6574860..6575316
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   assembly_gap    6585666..6586433
FT                   /estimated_length=768
FT                   /gap_type="unknown"
FT   assembly_gap    6597025..6600466
FT                   /estimated_length=3442
FT                   /gap_type="unknown"
FT   assembly_gap    6612425..6613131
FT                   /estimated_length=707
FT                   /gap_type="unknown"
FT   assembly_gap    6621954..6621973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6624623..6624785
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    6637296..6637315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6638483..6638502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6639738..6640804
FT                   /estimated_length=1067
FT                   /gap_type="unknown"
FT   assembly_gap    6655663..6656058
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    6658445..6658977
FT                   /estimated_length=533
FT                   /gap_type="unknown"
FT   assembly_gap    6674551..6674570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6675742..6675761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6677091..6685345
FT                   /estimated_length=8255
FT                   /gap_type="unknown"
FT   assembly_gap    6686401..6686420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6694984..6695003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6696237..6696256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6707027..6707079
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    6717531..6717550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6732036..6732125
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    6737061..6737551
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    6740350..6740938
FT                   /estimated_length=589
FT                   /gap_type="unknown"
FT   assembly_gap    6758148..6758167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6809567..6809586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6825209..6826441
FT                   /estimated_length=1233
FT                   /gap_type="unknown"
FT   assembly_gap    6833567..6833742
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    6845601..6845693
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    6867625..6867737
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   gene            6867738..7005968
FT                   /gene="Lhfpl2"
FT                   /locus_tag="mCG_114103"
FT                   /note="gene_id=mCG114103.1"
FT   mRNA            join(6867738..6867844,6931263..6931321,6984581..6985196,
FT                   7002396..7005968)
FT                   /gene="Lhfpl2"
FT                   /locus_tag="mCG_114103"
FT                   /product="lipoma HMGIC fusion partner-like 2"
FT                   /note="gene_id=mCG114103.1 transcript_id=mCT115194.1
FT                   created on 19-FEB-2003"
FT   assembly_gap    6884749..6884768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6899178..6899197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6901576..6901790
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    6906279..6906807
FT                   /estimated_length=529
FT                   /gap_type="unknown"
FT   assembly_gap    6915995..6916017
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    6936199..6936218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6947536..6947676
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   gene            complement(6947925..6950597)
FT                   /locus_tag="mCG_146977"
FT                   /note="gene_id=mCG146977.0"
FT   mRNA            complement(join(6947925..6949906,6950269..6950597))
FT                   /locus_tag="mCG_146977"
FT                   /product="mCG146977"
FT                   /note="gene_id=mCG146977.0 transcript_id=mCT187240.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(6949473..6949709)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146977"
FT                   /product="mCG146977"
FT                   /note="gene_id=mCG146977.0 transcript_id=mCT187240.0
FT                   protein_id=mCP108192.0"
FT                   /protein_id="EDL00925.1"
FT                   /translation="MFIYLENICCGGIKSPHIYCAGEGARRPRSLTSDTGTHSQSCTLV
FT                   VSLYYNASWLPPSLVRASICEGHLHAEGHLSSV"
FT   assembly_gap    6968013..6968098
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   CDS             join(6984782..6985196,7002396..7002649)
FT                   /codon_start=1
FT                   /gene="Lhfpl2"
FT                   /locus_tag="mCG_114103"
FT                   /product="lipoma HMGIC fusion partner-like 2"
FT                   /note="gene_id=mCG114103.1 transcript_id=mCT115194.1
FT                   protein_id=mCP51993.1 partial"
FT                   /protein_id="EDL00924.1"
FT                   /translation="MCHVIVTCRSMLWTLLSIVVAFAELVAFMSADWLIGKAKTRSGSG
FT                   DEQAGVNSEPHYLGILCIRTPAMQQVSRDTLCGTYAKSFGEIASGFWQATAIFLAVGIF
FT                   ILCVVALVSVFTMCVQSIMRKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDCGR
FT                   YASPYKPGDCSLGWAFYTATGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLVCLL
FT                   "
FT   assembly_gap    6996124..6996143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7005222..7005241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7010827..7010846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7011974..7091824)
FT                   /gene="Scamp1"
FT                   /locus_tag="mCG_114101"
FT                   /note="gene_id=mCG114101.1"
FT   mRNA            complement(join(7011974..7014703,7018737..7018854,
FT                   7021178..7021279,7031480..7031639,7036184..7036312,
FT                   7038542..7038650,7039552..7039650,7059424..7059501,
FT                   7091717..7091824))
FT                   /gene="Scamp1"
FT                   /locus_tag="mCG_114101"
FT                   /product="secretory carrier membrane protein 1"
FT                   /note="gene_id=mCG114101.1 transcript_id=mCT115192.1
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(7014539..7014703,7018737..7018854,
FT                   7021178..7021279,7031480..7031639,7036184..7036312,
FT                   7038542..7038650,7039552..7039650,7059424..7059501,
FT                   7091717..7091773))
FT                   /codon_start=1
FT                   /gene="Scamp1"
FT                   /locus_tag="mCG_114101"
FT                   /product="secretory carrier membrane protein 1"
FT                   /note="gene_id=mCG114101.1 transcript_id=mCT115192.1
FT                   protein_id=mCP51838.1"
FT                   /db_xref="GOA:Q3TD71"
FT                   /db_xref="InterPro:IPR007273"
FT                   /db_xref="MGI:MGI:1349480"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TD71"
FT                   /protein_id="EDL00923.1"
FT                   /translation="MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRT
FT                   PPPGSVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRR
FT                   EREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTL
FT                   FLNIFGCLAWFCVDSSRAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFF
FT                   FVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVM
FT                   FKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAATSAAQNAFKGNQM"
FT   assembly_gap    7015790..7015874
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    7026504..7026523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7032811..7033048
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    7046167..7046505
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    7060084..7060190
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    7091951..7091970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7095983..7101565)
FT                   /locus_tag="mCG_1050920"
FT                   /note="gene_id=mCG1050920.0"
FT   mRNA            complement(join(7095983..7096807,7097425..7097610,
FT                   7099216..7099336,7101496..7101565))
FT                   /locus_tag="mCG_1050920"
FT                   /product="mCG1050920"
FT                   /note="gene_id=mCG1050920.0 transcript_id=mCT194709.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(7096270..7096419)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050920"
FT                   /product="mCG1050920"
FT                   /note="gene_id=mCG1050920.0 transcript_id=mCT194709.0
FT                   protein_id=mCP115738.0 partial"
FT                   /protein_id="EDL00922.1"
FT                   /translation="MKLCPPSLPPSLLPXXXXXXXSLRLSLPSSLLLSFLLSCLPSLLS
FT                   AHSW"
FT   assembly_gap    7096359..7096378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7101229..7101259
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    7103517..7108924
FT                   /estimated_length=5408
FT                   /gap_type="unknown"
FT   assembly_gap    7132479..7132575
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    7135798..7135929
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   gene            7165083..7367608
FT                   /gene="Ap3b1"
FT                   /locus_tag="mCG_114099"
FT                   /note="gene_id=mCG114099.1"
FT   mRNA            join(7165083..7165283,7198222..7198297,7202152..7202226,
FT                   7210771..7210866,7211380..7211540,7216214..7216280,
FT                   7225398..7225580,7248011..7248172,7251677..7251774,
FT                   7253680..7253734,7253824..7253895,7256213..7256275,
FT                   7258597..7258729,7263040..7263149,7270043..7270219,
FT                   7279331..7279517,7280454..7280584,7284621..7284783,
FT                   7287382..7287529,7290868..7291015,7301317..7301389,
FT                   7309576..7309682,7335798..7336029,7339615..7339699,
FT                   7350441..7350538,7355416..7355554,7366898..7367608)
FT                   /gene="Ap3b1"
FT                   /locus_tag="mCG_114099"
FT                   /product="adaptor-related protein complex 3, beta 1
FT                   subunit, transcript variant mCT115190"
FT                   /note="gene_id=mCG114099.1 transcript_id=mCT115190.0
FT                   created on 27-NOV-2002"
FT   CDS             join(7165156..7165283,7198222..7198297,7202152..7202226,
FT                   7210771..7210866,7211380..7211540,7216214..7216280,
FT                   7225398..7225580,7248011..7248172,7251677..7251774,
FT                   7253680..7253734,7253824..7253895,7256213..7256275,
FT                   7258597..7258729,7263040..7263149,7270043..7270219,
FT                   7279331..7279517,7280454..7280584,7284621..7284783,
FT                   7287382..7287529,7290868..7291015,7301317..7301389,
FT                   7309576..7309682,7335798..7336029,7339615..7339699,
FT                   7350441..7350538,7355416..7355554,7366898..7367051)
FT                   /codon_start=1
FT                   /gene="Ap3b1"
FT                   /locus_tag="mCG_114099"
FT                   /product="adaptor-related protein complex 3, beta 1
FT                   subunit, isoform CRA_b"
FT                   /note="gene_id=mCG114099.1 transcript_id=mCT115190.0
FT                   protein_id=mCP51816.1 isoform=CRA_b"
FT                   /protein_id="EDL00921.1"
FT                   /translation="MSSNSFAYNEQSGGGEAAELGQEATSTISPSGAFGLFSSDWKKNE
FT                   DLKQMLESNKDSAKLDAMKRIVGMIAKGKNASELFPAVVKNVASKNIEIKKLVYVYLVR
FT                   YAEEQQDLALLSISTFQRALKDPNQLIRASALRVLSSIRVPIIVPVMMLAIKEASADLS
FT                   PYVRKNAAHAIQKLYSLDPEQKEMLIEVIEKLLKDKSTLVAGSVVMAFEEVCPDRIDLI
FT                   HRNYRKLCNLLVDVEEWGQVVIIHMLTRYARTQFVSPWREDGGLEDNEKNFYESEEEEE
FT                   EEKEKSSRKKSYAMDPDHRLLIRNTKPLLQSRNAAVVMAVAQLYWHISPKSEAGVISKS
FT                   LVRLLRSNREVQYIVLQNIATMSIERKGMFEPYLKSFYVRSTDPTMIKTLKLEILTNLA
FT                   NEANISTLLREFQTYVRSQDKQFAAATIQTIGRCATSISEVTDTCLNGLVCLLSNRDEI
FT                   VVAESVVVIKKLLQMQPAQHGEIIRHMAKLLDSITVPVARASILWLIGENCERVPKIAP
FT                   DVLRKMAKSFTSEDDLVKLQILNLAAKLYLTNSKQTKLLTQYILNLGKYDQNYDIRDRT
FT                   RFIRQLIVPNEKSGALSKYAKKIFLAPKPAPLLESPFKDRDRFQLGTLSHTLNIKASGY
FT                   LELSNWPEVAPDPSVRNVEVIESAKEWTPLGKTKKEKPMKKFYSESEEEEDEDEDEDEE
FT                   EEEKEDEDENPSDSSSDSESGSGSESGDTGTEDSSEDSSSGQDSETGSQAEAERQKVAK
FT                   RNSKTKRKSDSENREKKNENSKASESSSEESSSMEDSSSESESESGSDSEPAPRNVAPA
FT                   KERKPQQERHPPSKDVFLLDLDDFNPVSTPVALPTPALSPSLIADLEGLNLSTSSSVIN
FT                   VSTPVFVPTKTHELLHRMHGKGLAAHYCFPRQPCIFSDKMVSVQITLTNTSDRKIENIH
FT                   IGGKGLPVGMQMHAFHPIDSLEPKGSVTVSVGIDFCDSTQTASFQLCTKDDCFNVTLQP
FT                   PVGELLSPVAMSEKDFKKEQGTLTGMNETSATLIAAPQNFTPSMILQKVVNVANLGAVP
FT                   SSQDNVHRFAARTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG"
FT   mRNA            join(7165182..7165283,7210771..7210866,7211380..7211540,
FT                   7216214..7216280,7225398..7225580,7248011..7248060,
FT                   7251677..7251774,7253680..7253734,7253824..7253895,
FT                   7256213..7256275,7258597..7258729,7263040..7263149,
FT                   7270043..7270219,7279331..7279517,7280454..7280584,
FT                   7284621..7284783,7287382..7287529,7290868..7291015,
FT                   7301317..7301389,7309576..7309682,7335798..7336029,
FT                   7339615..7339699,7350441..7350538,7355416..7355554,
FT                   7366458..7366493,7366898..7367608)
FT                   /gene="Ap3b1"
FT                   /locus_tag="mCG_114099"
FT                   /product="adaptor-related protein complex 3, beta 1
FT                   subunit, transcript variant mCT176310"
FT                   /note="gene_id=mCG114099.1 transcript_id=mCT176310.0
FT                   created on 27-NOV-2002"
FT   assembly_gap    7172658..7172784
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    7176283..7176302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7177579..7177598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7240559..7240771
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    7246776..7247125
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   CDS             join(7251683..7251774,7253680..7253734,7253824..7253895,
FT                   7256213..7256275,7258597..7258729,7263040..7263149,
FT                   7270043..7270219,7279331..7279517,7280454..7280584,
FT                   7284621..7284783,7287382..7287529,7290868..7291015,
FT                   7301317..7301389,7309576..7309682,7335798..7336029,
FT                   7339615..7339699,7350441..7350538,7355416..7355554,
FT                   7366458..7366488)
FT                   /codon_start=1
FT                   /gene="Ap3b1"
FT                   /locus_tag="mCG_114099"
FT                   /product="adaptor-related protein complex 3, beta 1
FT                   subunit, isoform CRA_a"
FT                   /note="gene_id=mCG114099.1 transcript_id=mCT176310.0
FT                   protein_id=mCP99232.0 isoform=CRA_a"
FT                   /protein_id="EDL00920.1"
FT                   /translation="MAVAQLYWHISPKSEAGVISKSLVRLLRSNREVQYIVLQNIATMS
FT                   IERKGMFEPYLKSFYVRSTDPTMIKTLKLEILTNLANEANISTLLREFQTYVRSQDKQF
FT                   AAATIQTIGRCATSISEVTDTCLNGLVCLLSNRDEIVVAESVVVIKKLLQMQPAQHGEI
FT                   IRHMAKLLDSITVPVARASILWLIGENCERVPKIAPDVLRKMAKSFTSEDDLVKLQILN
FT                   LAAKLYLTNSKQTKLLTQYILNLGKYDQNYDIRDRTRFIRQLIVPNEKSGALSKYAKKI
FT                   FLAPKPAPLLESPFKDRDRFQLGTLSHTLNIKASGYLELSNWPEVAPDPSVRNVEVIES
FT                   AKEWTPLGKTKKEKPMKKFYSESEEEEDEDEDEDEEEEEKEDEDENPSDSSSDSESGSG
FT                   SESGDTGTEDSSEDSSSGQDSETGSQAEAERQKVAKRNSKTKRKSDSENREKKNENSKA
FT                   SESSSEESSSMEDSSSESESESGSDSEPAPRNVAPAKERKPQQERHPPSKDVFLLDLDD
FT                   FNPVSTPVALPTPALSPSLIADLEGLNLSTSSSVINVSTPVFVPTKTHELLHRMHGKGL
FT                   AAHYCFPRQPCIFSDKMVSVQITLTNTSDRKIENIHIGGKGLPVGMQMHAFHPIDSLEP
FT                   KGSVTVSVGIDFCDSTQTASFQLCTKDDCFNVTLQPPVGELLSPVAMSEKDFKKEQGTL
FT                   TGMNETSATLIAAPQNFTPSMILQKVVNVANLGAVPSSQDNVHRYEELKFQAL"
FT   assembly_gap    7256806..7257069
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    7294706..7295689
FT                   /estimated_length=984
FT                   /gap_type="unknown"
FT   assembly_gap    7299746..7299814
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    7307189..7307208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7320887..7320906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7372084..7372103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7377879..7377898
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7416965..7416984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7421678..7421697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7447193..>7448619)
FT                   /locus_tag="mCG_1047095"
FT                   /note="gene_id=mCG1047095.1"
FT   mRNA            complement(join(7447193..7447672,7448510..>7448619))
FT                   /locus_tag="mCG_1047095"
FT                   /product="mCG1047095"
FT                   /note="gene_id=mCG1047095.1 transcript_id=mCT164799.0
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(7447548..7447672,7448510..>7448618))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047095"
FT                   /product="mCG1047095"
FT                   /note="gene_id=mCG1047095.1 transcript_id=mCT164799.0
FT                   protein_id=mCP51702.0"
FT                   /protein_id="EDL00919.1"
FT                   /translation="KAWNLEVPQKKKMCFLEKRCTQEIKLETRGFIRGIGDTSLEAKPE
FT                   LIHLGCREGPATLLGNKGHLHNAFSVNPCGKD"
FT   assembly_gap    7448213..7448232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7451534..7452398
FT                   /estimated_length=865
FT                   /gap_type="unknown"
FT   assembly_gap    7499522..7499724
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    7506051..7506088
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    7516854..7516873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7523774..7524121
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    7526596..7526615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7532745..7532961
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    7537461..7541061
FT                   /estimated_length=3601
FT                   /gap_type="unknown"
FT   gene            complement(7555654..7556066)
FT                   /pseudo
FT                   /locus_tag="mCG_1047126"
FT                   /note="gene_id=mCG1047126.1"
FT   mRNA            complement(7555654..7556066)
FT                   /pseudo
FT                   /locus_tag="mCG_1047126"
FT                   /note="gene_id=mCG1047126.1 transcript_id=mCT164830.1
FT                   created on 19-FEB-2003"
FT   assembly_gap    7559376..7559395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7590424..7646305
FT                   /locus_tag="mCG_122050"
FT                   /note="gene_id=mCG122050.1"
FT   mRNA            join(7590424..7590483,7635774..7635879,7640522..7640608,
FT                   7646051..7646305)
FT                   /locus_tag="mCG_122050"
FT                   /product="mCG122050"
FT                   /note="gene_id=mCG122050.1 transcript_id=mCT123264.0
FT                   created on 27-NOV-2002"
FT   CDS             join(7590431..7590483,7635774..7635879,7640522..7640608,
FT                   7646051..7646131)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122050"
FT                   /product="mCG122050"
FT                   /note="gene_id=mCG122050.1 transcript_id=mCT123264.0
FT                   protein_id=mCP51783.1"
FT                   /db_xref="GOA:Q5I0U7"
FT                   /db_xref="InterPro:IPR004226"
FT                   /db_xref="InterPro:IPR036126"
FT                   /db_xref="MGI:MGI:107549"
FT                   /db_xref="UniProtKB/TrEMBL:Q5I0U7"
FT                   /protein_id="EDL00918.1"
FT                   /translation="MADPRVRQIKIKTGVVRRLVKERVMYEKEAKQQEEKIEKMKAEDG
FT                   ENYAIKKQAEILQESRMMIPDCQRRLEAAYTDLQQILESEKDLEEAEEYKEARVVLDSV
FT                   KLEA"
FT   assembly_gap    7590606..7590625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7611769..7611788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7615955..7615974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7617336..7617355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7644707..7644726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7669003..7670393
FT                   /estimated_length=1391
FT                   /gap_type="unknown"
FT   assembly_gap    7670890..7670981
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   gene            7681187..7689239
FT                   /gene="Otp"
FT                   /locus_tag="mCG_122053"
FT                   /note="gene_id=mCG122053.1"
FT   mRNA            join(7681187..7681368,7682675..7683084,7688652..7689239)
FT                   /gene="Otp"
FT                   /locus_tag="mCG_122053"
FT                   /product="orthopedia homolog (Drosophila)"
FT                   /note="gene_id=mCG122053.1 transcript_id=mCT123266.0
FT                   created on 27-NOV-2002"
FT   CDS             join(7681332..7681368,7682675..7683084,7688652..7689182)
FT                   /codon_start=1
FT                   /gene="Otp"
FT                   /locus_tag="mCG_122053"
FT                   /product="orthopedia homolog (Drosophila)"
FT                   /note="gene_id=mCG122053.1 transcript_id=mCT123266.0
FT                   protein_id=mCP51789.1"
FT                   /protein_id="EDL00917.1"
FT                   /translation="MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDL
FT                   APNSDPVEGATLLPGEDITTVGSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQ
FT                   KRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRK
FT                   KTTNVFRAPGTLLPTPGLPQFPSAAAAAAAAMGDSLCSFHANDTRWAAAAMPGVSQLPL
FT                   PPALGRQQAMAQSLSQCSLAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPASL
FT                   PGPSNVSGSPQLCSSPDSSDVWRGTSIASLRRKALEHTVSMSFT"
FT   assembly_gap    7689478..7689606
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    7722394..7723505
FT                   /estimated_length=1112
FT                   /gap_type="unknown"
FT   assembly_gap    7742318..7742388
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    7756438..7757466
FT                   /estimated_length=1029
FT                   /gap_type="unknown"
FT   assembly_gap    7758388..7759039
FT                   /estimated_length=652
FT                   /gap_type="unknown"
FT   assembly_gap    7780711..7780730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7782636..7829697
FT                   /gene="Wdr41"
FT                   /locus_tag="mCG_122055"
FT                   /note="gene_id=mCG122055.1"
FT   mRNA            join(7782636..7782730,7782793..7782871,7784752..7784867,
FT                   7801526..7801574,7803332..7803461,7806143..7806204,
FT                   7812142..7812253,7815205..7815267,7816682..7816792,
FT                   7818970..7820928)
FT                   /gene="Wdr41"
FT                   /locus_tag="mCG_122055"
FT                   /product="WD repeat domain 41, transcript variant
FT                   mCT180641"
FT                   /note="gene_id=mCG122055.1 transcript_id=mCT180641.0
FT                   created on 19-FEB-2003"
FT   mRNA            join(7782668..7782730,7782793..7782871,7784752..7784867,
FT                   7801526..7801574,7803332..7803461,7806143..7806204,
FT                   7812142..7812253,7815205..7815267,7816682..7816792,
FT                   7821428..7821612,7823720..7823841,7824510..7824598,
FT                   7825225..7825358,7828063..7829697)
FT                   /gene="Wdr41"
FT                   /locus_tag="mCG_122055"
FT                   /product="WD repeat domain 41, transcript variant
FT                   mCT123270"
FT                   /note="gene_id=mCG122055.1 transcript_id=mCT123270.1
FT                   created on 19-FEB-2003"
FT   assembly_gap    7782731..7782792
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   CDS             join(7782821..7782871,7784752..7784867,7801526..7801574,
FT                   7803332..7803461,7806143..7806204,7812142..7812253,
FT                   7815205..7815267,7816682..7816792,7821428..7821612,
FT                   7823720..7823841,7824510..7824598,7825225..7825358,
FT                   7828063..7828218)
FT                   /codon_start=1
FT                   /gene="Wdr41"
FT                   /locus_tag="mCG_122055"
FT                   /product="WD repeat domain 41, isoform CRA_a"
FT                   /note="gene_id=mCG122055.1 transcript_id=mCT123270.1
FT                   protein_id=mCP51806.1 isoform=CRA_a"
FT                   /protein_id="EDL00915.1"
FT                   /translation="MLRWLIGGGREPQGLAEKAALQTIGEDQGQNPYTELLVLEAHRDI
FT                   VRFLVRLDDFRFASAGDDGIIVVWNAQTGEKLLELRGHTQKITAVIAFPPLDSCEASSQ
FT                   LLLTASADRTVVWDCDTGRQIQRVTCFQSTVKCLTVLQRLDIWLSGGSDLGVWNRKLDL
FT                   LCKTSHLSDTGISALVEIPGNCVAAAVGRELIIFRLVTPTEELPEWDIIEVKRLLDHQD
FT                   NILSLANINDTGFVTGSHVGELLIWDALDWTVQACERTFWSPTAQLDAQQEIKLFQKQN
FT                   DISINHFTCDEENIFAAVGRGLYVYNLQLKRVIACQKTAHDSNILHIDKLPNRQLISCS
FT                   EDGAVRMWEVREKQQLAAEPVPTGFFNMWGFGRVNKQASQPVKKQEENVTTCSLELIGD
FT                   LIGHSSSVEMFLYFEDHGLVTCSADHLIILWKNGERESGVRSLKLFQKLEENGDLYPES
FT                   P"
FT   CDS             join(7782821..7782871,7784752..7784867,7801526..7801574,
FT                   7803332..7803461,7806143..7806204,7812142..7812253,
FT                   7815205..7815267,7816682..7816792,7818970..7819676)
FT                   /codon_start=1
FT                   /gene="Wdr41"
FT                   /locus_tag="mCG_122055"
FT                   /product="WD repeat domain 41, isoform CRA_b"
FT                   /note="gene_id=mCG122055.1 transcript_id=mCT180641.0
FT                   protein_id=mCP103563.0 isoform=CRA_b"
FT                   /protein_id="EDL00916.1"
FT                   /translation="MLRWLIGGGREPQGLAEKAALQTIGEDQGQNPYTELLVLEAHRDI
FT                   VRFLVRLDDFRFASAGDDGIIVVWNAQTGEKLLELRGHTQKITAVIAFPPLDSCEASSQ
FT                   LLLTASADRTVVWDCDTGRQIQRVTCFQSTVKCLTVLQRLDIWLSGGSDLGVWNRKLDL
FT                   LCKTSHLSDTGISALVEIPGNCVAAAVGRELIIFRLVTPTEELPEWDIIEVKRLLDHQD
FT                   NILSLANINGSVLTMGSVLTTGSVLTIGSVLTTGSVLTMGSVLTTGSVLTAGSVLTMGS
FT                   VLTAGSVLTMGSVLTAGAVLPAGSVLTMGSVLTTGSVLTIGSVLTTGSVLTMGSVLTTG
FT                   SVLTAGSVLTAGSVLTMGSVLTAGAVLTAGAVLTMGSVLTAGSVLTAGAVLTAGSVLTM
FT                   GSVLTAGAVLTMGSVLTAGSVLTAGSVLTAGSVLTADLDLESRSVFLILGFSDSFVAEW
FT                   NQRRSWKD"
FT   assembly_gap    7809630..7809844
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   gene            complement(7830898..8057927)
FT                   /gene="Pde8b"
FT                   /locus_tag="mCG_122049"
FT                   /note="gene_id=mCG122049.1"
FT   mRNA            complement(join(7830898..7832622,7834011..7834140,
FT                   7836706..7836873,7839223..7839343,7840562..7840780,
FT                   7848259..7848457,7849294..7849429,7849821..7849866,
FT                   7852662..7852826,7854077..7854153,7856266..7856343,
FT                   7859228..7859270,7896632..7896710,7901992..7902080,
FT                   7907235..7907292,7910420..7910479,7913439..7913629,
FT                   7929062..7929121,8029990..8030566))
FT                   /gene="Pde8b"
FT                   /locus_tag="mCG_122049"
FT                   /product="phosphodiesterase 8B, transcript variant
FT                   mCT182062"
FT                   /note="gene_id=mCG122049.1 transcript_id=mCT182062.0
FT                   created on 22-APR-2003"
FT   mRNA            complement(join(7830904..7832622,7834011..7834140,
FT                   7836706..7836873,7839223..7839343,7840562..7840780,
FT                   7848259..7848457,7849294..7849429,7849821..7849866,
FT                   7852662..7852826,7854077..7854153,7856266..7856343,
FT                   7859228..7859270,7893081..7893221,7896632..7896710,
FT                   7901992..7902080,7907235..7907292,7910420..7910479,
FT                   7913439..7913629,7929062..7929118,8057756..8057927))
FT                   /gene="Pde8b"
FT                   /locus_tag="mCG_122049"
FT                   /product="phosphodiesterase 8B, transcript variant
FT                   mCT123268"
FT                   /note="gene_id=mCG122049.1 transcript_id=mCT123268.1
FT                   created on 22-APR-2003"
FT   mRNA            complement(join(7840343..7840780,7848259..7848457,
FT                   7849294..7849429,7849821..7849866,7852662..7852826,
FT                   7854077..7854153,7856266..7856343,7859228..7859270,
FT                   7889467..7889527,7891526..7891614,7896632..7896710,
FT                   7901992..7902080,7907235..7907292,7910420..7910479,
FT                   7913439..7913629,7929062..7929118,8029990..8030401,
FT                   8031046..8031132))
FT                   /gene="Pde8b"
FT                   /locus_tag="mCG_122049"
FT                   /product="phosphodiesterase 8B, transcript variant
FT                   mCT123267"
FT                   /note="gene_id=mCG122049.1 transcript_id=mCT123267.1
FT                   created on 22-APR-2003"
FT   CDS             complement(join(7840652..7840780,7848259..7848457,
FT                   7849294..7849429,7849821..7849866,7852662..7852826,
FT                   7854077..7854153,7856266..7856343,7859228..7859270,
FT                   7893081..7893221,7896632..7896710,7901992..7902080,
FT                   7907235..7907292,7910420..7910479,7913439..7913629,
FT                   7929062..7929118,8057756..8057782))
FT                   /codon_start=1
FT                   /gene="Pde8b"
FT                   /locus_tag="mCG_122049"
FT                   /product="phosphodiesterase 8B, isoform CRA_b"
FT                   /note="gene_id=mCG122049.1 transcript_id=mCT123268.1
FT                   protein_id=mCP51796.1 isoform=CRA_b"
FT                   /protein_id="EDL00911.1"
FT                   /translation="MDQQQSVRQVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWW
FT                   ACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRQSRNFDAEAVCRSIRATNPSEHTV
FT                   ILAVVSQASDDHEEASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVRSQFKLRAC
FT                   NSVFTALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNRADL
FT                   LDTINTCIKKGKIHRIHRDSGDNSQTEPHSFRHKSRRKESIDVKSISSRGSDAPSLQNR
FT                   RYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTELYSPQLGTK
FT                   DEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHHSHSHLSMPITINDVPPSIAQLLDNE
FT                   ESWDFNIFELEAVTHKRPLVYLGLKVFSRFGVCEFLNCTETTLRAWLQVIEANYHSSNA
FT                   YHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPRKDQLFPVQRRQ
FT                   RARCALQ"
FT   CDS             complement(join(7840652..7840780,7848259..7848457,
FT                   7849294..7849429,7849821..7849866,7852662..7852826,
FT                   7854077..7854153,7856266..7856343,7859228..7859270,
FT                   7889467..7889527,7891526..7891614,7896632..7896710,
FT                   7901992..7902080,7907235..7907292,7910420..7910479,
FT                   7913439..7913629,7929062..7929118,8029990..8030328))
FT                   /codon_start=1
FT                   /gene="Pde8b"
FT                   /locus_tag="mCG_122049"
FT                   /product="phosphodiesterase 8B, isoform CRA_a"
FT                   /note="gene_id=mCG122049.1 transcript_id=mCT123267.1
FT                   protein_id=mCP51791.1 isoform=CRA_a"
FT                   /protein_id="EDL00910.1"
FT                   /translation="MGCAPSIHVSQSGVIYCRDSDESNSPRQTSSVSQGPTAPLHGLFV
FT                   QTDAADAMPPSRAAGPPGAVRVRRSRAELGSGSSTGSSGPATTTCRGRRRHCCSSAEAE
FT                   TQTSYTSVKVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIART
FT                   PESALECFLDKHHEIIVIDHRQSRNFDAEAVCRSIRATNPSEHTVILAVVSQASDDHEE
FT                   ASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAI
FT                   EITSDDHVIQEWQGVYYARRKSGDSIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDSNK
FT                   QIHRIHRDSGDNSQTEPHSFRHKSRRKESIDVKSISSRGSDAPSLQNRRYPSMARIHSM
FT                   TIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTELYSPQLGTKDEDPHTSDLVG
FT                   GLMTDGLRRLSGNEYVFTKNVHHSHSHLSMPITINDVPPSIAQLLDNEESWDFNIFELE
FT                   AVTHKRPLVYLGLKVFSRFGVCEFLNCTETTLRAWLQVIEANYHSSNAYHNSTHAADVL
FT                   HATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPRKDQLFPVQRRQRARCALQ"
FT   CDS             complement(join(7840652..7840780,7848259..7848457,
FT                   7849294..7849429,7849821..7849866,7852662..7852826,
FT                   7854077..7854153,7856266..7856343,7859228..7859270,
FT                   7896632..7896710,7901992..7902080,7907235..7907292,
FT                   7910420..7910479,7913439..7913629,7929062..7929121,
FT                   8029990..8030328))
FT                   /codon_start=1
FT                   /gene="Pde8b"
FT                   /locus_tag="mCG_122049"
FT                   /product="phosphodiesterase 8B, isoform CRA_c"
FT                   /note="gene_id=mCG122049.1 transcript_id=mCT182062.0
FT                   protein_id=mCP104983.0 isoform=CRA_c"
FT                   /protein_id="EDL00912.1"
FT                   /translation="MGCAPSIHVSQSGVIYCRDSDESNSPRQTSSVSQGPTAPLHGLFV
FT                   QTDAADAMPPSRAAGPPGAVRVRRSRAELGSGSSTGSSGPATTTCRGRRRHCCSSAEAE
FT                   TQTSYTSVKQVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIAR
FT                   TPESALECFLDKHHEIIVIDHRQSRNFDAEAVCRSIRATNPSEHTVILAVVSQASDDHE
FT                   EASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEA
FT                   IEITSDDHVIQIHRIHRDSGDNSQTEPHSFRHKSRRKESIDVKSISSRGSDAPSLQNRR
FT                   YPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTELYSPQLGTKD
FT                   EDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHHSHSHLSMPITINDVPPSIAQLLDNEE
FT                   SWDFNIFELEAVTHKRPLVYLGLKVFSRFGVCEFLNCTETTLRAWLQVIEANYHSSNAY
FT                   HNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPRKDQLFPVQRRQR
FT                   ARCALQ"
FT   assembly_gap    7851956..7852056
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   mRNA            complement(join(7896423..7896710,7901992..7902080,
FT                   7907235..7907292,7910420..7910479,7913439..7913629,
FT                   7929062..7929121,8029990..8030566))
FT                   /gene="Pde8b"
FT                   /locus_tag="mCG_122049"
FT                   /product="phosphodiesterase 8B, transcript variant
FT                   mCT182061"
FT                   /note="gene_id=mCG122049.1 transcript_id=mCT182061.0
FT                   created on 22-APR-2003"
FT   CDS             complement(join(7896467..7896710,7901992..7902080,
FT                   7907235..7907292,7910420..7910479,7913439..7913629,
FT                   7929062..7929121,8029990..8030328))
FT                   /codon_start=1
FT                   /gene="Pde8b"
FT                   /locus_tag="mCG_122049"
FT                   /product="phosphodiesterase 8B, isoform CRA_d"
FT                   /note="gene_id=mCG122049.1 transcript_id=mCT182061.0
FT                   protein_id=mCP104984.0 isoform=CRA_d"
FT                   /protein_id="EDL00913.1"
FT                   /translation="MGCAPSIHVSQSGVIYCRDSDESNSPRQTSSVSQGPTAPLHGLFV
FT                   QTDAADAMPPSRAAGPPGAVRVRRSRAELGSGSSTGSSGPATTTCRGRRRHCCSSAEAE
FT                   TQTSYTSVKQVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIAR
FT                   TPESALECFLDKHHEIIVIDHRQSRNFDAEAVCRSIRATNPSEHTVILAVVSQASDDHE
FT                   EASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEA
FT                   IEITSDDHVIQVWEEALHIINTDKEPFRFHPPLNLKYSPIIFSYLHIFLKKGKSVCKKM
FT                   TGKLKN"
FT   assembly_gap    7938015..7938040
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    7942973..7943307
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    7951225..7951244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7966291..7967078
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   gene            8014845..8015691
FT                   /locus_tag="mCG_1047196"
FT                   /note="gene_id=mCG1047196.1"
FT   mRNA            join(8014845..8014938,8015270..8015691)
FT                   /locus_tag="mCG_1047196"
FT                   /product="mCG1047196"
FT                   /note="gene_id=mCG1047196.1 transcript_id=mCT164900.0
FT                   created on 19-FEB-2003"
FT   CDS             8015293..8015475
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047196"
FT                   /product="mCG1047196"
FT                   /note="gene_id=mCG1047196.1 transcript_id=mCT164900.0
FT                   protein_id=mCP51768.1"
FT                   /protein_id="EDL00914.1"
FT                   /translation="MASRKAEREWILPVSTLQKKKREEEHQDINTQQNFCFLLLVRLQC
FT                   QTVSVWLISHGGSYV"
FT   assembly_gap    8020194..8020213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8024422..8024577
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    8030567..8030773
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    8045481..8045531
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    8073121..8073146
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    8094531..8094654
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    8096840..8097030
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    8106277..8106375
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    8109436..8109455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8122893..8122912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8129664..8130245
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    8133940..8133966
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   gene            8134776..8147401
FT                   /gene="Zbed3"
FT                   /locus_tag="mCG_122057"
FT                   /note="gene_id=mCG122057.1"
FT   mRNA            join(8134776..8134903,8145615..8146711,8146984..8147399)
FT                   /gene="Zbed3"
FT                   /locus_tag="mCG_122057"
FT                   /product="zinc finger, BED domain containing 3, transcript
FT                   variant mCT176319"
FT                   /note="gene_id=mCG122057.1 transcript_id=mCT176319.0
FT                   created on 27-NOV-2002"
FT   mRNA            join(8134797..8134903,8145615..8147401)
FT                   /gene="Zbed3"
FT                   /locus_tag="mCG_122057"
FT                   /product="zinc finger, BED domain containing 3, transcript
FT                   variant mCT123272"
FT                   /note="gene_id=mCG122057.1 transcript_id=mCT123272.0
FT                   created on 27-NOV-2002"
FT   mRNA            join(8136325..8136502,8145615..8147399)
FT                   /gene="Zbed3"
FT                   /locus_tag="mCG_122057"
FT                   /product="zinc finger, BED domain containing 3, transcript
FT                   variant mCT176318"
FT                   /note="gene_id=mCG122057.1 transcript_id=mCT176318.0
FT                   created on 27-NOV-2002"
FT   CDS             8145629..8146315
FT                   /codon_start=1
FT                   /gene="Zbed3"
FT                   /locus_tag="mCG_122057"
FT                   /product="zinc finger, BED domain containing 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG122057.1 transcript_id=mCT123272.0
FT                   protein_id=mCP51821.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D0L1"
FT                   /db_xref="InterPro:IPR003656"
FT                   /db_xref="InterPro:IPR033546"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:1919364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D0L1"
FT                   /protein_id="EDL00907.1"
FT                   /translation="MKSKKPLKITMEDSRRLNDPAEQGGLCPAPVGPSYSEAWGYFHLD
FT                   PAQPRHRMMSAWATCRLCGLQVGGLPNFQMWTRALCQHLSDVHLPELKKSAAPSSPTTM
FT                   PCPPPPSPTMAAEGDWARLLEQMGELAMRGSQRELELERREAALMQAELELERKRQALK
FT                   QEAQSVEQERHQLQVEREALSKWIKKQSPGAQVPEPPSPLPLLPKEDPDIHDNNSDNDM
FT                   VTKVLL"
FT   CDS             8145629..8146315
FT                   /codon_start=1
FT                   /gene="Zbed3"
FT                   /locus_tag="mCG_122057"
FT                   /product="zinc finger, BED domain containing 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG122057.1 transcript_id=mCT176319.0
FT                   protein_id=mCP99240.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D0L1"
FT                   /db_xref="InterPro:IPR003656"
FT                   /db_xref="InterPro:IPR033546"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:1919364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D0L1"
FT                   /protein_id="EDL00908.1"
FT                   /translation="MKSKKPLKITMEDSRRLNDPAEQGGLCPAPVGPSYSEAWGYFHLD
FT                   PAQPRHRMMSAWATCRLCGLQVGGLPNFQMWTRALCQHLSDVHLPELKKSAAPSSPTTM
FT                   PCPPPPSPTMAAEGDWARLLEQMGELAMRGSQRELELERREAALMQAELELERKRQALK
FT                   QEAQSVEQERHQLQVEREALSKWIKKQSPGAQVPEPPSPLPLLPKEDPDIHDNNSDNDM
FT                   VTKVLL"
FT   CDS             8145629..8146315
FT                   /codon_start=1
FT                   /gene="Zbed3"
FT                   /locus_tag="mCG_122057"
FT                   /product="zinc finger, BED domain containing 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG122057.1 transcript_id=mCT176318.0
FT                   protein_id=mCP99241.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D0L1"
FT                   /db_xref="InterPro:IPR003656"
FT                   /db_xref="InterPro:IPR033546"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:1919364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D0L1"
FT                   /protein_id="EDL00909.1"
FT                   /translation="MKSKKPLKITMEDSRRLNDPAEQGGLCPAPVGPSYSEAWGYFHLD
FT                   PAQPRHRMMSAWATCRLCGLQVGGLPNFQMWTRALCQHLSDVHLPELKKSAAPSSPTTM
FT                   PCPPPPSPTMAAEGDWARLLEQMGELAMRGSQRELELERREAALMQAELELERKRQALK
FT                   QEAQSVEQERHQLQVEREALSKWIKKQSPGAQVPEPPSPLPLLPKEDPDIHDNNSDNDM
FT                   VTKVLL"
FT   gene            complement(8160233..8184887)
FT                   /gene="Aggf1"
FT                   /locus_tag="mCG_122056"
FT                   /note="gene_id=mCG122056.1"
FT   mRNA            complement(join(8160233..8161251,8162296..8162395,
FT                   8163499..8163626,8165942..8166024,8166746..8166911,
FT                   8168259..8168360,8172018..8172069,8172386..8172497,
FT                   8174230..8174551,8177929..8178117,8178946..8179107,
FT                   8180306..8180508,8181090..8181192,8184396..8184887))
FT                   /gene="Aggf1"
FT                   /locus_tag="mCG_122056"
FT                   /product="angiogenic factor with G patch and FHA domains 1"
FT                   /note="gene_id=mCG122056.1 transcript_id=mCT123271.1
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(8161051..8161251,8162296..8162395,
FT                   8163499..8163626,8165942..8166024,8166746..8166911,
FT                   8168259..8168360,8172018..8172069,8172386..8172497,
FT                   8174230..8174551,8177929..8178117,8178946..8179107,
FT                   8180306..8180508,8181090..8181192,8184396..8184608))
FT                   /codon_start=1
FT                   /gene="Aggf1"
FT                   /locus_tag="mCG_122056"
FT                   /product="angiogenic factor with G patch and FHA domains 1"
FT                   /note="gene_id=mCG122056.1 transcript_id=mCT123271.1
FT                   protein_id=mCP51813.1"
FT                   /protein_id="EDL00906.1"
FT                   /translation="MASEAPSPPSPSPPPPASPEPELAQLRRKVEKLERELRSCRRQVR
FT                   EVEKLLQHTERLYRNAESDNQELRTQVEELSKILHCGKNEDNPKSDVEVQTESQAPWAI
FT                   SDYYYQTCYNDDSLPSKETELCVQQSQCAQASALDPQDESHIDSGSYAGADATEGVSHR
FT                   QEDAVTSDSQESVSALAEGPALEGSSLAESLRAAAEAAVSQTGFTYDESTGLYFDHSTG
FT                   FYYDSENQLYYDPSTGIYYYCDVESGRYQFHSRVDLQPYQTSSTKPNRERRLKKRRKEP
FT                   GFYTANEEKDLSSEDQKVCSVEYINCSEDEHSGNVKKKARTDTSHKSSPLQLTVAVSGD
FT                   TVESPGDDNSASSKDERIGESESEPEEGEITDSQSEKSYDGDSSSGDRETSEESDDEDE
FT                   ERIWPPCIRVIVIRSPVLQMGSLFIITAVSPATIGREKDMEHTVRIPEVAVSKFHAEVY
FT                   FDHDLQSYVLVDQGSQNGTIVNGKQILQPKTKCDPYVLEHGDEVKIGETVLSFHIHPGS
FT                   ETCDGCEPGQVRAHLRLDRKDEPLVGPALSKEEKELERRKALKKIRVKYGLQNTDYEAE
FT                   KALKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGRKMLEKMGWKRGEGL
FT                   GKDGGGMKTPIQLQLRRTHAGLGTGKLSSIDDVHLIQNKSKKHWDKARERFAETFTENK
FT                   PRKETPGAVPWVTGTAE"
FT   assembly_gap    8193482..8193879
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    8213852..8213871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8217787..8217836
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    8221423..8221717
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    8228819..8228979
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   gene            complement(<8229988..8230431)
FT                   /locus_tag="mCG_1047124"
FT                   /note="gene_id=mCG1047124.1"
FT   mRNA            complement(<8229988..8230431)
FT                   /locus_tag="mCG_1047124"
FT                   /product="mCG1047124"
FT                   /note="gene_id=mCG1047124.1 transcript_id=mCT164828.1
FT                   created on 19-FEB-2003"
FT   CDS             complement(<8229988..8230122)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047124"
FT                   /product="mCG1047124"
FT                   /note="gene_id=mCG1047124.1 transcript_id=mCT164828.1
FT                   protein_id=mCP51860.1"
FT                   /protein_id="EDL00905.1"
FT                   /translation="MAKGHRLCQPKPKIATKIETTAPAKTQASFPTQASKGAPAPVKAP
FT                   "
FT   gene            complement(8240188..8253424)
FT                   /gene="Crhbp"
FT                   /locus_tag="mCG_122054"
FT                   /note="gene_id=mCG122054.1"
FT   mRNA            complement(join(8240188..8240903,8245097..8245214,
FT                   8248778..8248926,8250766..8250976,8252409..8252566,
FT                   8252845..8252938,8253251..8253424))
FT                   /gene="Crhbp"
FT                   /locus_tag="mCG_122054"
FT                   /product="corticotropin releasing hormone binding protein"
FT                   /note="gene_id=mCG122054.1 transcript_id=mCT123269.0
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(8240746..8240903,8245097..8245214,
FT                   8248778..8248926,8250766..8250976,8252409..8252566,
FT                   8252845..8252938,8253251..8253331))
FT                   /codon_start=1
FT                   /gene="Crhbp"
FT                   /locus_tag="mCG_122054"
FT                   /product="corticotropin releasing hormone binding protein"
FT                   /note="gene_id=mCG122054.1 transcript_id=mCT123269.0
FT                   protein_id=mCP51799.1"
FT                   /db_xref="GOA:Q3UY07"
FT                   /db_xref="InterPro:IPR008435"
FT                   /db_xref="InterPro:IPR035914"
FT                   /db_xref="MGI:MGI:88497"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UY07"
FT                   /protein_id="EDL00904.1"
FT                   /translation="MSPNFKLQCHFILILLTALRGESRYLEVQEAAVYDPLLLFSANLK
FT                   RDLAEEQPYRRALRCLDMLSLPGQFTFTADRPQLHCAAFFIGEPEEFITIHYDLVSIDC
FT                   QGGDFLKVFDGWILKGEKFPSSQDHPLPTMKRYTDFCESGLTRRSIRSSQNVAMVFFRV
FT                   HEPGNGFTITIKTDPNLFPCNVISQTPSGRFTLVVPYQHQNCSFSIIYPVAIKISDLTL
FT                   GHLHGLQLKKPAAGCGGTGDFVELLGGTGLDPSKMMPLADLCYPFLGPAQMKISCDNAV
FT                   VRMVSSGKHINRVTFEYRQLEPFELETSTGNSIPEYCLSSL"
FT   assembly_gap    8242300..8242353
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    8255048..8255575
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    8267330..8268965
FT                   /estimated_length=1636
FT                   /gap_type="unknown"
FT   assembly_gap    8270099..8271111
FT                   /estimated_length=1013
FT                   /gap_type="unknown"
FT   assembly_gap    8278131..8278150
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8284438..8284657
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   gene            complement(8284714..8286935)
FT                   /locus_tag="mCG_122058"
FT                   /note="gene_id=mCG122058.1"
FT   mRNA            complement(join(8284714..8285426,8286482..8286935))
FT                   /locus_tag="mCG_122058"
FT                   /product="mCG122058"
FT                   /note="gene_id=mCG122058.1 transcript_id=mCT123273.1
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(8285268..8285426,8286482..8286622))
FT                   /codon_start=1
FT                   /locus_tag="mCG_122058"
FT                   /product="mCG122058"
FT                   /note="gene_id=mCG122058.1 transcript_id=mCT123273.1
FT                   protein_id=mCP51822.0"
FT                   /db_xref="GOA:B9EJL3"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028490"
FT                   /db_xref="MGI:MGI:2685471"
FT                   /db_xref="UniProtKB/TrEMBL:B9EJL3"
FT                   /protein_id="EDL00903.1"
FT                   /translation="MPTQLEMAMDTMIRIFHRYSCKEGDRFKLNKGELKMLLQRELTEF
FT                   LTCQKDPQLVDKIMQDLDANKDNEVDFNEFVVMVAALTVACNDYFVEQMKKKGK"
FT   assembly_gap    8296477..8297643
FT                   /estimated_length=1167
FT                   /gap_type="unknown"
FT   assembly_gap    8311997..8312016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8318500..8318519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8318712..8331795)
FT                   /gene="F2rl1"
FT                   /locus_tag="mCG_122051"
FT                   /note="gene_id=mCG122051.1"
FT   mRNA            complement(join(8318712..8321261,8331633..8331795))
FT                   /gene="F2rl1"
FT                   /locus_tag="mCG_122051"
FT                   /product="coagulation factor II (thrombin) receptor-like 1"
FT                   /note="gene_id=mCG122051.1 transcript_id=mCT123265.0
FT                   created on 27-NOV-2002"
FT   CDS             complement(join(8320153..8321261,8331633..8331723))
FT                   /codon_start=1
FT                   /gene="F2rl1"
FT                   /locus_tag="mCG_122051"
FT                   /product="coagulation factor II (thrombin) receptor-like 1"
FT                   /note="gene_id=mCG122051.1 transcript_id=mCT123265.0
FT                   protein_id=mCP51785.1"
FT                   /db_xref="GOA:Q8R3I1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR002281"
FT                   /db_xref="InterPro:IPR003912"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:101910"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R3I1"
FT                   /protein_id="EDL00902.1"
FT                   /translation="MRSLSLAWLLGGITLLAASVSCSRTENLAPGRNNSKGRSLIGRLE
FT                   TQPPITGKGVPVEPGFSIDEFSASILTGKLTTVFLPVVYIIVFVIGLPSNGMALWIFLF
FT                   RTKKKHPAVIYMANLALADLLSVIWFPLAIAYHLHGNNWVYGEALCKVLIGFFYGNMYC
FT                   SILFMTCLSVQRYWVIVNPMGHPRKKANIAVGVSLAIWLLIFLVTIPLYVMKQTIYIPA
FT                   LNITTCHDVLPEEVLVGDMFNYFLSLAIGVFLFPAILTASAYVLMIKTLRSSAMDEHSE
FT                   KKRQRAIRLIITVLAMYFICFAPSNLLLVVHYFLIKTQRQSHVYALYLVALCLSTLNSC
FT                   IDPFVYYFVSKDFRDHARNALLCRSVRTVNRMQISLSSNKFSRKSGSYSSSSTSVKTSY
FT                   "
FT   assembly_gap    8325706..8325725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8339963..8339982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8358408..8358526
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    8368547..8368566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8369798..8382813
FT                   /estimated_length=13016
FT                   /gap_type="unknown"
FT   assembly_gap    8384527..8384822
FT                   /estimated_length=296
FT                   /gap_type="unknown"
FT   assembly_gap    8398224..8399301
FT                   /estimated_length=1078
FT                   /gap_type="unknown"
FT   assembly_gap    8404765..8404784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8406780..8423497)
FT                   /gene="F2r"
FT                   /locus_tag="mCG_114895"
FT                   /note="gene_id=mCG114895.1"
FT   mRNA            complement(join(8406780..8409929,8423316..8423497))
FT                   /gene="F2r"
FT                   /locus_tag="mCG_114895"
FT                   /product="coagulation factor II (thrombin) receptor"
FT                   /note="gene_id=mCG114895.1 transcript_id=mCT115993.1
FT                   created on 21-SEP-2002"
FT   CDS             complement(join(8408725..8409929,8423316..8423403))
FT                   /codon_start=1
FT                   /gene="F2r"
FT                   /locus_tag="mCG_114895"
FT                   /product="coagulation factor II (thrombin) receptor"
FT                   /note="gene_id=mCG114895.1 transcript_id=mCT115993.1
FT                   protein_id=mCP51836.1"
FT                   /protein_id="EDL00901.1"
FT                   /translation="MGPRRLLIVALGLSLCGPLLSSRVPMSQPESERTDATVNPRSFFL
FT                   RNPSENTFELVPLGDEEEEEKNESVLLEGRAVYLNISLPPHTPPPPFISEDASGYLTSP
FT                   WLTLFMPSVYTIVFIVSLPLNVLAIAVFVLRMKVKKPAVVYMLHLAMADVLFVSVLPFK
FT                   ISYYFSGTDWQFGSGMCRFATAAFYGNMYASIMLMTVISIDRFLAVVYPIQSLSWRTLG
FT                   RANFTCVVIWVMAIMGVVPLLLKEQTTRVPGLNITTCHDVLSENLMQGFYSYYFSAFSA
FT                   IFFLVPLIVSTVCYTSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIV
FT                   HYLFLSDSPGTEAAYFAYLLCVCVSSVSCCIDPLIYYYASSECQRHLYSILCCKESSDP
FT                   NSCNSTGQLMPSKMDTCSSHLNNSIYKKLLA"
FT   assembly_gap    8416847..8416866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8422063..8422243
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    8430144..8430163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8432163..>8698623)
FT                   /locus_tag="mCG_114897"
FT                   /note="gene_id=mCG114897.1"
FT   mRNA            complement(join(8432163..8433105,8433931..8434039,
FT                   8434977..8435114,8437005..8437165,8440314..8440526,
FT                   8442559..8442646,8451523..8451664,8452945..8453047,
FT                   8462958..8463090,8465245..8465477,8466126..8466210,
FT                   8466705..8466845,8469139..8469363,8470669..8470832,
FT                   8473442..8473591,8476252..8476460,8478015..8478084,
FT                   8478715..8478786,8480441..8480524,8487277..8487447,
FT                   8488026..8488183,8489970..8490137,8494851..8494941,
FT                   8512997..8513160,8521140..8521264,8526453..8526613,
FT                   8529475..8529638,8534454..8534541,8536272..8536450,
FT                   8537856..8537969,8538847..8538914,8551211..8551287,
FT                   8554797..8554874,8568174..8568330,8641421..8641520,
FT                   8698370..>8698623))
FT                   /locus_tag="mCG_114897"
FT                   /product="mCG114897, transcript variant mCT115996"
FT                   /note="gene_id=mCG114897.1 transcript_id=mCT115996.1
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(8432992..8433105,8433931..8434039,
FT                   8434977..8435114,8437005..8437165,8440314..8440526,
FT                   8442559..8442646,8451523..8451664,8452945..8453047,
FT                   8462958..8463090,8465245..8465477,8466126..8466210,
FT                   8466705..8466845,8469139..8469363,8470669..8470832,
FT                   8473442..8473591,8476252..8476460,8478015..8478084,
FT                   8478715..8478786,8480441..8480524,8487277..8487447,
FT                   8488026..8488183,8489970..8490137,8494851..8494941,
FT                   8512997..8513160,8521140..8521264,8526453..8526613,
FT                   8529475..8529638,8534454..8534541,8536272..8536450,
FT                   8537856..8537969,8538847..8538914,8551211..8551287,
FT                   8554797..8554874,8568174..8568330,8641421..8641520,
FT                   8698370..>8698622))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114897"
FT                   /product="mCG114897, isoform CRA_a"
FT                   /note="gene_id=mCG114897.1 transcript_id=mCT115996.1
FT                   protein_id=mCP51850.1 isoform=CRA_a"
FT                   /protein_id="EDL00898.1"
FT                   /translation="LLPRCQRDAAAAGASEGAPRERSGQLREAGRGQPRGGIGARPPGA
FT                   EPASLASEGNHGGRSPGGPPEQRRMPHEELPSLQRPRYGSIVDDERLSAEEMDERRRQN
FT                   IAYEYLCHLEEAKRWMEVCLVEELPPTTELEEGLRNGVYLAKLAKFFAPKMVSEKKIYD
FT                   VEQTRYKKSGLHFRHTDNTVQWLRAMEAIGLPKIFYPETTDVYDRKNIPRMIYCIHALS
FT                   LYLFKLGIAPQIQDLLGKVDFTEEEISNMRKELEKYGIQMPAFSKIGGILANELSVDEA
FT                   ALHAAVIAINEAIEKGVAKQTIITLRNPNAVLTCVDDSLSQEYQKELWEAKKKKEESAK
FT                   LKNSCISEEERDAYEELLTQAEIQSNISTVNRMAAVDHINAVLQEGDPENTLLALKKPE
FT                   AQLPAVYPFAAVMYQNELFNLQKQNTSNYLAHEELLIAVEMLSAVALLNQALESSDLVA
FT                   VQNQLRSPTIGFNNLDEAHVDRYADALLSVKQEALSQGQDTLSWNEIQNCIDMINNQIQ
FT                   EENDRMVVLGYINEAIDAGNPLKTLDTLLLPTANIRDVDPDCAQHYQDVLFYTKSQKLG
FT                   DPKNVSKVLWLDEIQQAIDEANVDENRAKQWVTLVVDVNECLDRKQSDHILTALKSSSS
FT                   NIHNILPECANKYYDTLVKAKESKTDNDSSSLESSEGSWVTLNVQEKYNYYYNTDSKEG
FT                   SWVPPELCLSKESWLTGEEIEDIVEEVTSDYIREKLWSASEDLLVRFEATASGPALREE
FT                   FEARKAFLYEQTESVVKIQAFWKGFKQRQEYLHRQQVFAGNVDSVVKIQSWFRMVTARK
FT                   SYLSRLRYFEDHKNEIVKIQSLLRASKARDDYKALVGSENPPLTVIRKFVYLLDQSDLD
FT                   FQEELEVARLREEVVTKIRANQQLEKDLNLMDIKIGLLVKNRITLEDVISHRKKLNKKK
FT                   GGEIEILNNTDNKGIKSLSKERRKTLETYQQLFYLLQTKPSYLAKLIFQMPQNKSTKFM
FT                   DTVIFTLYNYASNQREEYLLLKLFKTALEEEIKSKVDQVQDIVTGNPTVIKMVVSFNRG
FT                   ARGQNTLRQLLAPVVKEIIEDKALVINTNPVEVYKAWVNQLETQTGEASKLPYDVTTEQ
FT                   ALTYPEVKNKLEASIENLRKVTDKVLGSIISSLDLLPYGLRYIAKVLKNSIREKFPDAT
FT                   EEELLKIVGNLLYYRYMNPAIVAPDGFDIIDMTAGGQINSNQRRNLGSVAKVLQHAASN
FT                   KLFEGENEHLSSMNNYLSETYQEFRKYFQEACDVPEPEEKFNMDKYTDLVTVSKPVIYI
FT                   SIEEIINTHLLLLEHQDAIATEKSDLLNELLESLGEVPTVESFLGEGAVDPNDPNKENT
FT                   LNQLSKTEISLSLTSKYDVKDGEAVDGRSLMIKTKKLIIDVTRNQPGSTLTEILETPAT
FT                   EQQELEHAKDMESRAVVDSRTPEEGKQSQAVIEDARLPLEQKKRKIQRNLRTLEQTGHV
FT                   SSKNKYQDILNEIAKDIRNQRIHRKLRKAELSKLQQTLNALNKKAAFYEDQINYYDTYI
FT                   KTCVDNLKRKNSRRSIKLDGKTEPKGTKRVKPVRYTAAKLHDKGVLLGIDDLQTNQFKN
FT                   VMFDIIATEDMGIFDVRSKFLGVEMEKVQLNIQDLLQMQYEGVAVMKMFDKVKVNVNLL
FT                   IYLLNKKFYGK"
FT   assembly_gap    8460990..8461009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8462241..8462260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(<8476252..8476460,8478015..8478084,
FT                   8478715..8478786,8480441..8480524,8487277..8487447,
FT                   8488026..8488168,8489970..8490137,8494851..8494941,
FT                   8512997..8513160,8521140..8521264,8526453..8526613,
FT                   8529475..8529638,8534454..8534541,8536272..8536450,
FT                   8537856..8537969,8538847..8538914,8551211..8551287,
FT                   8554797..8554874,8568174..8568330,8641421..8641520,
FT                   8698370..>8698469))
FT                   /locus_tag="mCG_114897"
FT                   /product="mCG114897, transcript variant mCT189361"
FT                   /note="gene_id=mCG114897.1 transcript_id=mCT189361.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(<8476252..8476460,8478015..8478084,
FT                   8478715..8478786,8480441..8480524,8487277..8487447,
FT                   8488026..8488168,8489970..8490137,8494851..8494941,
FT                   8512997..8513160,8521140..8521264,8526453..8526613,
FT                   8529475..8529638,8534454..8534541,8536272..8536450,
FT                   8537856..8537969,8538847..8538914,8551211..8551287,
FT                   8554797..8554874,8568174..8568330,8641421..8641520,
FT                   8698370..>8698469))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114897"
FT                   /product="mCG114897, isoform CRA_b"
FT                   /note="gene_id=mCG114897.1 transcript_id=mCT189361.0
FT                   protein_id=mCP110342.0 isoform=CRA_b"
FT                   /protein_id="EDL00899.1"
FT                   /translation="SEGNHGGRSPGGPPEQRRMPHEELPSLQRPRYGSIVDDERLSAEE
FT                   MDERRRQNIAYEYLCHLEEAKRWMEVCLVEELPPTTELEEGLRNGVYLAKLAKFFAPKM
FT                   VSEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAMEAIGLPKIFYPETTDVYDRKNIPRM
FT                   IYCIHALSLYLFKLGIAPQIQDLLGKVDFTEEEISNMRKELEKYGIQMPAFSKIGGILA
FT                   NELSVDEAALHAAVIAINEAIEKGVAKQTIITLRNPNAVLTCVDDSLSQEYQKELWEAK
FT                   KKKEESAKLKNSCISEEERDAYEELLTQAEIQSNISTVNRMAAVDHINAVLQEGDPENT
FT                   LLALKKPEAQLPAVYPFAAVMYQNELFNLQKQNTSNYLAHEELLIAVEMLSAVALLNQA
FT                   LESSDLVAVQNQLRSPTIGFNNLDEAHVDRYADALLSVKQEALSQGQDTLSWNEIQNCI
FT                   DMINNQIQEENDRMVVLGYINEAIDAGNPLKTLDTLLLPTANIRDVDPDCAQHYQDVLF
FT                   YTKSQKLGDPKNVSKVLWLDEIQQAIDEANVDENRAKQWVTLVVDVNECLDRKQSDHIL
FT                   TALKSSSSNIHNILPECANKYYDTLVKAKESKTDNESSEGSWVTLNVQEKYNYYYNTDS
FT                   KEGSWVPPELCLSKESWLTGEEIEDIVEEVTSDYIREKLWSASEDLLVRFEATASGPAL
FT                   REEFEARKAFLYEQTESVVKIQAFWKGFKQRQEYLHRQQVFAGNVDSVVKIQSWFRMVT
FT                   ARKSYLSRLRYFEDHKNEIVKIQSLLRASKARDDYKALVGSENPPLTVIRKFVYLLDQS
FT                   DLDFQEELEVARLREEVVTKIRANQQLEKDLNLMDIKIGLLVKNRITLE"
FT   assembly_gap    8496997..8497457
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   gene            8501997..8507852
FT                   /gene="F2rl2"
FT                   /locus_tag="mCG_114894"
FT                   /note="gene_id=mCG114894.1"
FT   mRNA            join(8501997..8502212,8505594..8507852)
FT                   /gene="F2rl2"
FT                   /locus_tag="mCG_114894"
FT                   /product="coagulation factor II (thrombin) receptor-like 2"
FT                   /note="gene_id=mCG114894.1 transcript_id=mCT115992.1
FT                   created on 27-NOV-2002"
FT   CDS             join(8502149..8502212,8505594..8506639)
FT                   /codon_start=1
FT                   /gene="F2rl2"
FT                   /locus_tag="mCG_114894"
FT                   /product="coagulation factor II (thrombin) receptor-like 2"
FT                   /note="gene_id=mCG114894.1 transcript_id=mCT115992.1
FT                   protein_id=mCP51833.1"
FT                   /protein_id="EDL00900.1"
FT                   /translation="MKILILVAAGLLFLPVTVCQSGINVSDNSAKPTLTIKSFNGGPQN
FT                   TFEEFPLSDIEGWTGATTTIKAECPEDSISTLHVNNATIGYLRSSLSTQVIPAIYILLF
FT                   VVGVPANIVTLWKLSLRTKSISLVIFHTNLAIADLLFCVTLPFKIAYHLNGNNWVFGEV
FT                   MCRITTVVFYGNMYCAILILTCMGINRYLATAHPFTYQKLPKRSFSMLMCGMVWVMVFL
FT                   YMLPFVILKQEYHLVHSEITTCHDVVDACESPSSFRFYYFVSLAFFGFLIPFVIIIFCY
FT                   TTLIHKLKSKDRIWLGYIKAVLLILVIFTICFAPTNIILVIHHANYYYHNTDSLYFMYL
FT                   IALCLGSLNSCLDPFLYFVMSKVVDQLNP"
FT   assembly_gap    8522711..8522813
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    8523710..8524037
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    8530597..8530670
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    8583151..8583279
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    8602149..8603078
FT                   /estimated_length=930
FT                   /gap_type="unknown"
FT   assembly_gap    8616418..8617639
FT                   /estimated_length=1222
FT                   /gap_type="unknown"
FT   assembly_gap    8625397..8625416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8626537..8627287
FT                   /estimated_length=751
FT                   /gap_type="unknown"
FT   assembly_gap    8629595..8629614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8631085..8631141
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    8634231..8634514
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    8649252..8649271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8656245..8657160
FT                   /estimated_length=916
FT                   /gap_type="unknown"
FT   assembly_gap    8661308..8661683
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    8667328..8672499
FT                   /estimated_length=5172
FT                   /gap_type="unknown"
FT   assembly_gap    8675321..8677046
FT                   /estimated_length=1726
FT                   /gap_type="unknown"
FT   assembly_gap    8679205..8681107
FT                   /estimated_length=1903
FT                   /gap_type="unknown"
FT   assembly_gap    8684065..8684796
FT                   /estimated_length=732
FT                   /gap_type="unknown"
FT   assembly_gap    8685410..8685429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8688365..8688384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8690080..8690099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8702253..8702272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8703365..8705043
FT                   /estimated_length=1679
FT                   /gap_type="unknown"
FT   gene            complement(8705708..8708339)
FT                   /locus_tag="mCG_146979"
FT                   /note="gene_id=mCG146979.0"
FT   mRNA            complement(8705708..8708339)
FT                   /locus_tag="mCG_146979"
FT                   /product="mCG146979"
FT                   /note="gene_id=mCG146979.0 transcript_id=mCT187242.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(8707187..8707390)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146979"
FT                   /product="mCG146979"
FT                   /note="gene_id=mCG146979.0 transcript_id=mCT187242.0
FT                   protein_id=mCP108194.0"
FT                   /protein_id="EDL00897.1"
FT                   /translation="MPMKRFGIGIQRRKQNKTNWKEQKEHRFGSWELSIYLHNSQNSEQ
FT                   TCRGTGSGSDRTVHSQGHAPGA"
FT   assembly_gap    8711609..8712557
FT                   /estimated_length=949
FT                   /gap_type="unknown"
FT   assembly_gap    8715093..8715913
FT                   /estimated_length=821
FT                   /gap_type="unknown"
FT   assembly_gap    8729881..8729900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8749014..8749033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8754832..8754999
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   gene            complement(8767436..8894294)
FT                   /locus_tag="mCG_114899"
FT                   /note="gene_id=mCG114899.1"
FT   mRNA            complement(join(8767436..8767735,8783078..8783237,
FT                   8783691..8783894,8785195..8785328,8788970..8789134,
FT                   8793052..8793140,8793831..8793941,8796197..8796286,
FT                   8796759..8796892,8836917..8837068,8856200..8856380,
FT                   8893705..8894294))
FT                   /locus_tag="mCG_114899"
FT                   /product="mCG114899"
FT                   /note="gene_id=mCG114899.1 transcript_id=mCT115998.1
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(8767552..8767735,8783078..8783237,
FT                   8783691..8783894,8785195..8785328,8788970..8789134,
FT                   8793052..8793140,8793831..8793941,8796197..8796286,
FT                   8796759..8796892,8836917..8837068,8856200..8856380,
FT                   8893705..8894284))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114899"
FT                   /product="mCG114899"
FT                   /note="gene_id=mCG114899.1 transcript_id=mCT115998.1
FT                   protein_id=mCP51689.1"
FT                   /protein_id="EDL00896.1"
FT                   /translation="MEDSYKDRTSLMKGAKDIAKEVKKQTVKKVNQAVDRAQDEYTQRS
FT                   YSRFQDEEDDDDYYPPGETYSGEAIDDEGSSEATEGHDEEDEIYEGEYQGIPSTNQGKD
FT                   SIVSIGQPKGDEYKDRRELESERRADEEELAQQYELIIQECGHGRFQWALFFVLGMALM
FT                   ADGVEVFVVGFVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRKQSLL
FT                   ICMSVNGFFAFLSSFVQGYGFFLVCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSW
FT                   LCMFWMIGGIYASAMAWAIIPHYGWSFSMGSAYQFHSWRVFVIVCALPCVSSVVALTFM
FT                   PESPRFLLEVGKHDEAWMILKLIHDTNMRARGQPEKVFTVNKIKTPKQIDELIEIESDT
FT                   GTWYRRCFVRIRTELYGIWLTFMRCFNYPVRENTIKLTIVWFTLSFGYYGLSVWFPDVI
FT                   KHLQSDEYALLTRNVQKDKYANFSINFTMENQIHTGMEYENGRFLGVKFKSVTFKDSVF
FT                   KSCTFDDVTSVNTYFKNCTFIDTLFDNTDFEPYKFIDSEFQNCSFLHNKTGCQITFDDD
FT                   YSAYWIYFVNFLGTLAVLPGNIVSALLMDRIGRLTMLGGSMVLSGISCFFLWFGTSESM
FT                   MIGMLCLYNGLTISAWNSLDVVTVELYPTDRRATGFGFLNALCKAAAVLGNLIFGSLVS
FT                   ITKAIPILLASTVLVCGGLVGLRLPDTRTQVLM"
FT   assembly_gap    8818537..8818556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8839063..8839082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8876924..8877519
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    8880539..8880558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8887457..8889187
FT                   /pseudo
FT                   /locus_tag="mCG_1047093"
FT                   /note="gene_id=mCG1047093.1"
FT   mRNA            8887457..8889187
FT                   /pseudo
FT                   /locus_tag="mCG_1047093"
FT                   /note="gene_id=mCG1047093.1 transcript_id=mCT164797.1
FT                   created on 19-FEB-2003"
FT   assembly_gap    8890599..8890822
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    8897878..8897897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8899334..8899353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8901126..8901145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8908285..8908304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8940546..8940565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8948047..8948194
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    8957931..8961789
FT                   /estimated_length=3859
FT                   /gap_type="unknown"
FT   assembly_gap    8965220..8965636
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   assembly_gap    8974750..8976410
FT                   /estimated_length=1661
FT                   /gap_type="unknown"
FT   assembly_gap    8977935..8978534
FT                   /estimated_length=600
FT                   /gap_type="unknown"
FT   assembly_gap    9002646..9003113
FT                   /estimated_length=468
FT                   /gap_type="unknown"
FT   assembly_gap    9010766..9010785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9012067..9012086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9013550..9013860
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    9026012..9026165
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    9034156..9034175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9036304..9036323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9037626..9037645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9038896..9038915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9040054..9040175
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    9044347..9044366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9047236..9047255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9049487..9050984
FT                   /estimated_length=1498
FT                   /gap_type="unknown"
FT   assembly_gap    9053955..9053974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9063894..9063913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9067925..9067944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9069153..9069172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9070204..9070223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9071460..9071479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9075310..9075841
FT                   /estimated_length=532
FT                   /gap_type="unknown"
FT   assembly_gap    9113072..9113091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9115972..9115991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9119213..9119408
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    9130151..9130170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9165482..9165501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9166946..9168919
FT                   /estimated_length=1974
FT                   /gap_type="unknown"
FT   assembly_gap    9172551..9172570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9173846..9173865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9174959..9174978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9182176..9182195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9183824..9183843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9185062..9185081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9196552..9197388
FT                   /pseudo
FT                   /locus_tag="mCG_114893"
FT                   /note="gene_id=mCG114893.1"
FT   mRNA            9196552..9197388
FT                   /pseudo
FT                   /locus_tag="mCG_114893"
FT                   /note="gene_id=mCG114893.1 transcript_id=mCT115991.0
FT                   created on 01-APR-2003"
FT   assembly_gap    9204527..9204546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9206497..9206516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9208412..9237672
FT                   /gene="1200014M14Rik"
FT                   /locus_tag="mCG_114891"
FT                   /note="gene_id=mCG114891.1"
FT   mRNA            join(9208412..9208578,9211155..9211294,9212518..9212605,
FT                   9215269..9215386,9216534..9216611,9218682..9218872,
FT                   9220751..9220927,9222805..9222909,9223629..9223808,
FT                   9224933..9225086,9226459..9226736,9232650..9232826,
FT                   9236582..9237672)
FT                   /gene="1200014M14Rik"
FT                   /locus_tag="mCG_114891"
FT                   /product="RIKEN cDNA 1200014M14, transcript variant
FT                   mCT115989"
FT                   /note="gene_id=mCG114891.1 transcript_id=mCT115989.0
FT                   created on 27-NOV-2002"
FT   mRNA            join(9208412..9208578,9211155..9211294,9212518..9212605,
FT                   9215269..9215386,9216534..9216611,9218682..9218832,
FT                   9225071..9225086,9226459..9226736,9232650..9232826,
FT                   9236582..9237672)
FT                   /gene="1200014M14Rik"
FT                   /locus_tag="mCG_114891"
FT                   /product="RIKEN cDNA 1200014M14, transcript variant
FT                   mCT176313"
FT                   /note="gene_id=mCG114891.1 transcript_id=mCT176313.0
FT                   created on 27-NOV-2002"
FT   mRNA            join(9208448..9208578,9211155..9211294,9212518..9212605,
FT                   9216534..9216611,9218682..9218872,9220751..9220927,
FT                   9222805..9222909,9223629..9223808,9224933..9225086,
FT                   9226459..9226736,9232650..9232826,9236582..9237672)
FT                   /gene="1200014M14Rik"
FT                   /locus_tag="mCG_114891"
FT                   /product="RIKEN cDNA 1200014M14, transcript variant
FT                   mCT176312"
FT                   /note="gene_id=mCG114891.1 transcript_id=mCT176312.0
FT                   created on 27-NOV-2002"
FT   assembly_gap    9209909..9209928
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(9212528..9212605,9215269..9215386,9216534..9216611,
FT                   9218682..9218872,9220751..9220927,9222805..9222909,
FT                   9223629..9223808,9224933..9225086,9226459..9226736,
FT                   9232650..9232826,9236582..9236722)
FT                   /codon_start=1
FT                   /gene="1200014M14Rik"
FT                   /locus_tag="mCG_114891"
FT                   /product="RIKEN cDNA 1200014M14, isoform CRA_a"
FT                   /note="gene_id=mCG114891.1 transcript_id=mCT115989.0
FT                   protein_id=mCP51761.1 isoform=CRA_a"
FT                   /protein_id="EDL00893.1"
FT                   /translation="MSSDEDKCSLHVAHNDSDRSVSTDLQEEYEELLRYAIVNPNVECS
FT                   ASQPSHLRGEVAPDRFPTLAGNNPVRDTELEVGKGSDLNISSHSKSGSPRKPSHPVMDF
FT                   FSSHVLDDSSSPASLSTRTDAHEINGGEHLVSDENFQKLENILDIWSSGLKTNVLSELS
FT                   KWRLNFIDWHRMEMKKEKEKHAVVVKQLSNQISDLKELQKAFEISIGRKDEVISNLSRA
FT                   IGKQKERIELMKSFFRWRIGHVKSRQEIYEGKLADQYFQRTLLKKVWKGWRSVVQRQWK
FT                   DVVERACQARAEEVCVQISNDYEARLAMLSGALENAKAEIQKMQQEKDHFEDSMKKAFM
FT                   RGVCALNLEAMTIFQNKNEAGIDFTNNKKEESGPGGPGREPSAHLDTSSSTMPSAVPSQ
FT                   LLPSGPLAAGVASATAFPSAASLTSAGATSASSLHVPISILSAGSAAAPAPEESYAPRV
FT                   VTAAQQKAGKTITARITGRSDFGSKARINSSLAIMGVSPPMGSVVVEKHHPVTVQTIPQ
FT                   ATAAKYPRTIHPESSISASRSLGARPGHAQSLSVQSIKVVD"
FT   assembly_gap    9214937..9214956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(9218711..9218872,9220751..9220927,9222805..9222909,
FT                   9223629..9223808,9224933..9225086,9226459..9226736,
FT                   9232650..9232826,9236582..9236722)
FT                   /codon_start=1
FT                   /gene="1200014M14Rik"
FT                   /locus_tag="mCG_114891"
FT                   /product="RIKEN cDNA 1200014M14, isoform CRA_b"
FT                   /note="gene_id=mCG114891.1 transcript_id=mCT176312.0
FT                   protein_id=mCP99235.0 isoform=CRA_b"
FT                   /protein_id="EDL00894.1"
FT                   /translation="MDFFSSHVLDDSSSPASLSTRTDAHEINGGEHLVSDENFQKLENI
FT                   LDIWSSGLKTNVLSELSKWRLNFIDWHRMEMKKEKEKHAVVVKQLSNQISDLKELQKAF
FT                   EISIGRKDEVISNLSRAIGKQKERIELMKSFFRWRIGHVKSRQEIYEGKLADQYFQRTL
FT                   LKKVWKGWRSVVQRQWKDVVERACQARAEEVCVQISNDYEARLAMLSGALENAKAEIQK
FT                   MQQEKDHFEDSMKKAFMRGVCALNLEAMTIFQNKNEAGIDFTNNKKEESGPGGPGREPS
FT                   AHLDTSSSTMPSAVPSQLLPSGPLAAGVASATAFPSAASLTSAGATSASSLHVPISILS
FT                   AGSAAAPAPEESYAPRVVTAAQQKAGKTITARITGRSDFGSKARINSSLAIMGVSPPMG
FT                   SVVVEKHHPVTVQTIPQATAAKYPRTIHPESSISASRSLGARPGHAQSLSVQSIKVVD"
FT   CDS             join(9226551..9226736,9232650..9232826,9236582..9236722)
FT                   /codon_start=1
FT                   /gene="1200014M14Rik"
FT                   /locus_tag="mCG_114891"
FT                   /product="RIKEN cDNA 1200014M14, isoform CRA_c"
FT                   /note="gene_id=mCG114891.1 transcript_id=mCT176313.0
FT                   protein_id=mCP99234.0 isoform=CRA_c"
FT                   /protein_id="EDL00895.1"
FT                   /translation="MPSAVPSQLLPSGPLAAGVASATAFPSAASLTSAGATSASSLHVP
FT                   ISILSAGSAAAPAPEESYAPRVVTAAQQKAGKTITARITGRSDFGSKARINSSLAIMGV
FT                   SPPMGSVVVEKHHPVTVQTIPQATAAKYPRTIHPESSISASRSLGARPGHAQSLSVQSI
FT                   KVVD"
FT   gene            complement(9238237..>9258759)
FT                   /locus_tag="mCG_114896"
FT                   /note="gene_id=mCG114896.1"
FT   mRNA            complement(join(9238237..9240003,9241762..9241893,
FT                   9242817..9243018,9246898..9246993,9251926..9252024,
FT                   9255440..9255538,9258006..9258104,9258699..>9258759))
FT                   /locus_tag="mCG_114896"
FT                   /product="mCG114896, transcript variant mCT115995"
FT                   /note="gene_id=mCG114896.1 transcript_id=mCT115995.1
FT                   created on 26-NOV-2002"
FT   mRNA            complement(join(9238237..9240003,9255440..9255538,
FT                   9258006..>9258470))
FT                   /locus_tag="mCG_114896"
FT                   /product="mCG114896, transcript variant mCT176314"
FT                   /note="gene_id=mCG114896.1 transcript_id=mCT176314.0
FT                   created on 26-NOV-2002"
FT   mRNA            complement(join(9238860..9240003,9241762..9241893,
FT                   9242817..9243018,9246898..9246993,9251926..9252024,
FT                   9255440..9255538,9258006..>9258119))
FT                   /locus_tag="mCG_114896"
FT                   /product="mCG114896, transcript variant mCT189357"
FT                   /note="gene_id=mCG114896.1 transcript_id=mCT189357.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(9239890..9240003,9255440..9255538,
FT                   9258006..>9258140))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114896"
FT                   /product="mCG114896, isoform CRA_a"
FT                   /note="gene_id=mCG114896.1 transcript_id=mCT176314.0
FT                   protein_id=mCP99236.0 isoform=CRA_a"
FT                   /protein_id="EDL00890.1"
FT                   /translation="RDPLPSPICSLQLNVSALQTATRNGHTALVNFLLGENADLQQQKE
FT                   SKEPPLHLAVINNRPAVVNSLLSARHDVDVLDQKRFGSSKAKLTQAPRNVQSPKLKNTP
FT                   ITFLSSFSVGS"
FT   CDS             complement(join(9239942..9240003,9241762..9241893,
FT                   9242817..9243018,9246898..9246993,9251926..9252024,
FT                   9255440..9255538,9258006..9258104,9258699..>9258758))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114896"
FT                   /product="mCG114896, isoform CRA_c"
FT                   /note="gene_id=mCG114896.1 transcript_id=mCT115995.1
FT                   protein_id=mCP51839.1 isoform=CRA_c"
FT                   /protein_id="EDL00892.1"
FT                   /translation="EAIPGRAWNKGRSQIPLRAFLNVSALQTATRNGHTALVNFLLGEN
FT                   ADLQQQKESKEPPLHLAVINNRPAVVNSLLSARHDVDVLDQRRQTPLHVAADLGNVELV
FT                   ETLLKAGCNLKITDKQGKTALAVAARSQHSLVVDMLIKAERYYAWREEHRESIQDSAVS
FT                   STLTFKQDHSLETRQIRTLLWNLAYRQLKKKDWQRLARLWSFTEDQIRAIEEQWSGNDS
FT                   FHEHGYRALLIWLHGALLTQLDPAKQLYEELLCAGFPELAEKIRQFKSKTDSSSKKCAV
FT                   S"
FT   CDS             complement(join(9239942..9240003,9241762..9241893,
FT                   9242817..9243018,9246898..9246993,9251926..9252024,
FT                   9255440..9255538,9258006..>9258119))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114896"
FT                   /product="mCG114896, isoform CRA_b"
FT                   /note="gene_id=mCG114896.1 transcript_id=mCT189357.0
FT                   protein_id=mCP110341.0 isoform=CRA_b"
FT                   /protein_id="EDL00891.1"
FT                   /translation="ICSLQLNVSALQTATRNGHTALVNFLLGENADLQQQKESKEPPLH
FT                   LAVINNRPAVVNSLLSARHDVDVLDQRRQTPLHVAADLGNVELVETLLKAGCNLKITDK
FT                   QGKTALAVAARSQHSLVVDMLIKAERYYAWREEHRESIQDSAVSSTLTFKQDHSLETRQ
FT                   IRTLLWNLAYRQLKKKDWQRLARLWSFTEDQIRAIEEQWSGNDSFHEHGYRALLIWLHG
FT                   ALLTQLDPAKQLYEELLCAGFPELAEKIRQFKSKTDSSSKKCAVS"
FT   assembly_gap    9244983..9245028
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    9269251..9269270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9270929..9270948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9272076..9272095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9278898..9278917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9294628..9295234
FT                   /estimated_length=607
FT                   /gap_type="unknown"
FT   assembly_gap    9298083..9298102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9304439..9367351)
FT                   /gene="Polk"
FT                   /locus_tag="mCG_114892"
FT                   /note="gene_id=mCG114892.1"
FT   mRNA            complement(join(9304439..9306006,9306210..9306243,
FT                   9307243..9308157,9310554..9310725,9312928..9313024,
FT                   9314683..9314715,9317569..9317735,9319171..9319295,
FT                   9320367..9320606,9325279..9325432,9328264..9328395,
FT                   9331966..9332118,9340477..9340596,9344076..9344234,
FT                   9367099..9367351))
FT                   /gene="Polk"
FT                   /locus_tag="mCG_114892"
FT                   /product="polymerase (DNA directed), kappa, transcript
FT                   variant mCT115990"
FT                   /note="gene_id=mCG114892.1 transcript_id=mCT115990.1
FT                   created on 24-JUL-2002"
FT   mRNA            complement(join(9304439..9306006,9306210..9306243,
FT                   9307243..9308157,9310554..9310725,9312928..9313024,
FT                   9314683..9314715,9317569..9317735,9319171..9319295,
FT                   9320367..9320606,9325279..9325432,9328264..9328395,
FT                   9331966..9332118,9340477..9340596,9344076..9344234,
FT                   9366998..9367112))
FT                   /gene="Polk"
FT                   /locus_tag="mCG_114892"
FT                   /product="polymerase (DNA directed), kappa, transcript
FT                   variant mCT171115"
FT                   /note="gene_id=mCG114892.1 transcript_id=mCT171115.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(9305922..9306006,9306210..9306243,
FT                   9307243..9308157,9310554..9310725,9312928..9313024,
FT                   9314683..9314715,9317569..9317735,9319171..9319295,
FT                   9320367..9320606,9325279..9325432,9328264..9328395,
FT                   9331966..9332118,9340477..9340596,9344076..9344207))
FT                   /codon_start=1
FT                   /gene="Polk"
FT                   /locus_tag="mCG_114892"
FT                   /product="polymerase (DNA directed), kappa, isoform CRA_a"
FT                   /note="gene_id=mCG114892.1 transcript_id=mCT171115.0
FT                   protein_id=mCP94033.0 isoform=CRA_a"
FT                   /protein_id="EDL00888.1"
FT                   /translation="MDNTKEKDNFKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKG
FT                   SRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDKFAMELERNRNLNNTIVH
FT                   VDMDAFYAAVEMRDNPELKDKPIAVGSMSMLATSNYHARRFGVRAAMPGFIAKRLCPQL
FT                   IIVPPNFDKYRAVSKEVKEILAEYDPNFMAMSLDEAYLNITQHLQERQDWPEDKRRYFI
FT                   KMGNYLKIDTPRQEANELTEYERSISPLLFEDSPPDLQPQGSPFQLNSEEQNNPQIAQN
FT                   SVVFGTSAEEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPSRSA
FT                   VMDFIKDLPIRKVSGIGKVTEKMLMALGIVTCTELYQQRALLSLLFSETSWHYFLHIAL
FT                   GLGSTDLARDGERKSMSVERTFSEISKTEEQYSLCQELCAELAHDLQKEGLKGRTVTIK
FT                   LKNVNFEVKTRASTVPAAISTAEEIFAIAKELLRTEVNVGSPHPLRLRLMGVRMSTFSS
FT                   EDDRKHQQRSIIGFLQAGNQALSSTGDSLDKTDKTELAKPLEMSHKKSFFDKKRSERIS
FT                   NCQDTSRCKTAGQQALQILEPSQALKKLSESFETSENSNDCQTFICPVCFREQEGVSLE
FT                   AFNEHVDECLDGPSTSENSKISCYSHASSADIGQKEDVHPSIPLCEKRGHENGEITSVD
FT                   GVDLTGTEDRSLKAASMDTLENNRSKEECPDIPDKSCPISLANETISTLSRQDSVQPCT
FT                   DEVVTGRALVCPVCNLEQETSDLTLFNIHVDICLNKGIIQELRNSEGNSVKQPKESSRS
FT                   TDRLQKASGRTKRPGTKTKSSTLKKTKPRDPRHTLDGFFK"
FT   CDS             complement(join(9305922..9306006,9306210..9306243,
FT                   9307243..9308157,9310554..9310725,9312928..9313024,
FT                   9314683..9314715,9317569..9317735,9319171..9319295,
FT                   9320367..9320606,9325279..9325432,9328264..9328395,
FT                   9331966..9332118,9340477..9340596,9344076..9344207))
FT                   /codon_start=1
FT                   /gene="Polk"
FT                   /locus_tag="mCG_114892"
FT                   /product="polymerase (DNA directed), kappa, isoform CRA_a"
FT                   /note="gene_id=mCG114892.1 transcript_id=mCT115990.1
FT                   protein_id=mCP51826.1 isoform=CRA_a"
FT                   /protein_id="EDL00889.1"
FT                   /translation="MDNTKEKDNFKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKG
FT                   SRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDKFAMELERNRNLNNTIVH
FT                   VDMDAFYAAVEMRDNPELKDKPIAVGSMSMLATSNYHARRFGVRAAMPGFIAKRLCPQL
FT                   IIVPPNFDKYRAVSKEVKEILAEYDPNFMAMSLDEAYLNITQHLQERQDWPEDKRRYFI
FT                   KMGNYLKIDTPRQEANELTEYERSISPLLFEDSPPDLQPQGSPFQLNSEEQNNPQIAQN
FT                   SVVFGTSAEEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPSRSA
FT                   VMDFIKDLPIRKVSGIGKVTEKMLMALGIVTCTELYQQRALLSLLFSETSWHYFLHIAL
FT                   GLGSTDLARDGERKSMSVERTFSEISKTEEQYSLCQELCAELAHDLQKEGLKGRTVTIK
FT                   LKNVNFEVKTRASTVPAAISTAEEIFAIAKELLRTEVNVGSPHPLRLRLMGVRMSTFSS
FT                   EDDRKHQQRSIIGFLQAGNQALSSTGDSLDKTDKTELAKPLEMSHKKSFFDKKRSERIS
FT                   NCQDTSRCKTAGQQALQILEPSQALKKLSESFETSENSNDCQTFICPVCFREQEGVSLE
FT                   AFNEHVDECLDGPSTSENSKISCYSHASSADIGQKEDVHPSIPLCEKRGHENGEITSVD
FT                   GVDLTGTEDRSLKAASMDTLENNRSKEECPDIPDKSCPISLANETISTLSRQDSVQPCT
FT                   DEVVTGRALVCPVCNLEQETSDLTLFNIHVDICLNKGIIQELRNSEGNSVKQPKESSRS
FT                   TDRLQKASGRTKRPGTKTKSSTLKKTKPRDPRHTLDGFFK"
FT   assembly_gap    9358686..9358966
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   gene            9367509..9467575
FT                   /gene="Col4a3bp"
FT                   /locus_tag="mCG_114604"
FT                   /note="gene_id=mCG114604.1"
FT   mRNA            join(9367509..9368031,9373971..9374105,9396658..9396774,
FT                   9425187..9425294,9426372..9426510,9430052..9430135,
FT                   9436970..9437127,9439468..9439560,9442019..9442105,
FT                   9443702..9443794,9444239..9444316,9451899..9451994,
FT                   9456440..9456572,9458186..9458256,9461499..9461627,
FT                   9462280..9462409,9463176..9463312,9464544..9467575)
FT                   /gene="Col4a3bp"
FT                   /locus_tag="mCG_114604"
FT                   /product="procollagen, type IV, alpha 3 (Goodpasture
FT                   antigen) binding protein, transcript variant mCT115700"
FT                   /note="gene_id=mCG114604.1 transcript_id=mCT115700.1
FT                   created on 26-NOV-2002"
FT   mRNA            join(9367509..9368031,9373971..9374105,9396658..9396774,
FT                   9425187..9425294,9426372..9426510,9430052..9430135,
FT                   9436970..9437127,9439468..9439560,9442019..9442105,
FT                   9443702..9443794,9451899..9451994,9456440..9456572,
FT                   9458186..9458256,9461499..9461627,9462280..9462409,
FT                   9463176..9463312,9464544..9464977)
FT                   /gene="Col4a3bp"
FT                   /locus_tag="mCG_114604"
FT                   /product="procollagen, type IV, alpha 3 (Goodpasture
FT                   antigen) binding protein, transcript variant mCT176311"
FT                   /note="gene_id=mCG114604.1 transcript_id=mCT176311.0
FT                   created on 26-NOV-2002"
FT   CDS             join(9367936..9368031,9373971..9374105,9396658..9396774,
FT                   9425187..9425294,9426372..9426510,9430052..9430135,
FT                   9436970..9437127,9439468..9439560,9442019..9442105,
FT                   9443702..9443794,9444239..9444316,9451899..9451994,
FT                   9456440..9456572,9458186..9458256,9461499..9461627,
FT                   9462280..9462409,9463176..9463303)
FT                   /codon_start=1
FT                   /gene="Col4a3bp"
FT                   /locus_tag="mCG_114604"
FT                   /product="procollagen, type IV, alpha 3 (Goodpasture
FT                   antigen) binding protein, isoform CRA_b"
FT                   /note="gene_id=mCG114604.1 transcript_id=mCT115700.1
FT                   protein_id=mCP51976.1 isoform=CRA_b"
FT                   /protein_id="EDL00887.1"
FT                   /translation="MSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWV
FT                   VLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPEH
FT                   RQQWVDAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAE
FT                   METFRDILCRQVDTLQKYFDVCADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNG
FT                   NKEKLFPHVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREESWQKRHDREV
FT                   EKRRRVEEAYKNVMEELKKKPRFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQS
FT                   QSEKVRLHWPTSLPSGDTFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEE
FT                   MVQNHMNYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEV
FT                   CNYFWNVDVRNDWETTIENFHVVETLADNAIIVYQTHKRVWPASQRDVLYLSAIRKIPA
FT                   LTENDPETWIVCNFSVDHDSAPLNNRCVRAKINIAMICQTLVSPPEGDQEISRDNILCK
FT                   ITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF"
FT   CDS             join(9367936..9368031,9373971..9374105,9396658..9396774,
FT                   9425187..9425294,9426372..9426510,9430052..9430135,
FT                   9436970..9437127,9439468..9439560,9442019..9442105,
FT                   9443702..9443794,9451899..9451994,9456440..9456572,
FT                   9458186..9458256,9461499..9461627,9462280..9462409,
FT                   9463176..9463303)
FT                   /codon_start=1
FT                   /gene="Col4a3bp"
FT                   /locus_tag="mCG_114604"
FT                   /product="procollagen, type IV, alpha 3 (Goodpasture
FT                   antigen) binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG114604.1 transcript_id=mCT176311.0
FT                   protein_id=mCP99233.0 isoform=CRA_a"
FT                   /protein_id="EDL00886.1"
FT                   /translation="MSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWV
FT                   VLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPEH
FT                   RQQWVDAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAE
FT                   METFRDILCRQVDTLQKYFDVCADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNG
FT                   NKEKLFPHVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREESWQKRHDREV
FT                   EKRRRVEEAYKNVMEELKKKPRFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQS
FT                   QSEKVRLHWPTSLPSGDTFSSVGTHRFVQKVEEMVQNHMNYSLQDVGGDANWQLVVEEG
FT                   EMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETL
FT                   ADNAIIVYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIVCNFSVDHDSAPLNNR
FT                   CVRAKINIAMICQTLVSPPEGDQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREY
FT                   PKFLKRFTSYVQEKTAGKPILF"
FT   assembly_gap    9412307..9412326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9471287..>9473973)
FT                   /locus_tag="mCG_1047192"
FT                   /note="gene_id=mCG1047192.1"
FT   mRNA            complement(join(9471287..9471332,9473640..9473801,
FT                   9473832..>9473973))
FT                   /locus_tag="mCG_1047192"
FT                   /product="mCG1047192"
FT                   /note="gene_id=mCG1047192.1 transcript_id=mCT164896.1
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(9473767..9473801,9473832..>9473973))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047192"
FT                   /product="mCG1047192"
FT                   /note="gene_id=mCG1047192.1 transcript_id=mCT164896.1
FT                   protein_id=mCP51754.1"
FT                   /protein_id="EDL00885.1"
FT                   /translation="RYLRSCSDQHMCPHIFVPHPVYISIPTSLPTCLFVPGLQAYNHTT
FT                   LGKKEKKSLILPC"
FT   gene            complement(9476408..9498374)
FT                   /gene="Hmgcr"
FT                   /locus_tag="mCG_114611"
FT                   /note="gene_id=mCG114611.1"
FT   mRNA            complement(join(9476408..9478076,9478448..9478602,
FT                   9479294..9479452,9479534..9479674,9480096..9480266,
FT                   9482255..9482360,9482990..9483147,9483294..9483452,
FT                   9483999..9484193,9486023..9486198,9486311..9486558,
FT                   9486657..9486817,9487334..9487450,9487558..9487664,
FT                   9490466..9490571,9492198..9492282,9493246..9493333,
FT                   9493549..9493660,9493957..9494144,9498336..9498374))
FT                   /gene="Hmgcr"
FT                   /locus_tag="mCG_114611"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A reductase"
FT                   /note="gene_id=mCG114611.1 transcript_id=mCT115706.0
FT                   created on 26-NOV-2002"
FT   CDS             complement(join(9478022..9478076,9478448..9478602,
FT                   9479294..9479452,9479534..9479674,9480096..9480266,
FT                   9482255..9482360,9482990..9483147,9483294..9483452,
FT                   9483999..9484193,9486023..9486198,9486311..9486558,
FT                   9486657..9486817,9487334..9487450,9487558..9487664,
FT                   9490466..9490571,9492198..9492282,9493246..9493333,
FT                   9493549..9493660,9493957..9494121))
FT                   /codon_start=1
FT                   /gene="Hmgcr"
FT                   /locus_tag="mCG_114611"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A reductase"
FT                   /note="gene_id=mCG114611.1 transcript_id=mCT115706.0
FT                   protein_id=mCP51819.1"
FT                   /db_xref="GOA:Q01237"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR004816"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="InterPro:IPR023282"
FT                   /db_xref="MGI:MGI:96159"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01237"
FT                   /protein_id="EDL00884.1"
FT                   /translation="MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICG
FT                   WNYECPKFEEDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSF
FT                   VFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASALAKFALSSNSQDEVRENIARGMAI
FT                   LGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLEL
FT                   SRESREGRPIWQLSHFARVLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQN
FT                   STAEQAKVSLGLDEDVSKRIEPSVSLWQFYLSKMISMDIEQVITLSLAFLLAVKYIFFE
FT                   QAETESTLSLKNPITSPVVTSKKAQDNCCRREPLLVRRNQKLSSVEEDPGANQERKVEV
FT                   IKPLVVEAETTSRATFVLGASVASPPSALGTQEPGIELPIEPRPNEECLQILENAEKGA
FT                   KFLSDAEIIQLVNAKHIPAYKLETLMETHERGVSIRRQLLSTKLAEPSSLQYLPYRDYN
FT                   YSLVMGACCENVIGYMPIPVGVAGPLCLDGKEYQVPMATTEGCLVASTNRGCRAISLGG
FT                   GASSRVLADGMTRGPVVRLPRACDSAEVKTWLETPEGFAVIKEAFDSTSRFARLQKLHV
FT                   TMAGRNLYIRFQSRTGDAMGMNMISKGTEKALLKLQEFFPDMQILAVSGNYCTDKKPAA
FT                   INWIEGRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAA
FT                   NIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLP
FT                   QQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVRSHMVHNRS
FT                   KINLQDLQGTCTKKAA"
FT   assembly_gap    9524233..9524252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9525686..9525964
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    9533093..9533538
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    9570554..9570703
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   gene            <9605262..9606801
FT                   /locus_tag="mCG_1047122"
FT                   /note="gene_id=mCG1047122.1"
FT   mRNA            join(<9605262..9605839,9606738..9606801)
FT                   /locus_tag="mCG_1047122"
FT                   /product="mCG1047122"
FT                   /note="gene_id=mCG1047122.1 transcript_id=mCT164826.0
FT                   created on 19-FEB-2003"
FT   CDS             <9605263..9605430
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047122"
FT                   /product="mCG1047122"
FT                   /note="gene_id=mCG1047122.1 transcript_id=mCT164826.0
FT                   protein_id=mCP51744.0"
FT                   /protein_id="EDL00883.1"
FT                   /translation="ELLKNSQYSQCHFLTLKFHGVTKTLEVSFHEHQYVREPVRVDVFH
FT                   VAPQRTGAEG"
FT   gene            <9612474..>9657781
FT                   /locus_tag="mCG_114614"
FT                   /note="gene_id=mCG114614.1"
FT   mRNA            join(<9612474..9612548,9617667..9617710,9624673..9624836,
FT                   9625333..9625409,9630049..9630204,9647248..9647390,
FT                   9652127..9652157,9656463..9656491,9657359..>9657781)
FT                   /locus_tag="mCG_114614"
FT                   /product="mCG114614"
FT                   /note="gene_id=mCG114614.1 transcript_id=mCT115708.1
FT                   created on 26-NOV-2002"
FT   CDS             join(<9612476..9612548,9617667..9617710,9624673..9624836,
FT                   9625333..9625409,9630049..9630204,9647248..9647390,
FT                   9652127..9652157,9656463..9656491,9657359..>9657781)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114614"
FT                   /product="mCG114614"
FT                   /note="gene_id=mCG114614.1 transcript_id=mCT115708.1
FT                   protein_id=mCP51827.1"
FT                   /protein_id="EDL00882.1"
FT                   /translation="ECWYSPKFRLRAEFFRWEPRFEVEGHEAENCENLPHSKKETPRVL
FT                   RRSSRLEKLKASRDVVHTEAVLKKPERILSNTLSFKDQINSIFTTDSFSKRKNMHSSGF
FT                   KNEQIRKSEQLRKKNGTGEMKKMCLCTINRRNVFGENLLYKAALHNDVDLVRCCIKNGE
FT                   NVNQPSYDGWTALHEASIGGYYQAVSELLKGGADVNVKGKYQITPLHDAVMNRHYKIPQ
FT                   QKKCHLSAQRNSTDPAHKPKLSSNNYTEFICDENFDRQEPGHLEINKGSNNLLMSKEYV
FT                   CEHCQKDSNTTKFGKSNLNSVKNSRTNVSKRKGQKNRQQKKTQVDDRDCNLSQKIGTSS
FT                   FRRTNKLLTQQQHAVQTLSDLPEESFELSTTTLSSLENGI"
FT   assembly_gap    9614880..9615011
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    9668710..9670541
FT                   /estimated_length=1832
FT                   /gap_type="unknown"
FT   assembly_gap    9671281..9675454
FT                   /estimated_length=4174
FT                   /gap_type="unknown"
FT   assembly_gap    9688606..9688625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <9749455..>9771258
FT                   /locus_tag="mCG_114607"
FT                   /note="gene_id=mCG114607.1"
FT   mRNA            join(<9749455..9749675,9760611..9760727,9770982..>9771258)
FT                   /locus_tag="mCG_114607"
FT                   /product="mCG114607"
FT                   /note="gene_id=mCG114607.1 transcript_id=mCT115703.1
FT                   created on 26-NOV-2002"
FT   CDS             join(<9760678..9760727,9770982..>9771258)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114607"
FT                   /product="mCG114607"
FT                   /note="gene_id=mCG114607.1 transcript_id=mCT115703.1
FT                   protein_id=mCP51985.1"
FT                   /protein_id="EDL00881.1"
FT                   /translation="LSCPAVPLRPLFLLFCRMKIFRCCFKYTLQQKLFILLLTLWLFSL
FT                   LKLLNVGRLLFPQRDIYLVEYSLSTSPFVRNRFPESGDAARDNVNCSGVYEHEPLEIGK
FT                   SLEIR"
FT   assembly_gap    9798134..9798153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9799455..9799704
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    9801110..9801129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9818481..9818500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9821876..9821895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9834270..9834667
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    9835398..9835964
FT                   /estimated_length=567
FT                   /gap_type="unknown"
FT   assembly_gap    9840307..9840441
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   gene            complement(9848601..9861274)
FT                   /gene="1700029F12Rik"
FT                   /locus_tag="mCG_114606"
FT                   /note="gene_id=mCG114606.1"
FT   mRNA            complement(join(9848601..9848734,9848908..9849348,
FT                   9856954..9857175,9861159..9861274))
FT                   /gene="1700029F12Rik"
FT                   /locus_tag="mCG_114606"
FT                   /product="RIKEN cDNA 1700029F12"
FT                   /note="gene_id=mCG114606.1 transcript_id=mCT115702.0
FT                   created on 26-NOV-2002"
FT   assembly_gap    9848735..9848907
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   CDS             complement(join(9849211..9849348,9856954..9857175,
FT                   9861159..9861242))
FT                   /codon_start=1
FT                   /gene="1700029F12Rik"
FT                   /locus_tag="mCG_114606"
FT                   /product="RIKEN cDNA 1700029F12"
FT                   /note="gene_id=mCG114606.1 transcript_id=mCT115702.0
FT                   protein_id=mCP51979.1"
FT                   /protein_id="EDL00880.1"
FT                   /translation="MGFRQESDIGQDWDVSSDRNLTSGHDKEDSCGAQAAPSVTVKPPL
FT                   TRRTPVTWTANTACSHCYTAWTPSADTCHHSPRGLSVLLQAMAAAATTAMRLTDFYHDY
FT                   QPLSTEDQLSTEEPDANVYQVDPDGESQLHPKTDDAPRQQEAA"
FT   assembly_gap    9859164..9859183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9867750..9867769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9872444..9873359
FT                   /estimated_length=916
FT                   /gap_type="unknown"
FT   assembly_gap    9876783..9877707
FT                   /estimated_length=925
FT                   /gap_type="unknown"
FT   assembly_gap    9884368..9884395
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    9893074..9893756
FT                   /estimated_length=683
FT                   /gap_type="unknown"
FT   assembly_gap    9907585..9907835
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   gene            9913166..9951648
FT                   /locus_tag="mCG_114609"
FT                   /note="gene_id=mCG114609.1"
FT   mRNA            join(9913166..9913301,9914940..9915039,9915412..9915497,
FT                   9918898..9919069,9928525..9928704,9931594..9931722,
FT                   9932861..9932967,9935205..9935244,9935675..9935825,
FT                   9939981..9940137,9944300..9944500,9948096..9951648)
FT                   /locus_tag="mCG_114609"
FT                   /product="mCG114609"
FT                   /note="gene_id=mCG114609.1 transcript_id=mCT115705.1
FT                   created on 26-NOV-2002"
FT   CDS             join(9913170..9913301,9914940..9915039,9915412..9915497,
FT                   9918898..9919069,9928525..9928704,9931594..9931722,
FT                   9932861..9932967,9935205..9935244,9935675..9935825,
FT                   9939981..9940137,9944300..9944500,9948096..9948638)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114609"
FT                   /product="mCG114609"
FT                   /note="gene_id=mCG114609.1 transcript_id=mCT115705.1
FT                   protein_id=mCP51814.1"
FT                   /protein_id="EDL00879.1"
FT                   /translation="MAFPVDLLDNCTHEELENSSEDYLSSLRCGDPEHPECFSSLNITI
FT                   PVSLSNVGFVPLYGGNQTQKILALFAPEDSLTAVALYLVGQWWAIDDIVKTSEPSREGL
FT                   KQVSTLGERVVLYVLNRIIYRKQEMERNEIPFLCHSSTDYAKILWKKGEAVGFYSVKPT
FT                   GSLCASFLTQNYQLPVLDTMFIRKKYRGKDLGLHMLEDFVDSFTEDALGLRYPLSSLMY
FT                   TASKQYFEKYPGDHELLWEVEGVGHWHQRVPVTRALQREAIKATDVSQYEATRPVSGEY
FT                   GLAAVPEHEPGLDDTQSSELQIHSLKDAFASTSEGPEKTPVSTRTRSSHLKRPKIGKRF
FT                   QDSEFSSSQGEDENVAKTSPTASVNKIEYAARTSESSEEFLEEEPEQGVIDFEDESGDK
FT                   DAQPALETQPRLQKQDGDKDSALEPVNGEVMDAALKPSLTTEDEDSTSEGLEEDLKVPP
FT                   FNSSGEPGNPVPLVAESSKVPEATLAKTSPDTDSEMLIDQSPSDDKGHTEENLSPVSKK
FT                   KTLLGSSDNVATVSNIEKSDGNFPNSVVPEFPEEPVSQNLSPNTTSSVEDQGEEGAPEA
FT                   QEPSATQSSLIEVELEDAPFPQNAGQKSQSEEQSEASSEHLEQFTQSAEKAVDSSSEEI
FT                   EVEVPVVDRRNLRRKAKGHKGPGKKKAKLT"
FT   assembly_gap    9919560..9920161
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   assembly_gap    9923776..9923795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9924953..9924972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9951649..9952089
FT                   /estimated_length=441
FT                   /gap_type="unknown"
FT   gene            complement(9952090..9959433)
FT                   /locus_tag="mCG_114602"
FT                   /note="gene_id=mCG114602.1"
FT   mRNA            complement(join(9952090..9952808,9953423..9953615,
FT                   9955119..9955298,9956874..9957024,9957101..9957288,
FT                   9959335..9959433))
FT                   /locus_tag="mCG_114602"
FT                   /product="mCG114602"
FT                   /note="gene_id=mCG114602.1 transcript_id=mCT115698.1
FT                   created on 26-NOV-2002"
FT   CDS             complement(join(9952741..9952808,9953423..9953615,
FT                   9955119..9955298,9956874..9957024,9957101..9957288,
FT                   9959335..9959337))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114602"
FT                   /product="mCG114602"
FT                   /note="gene_id=mCG114602.1 transcript_id=mCT115698.1
FT                   protein_id=mCP51963.1"
FT                   /protein_id="EDL00878.1"
FT                   /translation="MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGL
FT                   KAKLYHKQRHAEKIQMKKTIKMHEKRNTKQKDDEKTPQGAVPAYLLDREGQSRAKVLSN
FT                   MIKQKRKEKAGKWEVPLPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRK
FT                   PPKYERFIRPMGLRFKKAHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEV
FT                   NVSELGLVTQGGKVIWGKYAQVTNNPENDGCINAVLLV"
FT   gene            <9959516..9997671
FT                   /gene="Gfm2"
FT                   /locus_tag="mCG_114608"
FT                   /note="gene_id=mCG114608.2"
FT   mRNA            join(<9959516..9959606,9963512..9963595,9964593..9964677,
FT                   9967235..9967292,9967808..9967905,9970926..9971051,
FT                   9971943..9972031,9974846..9974934,9976809..9976869,
FT                   9977040..9977219,9982380..9982528,9984229..9984369,
FT                   9984452..9984551,9986382..9986568,9989713..9989789,
FT                   9992717..9992855,9993742..9993921,9994170..9994285,
FT                   9996092..9996274,9996830..9997671)
FT                   /gene="Gfm2"
FT                   /locus_tag="mCG_114608"
FT                   /product="G elongation factor, mitochondrial 2, transcript
FT                   variant mCT189354"
FT                   /note="gene_id=mCG114608.2 transcript_id=mCT189354.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<9959578..9959606,9963512..9963595,9964593..9964677,
FT                   9967235..9967292,9967808..9967905,9970926..9971051,
FT                   9971943..9972031,9974846..9974934,9976809..9976869,
FT                   9977040..9977219,9981474..9981554,9982380..9982528,
FT                   9984229..9984369,9984452..9984551,9986382..9986568,
FT                   9989713..9989789,9992717..9992855,9993742..9993921,
FT                   9994170..9994285,9996092..9996274,9996830..9997496)
FT                   /gene="Gfm2"
FT                   /locus_tag="mCG_114608"
FT                   /product="G elongation factor, mitochondrial 2, transcript
FT                   variant mCT189355"
FT                   /note="gene_id=mCG114608.2 transcript_id=mCT189355.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(9959620..9959639,9963512..9963595,9964593..9964677,
FT                   9967241..9967292,9967808..9967905,9970926..9971051,
FT                   9971943..9972031,9974846..9974934,9976809..9976869,
FT                   9977040..9977219,9981474..9981554,9982380..9982528,
FT                   9984229..9984369,9984452..9984551,9986382..9986568,
FT                   9989713..9989789,9992717..9992855,9993742..9993921,
FT                   9994170..9994285,9996092..9996274,9996830..9997671)
FT                   /gene="Gfm2"
FT                   /locus_tag="mCG_114608"
FT                   /product="G elongation factor, mitochondrial 2, transcript
FT                   variant mCT115704"
FT                   /note="gene_id=mCG114608.2 transcript_id=mCT115704.1
FT                   created on 26-NOV-2002"
FT   CDS             join(<9963524..9963595,9964593..9964677,9967235..9967292,
FT                   9967808..9967905,9970926..9971051,9971943..9972031,
FT                   9974846..9974934,9976809..9976869,9977040..9977219,
FT                   9981474..9981554,9982380..9982528,9984229..9984369,
FT                   9984452..9984551,9986382..9986568,9989713..9989789,
FT                   9992717..9992855,9993742..9993921,9994170..9994285,
FT                   9996092..9996274,9996830..9996967)
FT                   /codon_start=1
FT                   /gene="Gfm2"
FT                   /locus_tag="mCG_114608"
FT                   /product="G elongation factor, mitochondrial 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG114608.2 transcript_id=mCT189355.0
FT                   protein_id=mCP110340.0 isoform=CRA_c"
FT                   /protein_id="EDL00877.1"
FT                   /translation="RTTMFTKWRIFAVNHQRTFSVHLNTMCYCKIKANLKRLKTQLPLT
FT                   RNYSSAPGIAGSDVKSLHSVINPPVAKIRNIGIMAHIDAGKTTTTERILYYSGYTRSLG
FT                   DVDDGDTVTDFMAQERERGITIQSAAVTLDWKGYRVNLIDTPGHVDFTLEVERCLRVLD
FT                   GAVAVFDASAGVEAQTLTVWRQADKHKIPRICFLNKMDKTGASFNYAVESIREKLKAKP
FT                   LILQLPIGEARTFQGVVDVVNKEKLLWNSNSDDGKDFERMPLSEASDRELLKETIEARN
FT                   SLIEQVADLDDEFADLVLGEFSENFDLVPAKKLQAAVHRVTLAQAAVPVLCGSALKNKG
FT                   VQPLLDAVTTYLPSPEEREDRFLQWYEGDLCALAFKVLHDKQRGPLVFLRIYSGTLTPQ
FT                   LAVHNINRNCTERMSRLLLPFADQHVEIPSLTAGNIALTVGLKQTATGDTIVSSKSSAL
FT                   AAARRAGRGEREHGKKREAESLLLAGVEVPEPVFFCTIEPPSVAKQPDLDHALERLQRE
FT                   DPSLKVKLDPDSGQTVLCGMGELHIEIIHDRIKREYGLETYLGPLQVAYRETILNSVRA
FT                   TDTLDRVLGDKRHLVSAELEVRPAEEPCAVAKIEYADCVGEDLLQASREAIESAVHSAC
FT                   LQGPLLGSPVQDVAMTLHSLMIHPGTSTTMVTACISRCMQKALKKADKQVLEPLMSLEV
FT                   TVSREYLSPVLADLAQRRGNIQEIQTRQDNRVVLGFVPLAEIMGYSTVLRTLTSGSATF
FT                   ALELSTYQAMSPQDQSALLNQRSGLAHVL"
FT   CDS             join(<9963524..9963595,9964593..9964677,9967235..9967292,
FT                   9967808..9967905,9970926..9971051,9971943..9972031,
FT                   9974846..9974934,9976809..9976869,9977040..9977219,
FT                   9982380..9982528,9984229..9984369,9984452..9984551,
FT                   9986382..9986568,9989713..9989789,9992717..9992855,
FT                   9993742..9993921,9994170..9994285,9996092..9996274,
FT                   9996830..9996967)
FT                   /codon_start=1
FT                   /gene="Gfm2"
FT                   /locus_tag="mCG_114608"
FT                   /product="G elongation factor, mitochondrial 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG114608.2 transcript_id=mCT189354.0
FT                   protein_id=mCP110339.0 isoform=CRA_b"
FT                   /protein_id="EDL00876.1"
FT                   /translation="RTTMFTKWRIFAVNHQRTFSVHLNTMCYCKIKANLKRLKTQLPLT
FT                   RNYSSAPGIAGSDVKSLHSVINPPVAKIRNIGIMAHIDAGKTTTTERILYYSGYTRSLG
FT                   DVDDGDTVTDFMAQERERGITIQSAAVTLDWKGYRVNLIDTPGHVDFTLEVERCLRVLD
FT                   GAVAVFDASAGVEAQTLTVWRQADKHKIPRICFLNKMDKTGASFNYAVESIREKLKAKP
FT                   LILQLPIGEARTFQGVVDVVNKEKLLWNSNSDDGKDFERMPLSEASDRELLKETIEARN
FT                   SLIEQLQAAVHRVTLAQAAVPVLCGSALKNKGVQPLLDAVTTYLPSPEEREDRFLQWYE
FT                   GDLCALAFKVLHDKQRGPLVFLRIYSGTLTPQLAVHNINRNCTERMSRLLLPFADQHVE
FT                   IPSLTAGNIALTVGLKQTATGDTIVSSKSSALAAARRAGRGEREHGKKREAESLLLAGV
FT                   EVPEPVFFCTIEPPSVAKQPDLDHALERLQREDPSLKVKLDPDSGQTVLCGMGELHIEI
FT                   IHDRIKREYGLETYLGPLQVAYRETILNSVRATDTLDRVLGDKRHLVSAELEVRPAEEP
FT                   CAVAKIEYADCVGEDLLQASREAIESAVHSACLQGPLLGSPVQDVAMTLHSLMIHPGTS
FT                   TTMVTACISRCMQKALKKADKQVLEPLMSLEVTVSREYLSPVLADLAQRRGNIQEIQTR
FT                   QDNRVVLGFVPLAEIMGYSTVLRTLTSGSATFALELSTYQAMSPQDQSALLNQRSGLAH
FT                   VL"
FT   CDS             join(9963533..9963595,9964593..9964677,9967241..9967292,
FT                   9967808..9967905,9970926..9971051,9971943..9972031,
FT                   9974846..9974934,9976809..9976869,9977040..9977219,
FT                   9981474..9981554,9982380..9982528,9984229..9984369,
FT                   9984452..9984551,9986382..9986568,9989713..9989789,
FT                   9992717..9992855,9993742..9993921,9994170..9994285,
FT                   9996092..9996274,9996830..9996967)
FT                   /codon_start=1
FT                   /gene="Gfm2"
FT                   /locus_tag="mCG_114608"
FT                   /product="G elongation factor, mitochondrial 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG114608.2 transcript_id=mCT115704.1
FT                   protein_id=mCP51800.1 isoform=CRA_a"
FT                   /protein_id="EDL00875.1"
FT                   /translation="MFTKWRIFAVNHQRTFSVHLNTMCYCKIKANLKRLKTQLPLTRNY
FT                   SSAPAGSDVKSLHSVINPPVAKIRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDG
FT                   DTVTDFMAQERERGITIQSAAVTLDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAV
FT                   FDASAGVEAQTLTVWRQADKHKIPRICFLNKMDKTGASFNYAVESIREKLKAKPLILQL
FT                   PIGEARTFQGVVDVVNKEKLLWNSNSDDGKDFERMPLSEASDRELLKETIEARNSLIEQ
FT                   VADLDDEFADLVLGEFSENFDLVPAKKLQAAVHRVTLAQAAVPVLCGSALKNKGVQPLL
FT                   DAVTTYLPSPEEREDRFLQWYEGDLCALAFKVLHDKQRGPLVFLRIYSGTLTPQLAVHN
FT                   INRNCTERMSRLLLPFADQHVEIPSLTAGNIALTVGLKQTATGDTIVSSKSSALAAARR
FT                   AGRGEREHGKKREAESLLLAGVEVPEPVFFCTIEPPSVAKQPDLDHALERLQREDPSLK
FT                   VKLDPDSGQTVLCGMGELHIEIIHDRIKREYGLETYLGPLQVAYRETILNSVRATDTLD
FT                   RVLGDKRHLVSAELEVRPAEEPCAVAKIEYADCVGEDLLQASREAIESAVHSACLQGPL
FT                   LGSPVQDVAMTLHSLMIHPGTSTTMVTACISRCMQKALKKADKQVLEPLMSLEVTVSRE
FT                   YLSPVLADLAQRRGNIQEIQTRQDNRVVLGFVPLAEIMGYSTVLRTLTSGSATFALELS
FT                   TYQAMSPQDQSALLNQRSGLAHVL"
FT   assembly_gap    9969818..9970189
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    9987177..9987606
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    9990221..9990240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9997016..>10018865)
FT                   /gene="Hexb"
FT                   /locus_tag="mCG_114603"
FT                   /note="gene_id=mCG114603.1"
FT   mRNA            complement(join(9997016..9997819,9998027..9998131,
FT                   9998286..9998376,9999110..9999284,10000574..10000646,
FT                   10002312..10002398,10003063..10003243,10004907..10005036,
FT                   10006798..10006899,10010192..10010302,10010536..10010582,
FT                   10012443..10012508,10015259..10015405,10018621..>10018865))
FT                   /gene="Hexb"
FT                   /locus_tag="mCG_114603"
FT                   /product="hexosaminidase B, transcript variant mCT115699"
FT                   /note="gene_id=mCG114603.1 transcript_id=mCT115699.1
FT                   created on 16-JUN-2003"
FT   mRNA            complement(join(9997554..9998131,9998286..9998376,
FT                   9999110..9999284,10000574..10000646,10002312..10002398,
FT                   10003063..10003243,10004907..10005036,10006798..10006899,
FT                   10010192..10010302,10010536..10010582,10012443..10012508,
FT                   10015259..10015405,10018621..>10018865))
FT                   /gene="Hexb"
FT                   /locus_tag="mCG_114603"
FT                   /product="hexosaminidase B, transcript variant mCT185829"
FT                   /note="gene_id=mCG114603.1 transcript_id=mCT185829.0
FT                   created on 16-JUN-2003"
FT   mRNA            complement(join(9997559..9997819,9998027..9998131,
FT                   9998286..9998376,9999110..9999284,10000574..10000646,
FT                   10003063..10003243,10004907..10005036,10006798..10006899,
FT                   10010192..10010302,10010536..10010582,10012443..10012508,
FT                   10015259..10015405,10018621..>10018865))
FT                   /gene="Hexb"
FT                   /locus_tag="mCG_114603"
FT                   /product="hexosaminidase B, transcript variant mCT185828"
FT                   /note="gene_id=mCG114603.1 transcript_id=mCT185828.0
FT                   created on 16-JUN-2003"
FT   CDS             complement(join(9997759..9997819,9998027..9998131,
FT                   9998286..9998376,9999110..9999284,10000574..10000646,
FT                   10003063..10003243,10004907..10005036,10006798..10006899,
FT                   10010192..10010302,10010536..10010582,10012443..10012508,
FT                   10015259..10015405,10018621..>10018780))
FT                   /codon_start=1
FT                   /gene="Hexb"
FT                   /locus_tag="mCG_114603"
FT                   /product="hexosaminidase B, isoform CRA_b"
FT                   /note="gene_id=mCG114603.1 transcript_id=mCT185828.0
FT                   protein_id=mCP107086.0 isoform=CRA_b"
FT                   /protein_id="EDL00873.1"
FT                   /translation="WPRPDCNLRYGPSRARCRCSRGCCTSPRRTSASTTVPIPQRALPA
FT                   RCYRRRFGDITTMFLVSTRRHHGPARFRAEPQLQKLLVSITLESECESFPSLSSDETYS
FT                   LLVQEPVAVLKANSVWGALRGLETFSQLVYQDSFGTFTINESSIADSPRFPHRGILIDT
FT                   SRHFLPVKTILKTLDAMAFNKFNVLHWHIVDDQSFPYQSTTFPELSNKGSYSLSHVYTP
FT                   NDVRMVLEYARLRGIRVIPEFDTPGHTQSWGKGQKNLLTPCYNQKTKTQVFGPVDPTVN
FT                   TTYAFFNTFFKEISSVFPDQFIHLGGDEVEFQCWILEIISSLKKNSIVWQEVFDDKVEL
FT                   QPGTVVEVWKSEHYSYELKQVTGSGFPAILSAPWYLDLISYGQDWKNYYKVEPLNFEGS
FT                   EKQKQLVIGGEACLWGEFVDATNLTPRLWPRASAVGERLWSPKTVTDLENAYKRLAVHR
FT                   CRMVSRGIAAQPLYTGYCNYENKI"
FT   CDS             complement(join(9997759..9997819,9998027..9998131,
FT                   9998286..9998376,9999110..9999284,10000574..10000646,
FT                   10002312..10002398,10003063..10003243,10004907..10005036,
FT                   10006798..10006899,10010192..10010302,10010536..10010582,
FT                   10012443..10012508,10015259..10015405,10018621..>10018780))
FT                   /codon_start=1
FT                   /gene="Hexb"
FT                   /locus_tag="mCG_114603"
FT                   /product="hexosaminidase B, isoform CRA_a"
FT                   /note="gene_id=mCG114603.1 transcript_id=mCT115699.1
FT                   protein_id=mCP51968.0 isoform=CRA_a"
FT                   /protein_id="EDL00872.1"
FT                   /translation="WPRPDCNLRYGPSRARCRCSRGCCTSPRRTSASTTVPIPQRALPA
FT                   RCYRRRFGDITTMFLVSTRRHHGPARFRAEPQLQKLLVSITLESECESFPSLSSDETYS
FT                   LLVQEPVAVLKANSVWGALRGLETFSQLVYQDSFGTFTINESSIADSPRFPHRGILIDT
FT                   SRHFLPVKTILKTLDAMAFNKFNVLHWHIVDDQSFPYQSTTFPELSNKGSYSLSHVYTP
FT                   NDVRMVLEYARLRGIRVIPEFDTPGHTQSWGKGQKNLLTPCYNQKTKTQVFGPVDPTVN
FT                   TTYAFFNTFFKEISSVFPDQFIHLGGDEVEFQCWASNPNIQGFMKRKGFGSDFRRLESF
FT                   YIKKILEIISSLKKNSIVWQEVFDDKVELQPGTVVEVWKSEHYSYELKQVTGSGFPAIL
FT                   SAPWYLDLISYGQDWKNYYKVEPLNFEGSEKQKQLVIGGEACLWGEFVDATNLTPRLWP
FT                   RASAVGERLWSPKTVTDLENAYKRLAVHRCRMVSRGIAAQPLYTGYCNYENKI"
FT   CDS             complement(join(9998023..9998131,9998286..9998376,
FT                   9999110..9999284,10000574..10000646,10002312..10002398,
FT                   10003063..10003243,10004907..10005036,10006798..10006899,
FT                   10010192..10010302,10010536..10010582,10012443..10012508,
FT                   10015259..10015405,10018621..>10018780))
FT                   /codon_start=1
FT                   /gene="Hexb"
FT                   /locus_tag="mCG_114603"
FT                   /product="hexosaminidase B, isoform CRA_c"
FT                   /note="gene_id=mCG114603.1 transcript_id=mCT185829.0
FT                   protein_id=mCP107087.0 isoform=CRA_c"
FT                   /protein_id="EDL00874.1"
FT                   /translation="WPRPDCNLRYGPSRARCRCSRGCCTSPRRTSASTTVPIPQRALPA
FT                   RCYRRRFGDITTMFLVSTRRHHGPARFRAEPQLQKLLVSITLESECESFPSLSSDETYS
FT                   LLVQEPVAVLKANSVWGALRGLETFSQLVYQDSFGTFTINESSIADSPRFPHRGILIDT
FT                   SRHFLPVKTILKTLDAMAFNKFNVLHWHIVDDQSFPYQSTTFPELSNKGSYSLSHVYTP
FT                   NDVRMVLEYARLRGIRVIPEFDTPGHTQSWGKGQKNLLTPCYNQKTKTQVFGPVDPTVN
FT                   TTYAFFNTFFKEISSVFPDQFIHLGGDEVEFQCWASNPNIQGFMKRKGFGSDFRRLESF
FT                   YIKKILEIISSLKKNSIVWQEVFDDKVELQPGTVVEVWKSEHYSYELKQVTGSGFPAIL
FT                   SAPWYLDLISYGQDWKNYYKVEPLNFEGSEKQKQLVIGGEACLWGEFVDATNLTPRLWP
FT                   RASAVGERLWSPKTVTDLENAYKRLAVHRCRMVR"
FT   assembly_gap    10013634..10013653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10035943..10035962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10045866..10045885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10050839..10050934
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    10053901..10053920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10061978..10061997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10062137..10074075
FT                   /gene="Enc1"
FT                   /locus_tag="mCG_114601"
FT                   /note="gene_id=mCG114601.1"
FT   mRNA            join(10062137..10062552,10065999..10067812,
FT                   10071572..10074075)
FT                   /gene="Enc1"
FT                   /locus_tag="mCG_114601"
FT                   /product="ectodermal-neural cortex 1"
FT                   /note="gene_id=mCG114601.1 transcript_id=mCT115696.1
FT                   created on 21-SEP-2002"
FT   CDS             10066012..10067781
FT                   /codon_start=1
FT                   /gene="Enc1"
FT                   /locus_tag="mCG_114601"
FT                   /product="ectodermal-neural cortex 1"
FT                   /note="gene_id=mCG114601.1 transcript_id=mCT115696.1
FT                   protein_id=mCP51962.1"
FT                   /db_xref="GOA:O35709"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR011705"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR017096"
FT                   /db_xref="InterPro:IPR030562"
FT                   /db_xref="MGI:MGI:109610"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35709"
FT                   /protein_id="EDL00871.1"
FT                   /translation="MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLF
FT                   TDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDY
FT                   AYSSRVIINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTK
FT                   LYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDERLVYESAMNWISYDL
FT                   KKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDG
FT                   VVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPRKEFSACAIGC
FT                   KVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAA
FT                   TGCLPASPSVSLKQVEQYDPTTNKWTMVAPLREGVSNAAVVSAKLKLFAFGGTSVSHDK
FT                   LPKVQCYDQCENRWSVPATCPQPWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQ
FT                   WTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQRCKTLDCYDPTLDVWNSITTVPYSLI
FT                   PTAFVSTWKHLPS"
FT   assembly_gap    10071135..10071154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10082386..10082472
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    10099934..10100215
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   gene            10104056..10106815
FT                   /locus_tag="mCG_146981"
FT                   /note="gene_id=mCG146981.0"
FT   mRNA            join(10104056..10104163,10105888..10106815)
FT                   /locus_tag="mCG_146981"
FT                   /product="mCG146981"
FT                   /note="gene_id=mCG146981.0 transcript_id=mCT187244.0
FT                   created on 13-JAN-2004"
FT   CDS             10106290..10106535
FT                   /codon_start=1
FT                   /locus_tag="mCG_146981"
FT                   /product="mCG146981"
FT                   /note="gene_id=mCG146981.0 transcript_id=mCT187244.0
FT                   protein_id=mCP108195.0"
FT                   /protein_id="EDL00870.1"
FT                   /translation="MHSGYRRLGEIYRTLKETLLMEDTIYPSVPDSLKVEGITQRHALI
FT                   LLLEVFQNLTVHWCYHQFSCPEFLSPPEPFRLLTLR"
FT   assembly_gap    10111932..10112071
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    10113039..10113696
FT                   /estimated_length=658
FT                   /gap_type="unknown"
FT   assembly_gap    10114641..10114851
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    10116884..10117091
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    10121697..10121718
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    10132664..10133006
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    10137827..10137846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10139030..10139384
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    10140435..10140516
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    10142611..10142630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10152249..10152268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10162348..10162367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10166826..10167357
FT                   /estimated_length=532
FT                   /gap_type="unknown"
FT   assembly_gap    10177628..10177647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10191572..10191666
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   gene            10195139..10199368
FT                   /locus_tag="mCG_146982"
FT                   /note="gene_id=mCG146982.0"
FT   mRNA            join(10195139..10195278,10197717..10198190,
FT                   10199050..10199368)
FT                   /locus_tag="mCG_146982"
FT                   /product="mCG146982"
FT                   /note="gene_id=mCG146982.0 transcript_id=mCT187245.0
FT                   created on 13-JAN-2004"
FT   CDS             10197790..10197921
FT                   /codon_start=1
FT                   /locus_tag="mCG_146982"
FT                   /product="mCG146982"
FT                   /note="gene_id=mCG146982.0 transcript_id=mCT187245.0
FT                   protein_id=mCP108196.0"
FT                   /protein_id="EDL00869.1"
FT                   /translation="MWLLGIELRTSGGAVSALNHWATSPAPMRNALDHIILSREDSP"
FT   assembly_gap    10261224..10261243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10276523..10278097)
FT                   /pseudo
FT                   /locus_tag="mCG_114605"
FT                   /note="gene_id=mCG114605.1"
FT   mRNA            complement(10276523..10278097)
FT                   /pseudo
FT                   /locus_tag="mCG_114605"
FT                   /note="gene_id=mCG114605.1 transcript_id=mCT115701.1
FT                   created on 26-NOV-2002"
FT   assembly_gap    10279063..10279082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10313896..10318046
FT                   /estimated_length=4151
FT                   /gap_type="unknown"
FT   assembly_gap    10321745..10321764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10329828..10330222
FT                   /estimated_length=395
FT                   /gap_type="unknown"
FT   assembly_gap    10345555..10345574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10358474..10358493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10366569..10366744
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   gene            <10373704..10397834
FT                   /locus_tag="mCG_144916"
FT                   /note="gene_id=mCG144916.0"
FT   mRNA            join(<10373704..10373911,10377565..10377691,
FT                   10396947..10397834)
FT                   /locus_tag="mCG_144916"
FT                   /product="mCG144916"
FT                   /note="gene_id=mCG144916.0 transcript_id=mCT184340.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    10384746..10384957
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    10396675..10396935
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   CDS             <10396992..10397387
FT                   /codon_start=1
FT                   /locus_tag="mCG_144916"
FT                   /product="mCG144916"
FT                   /note="gene_id=mCG144916.0 transcript_id=mCT184340.0
FT                   protein_id=mCP105296.0"
FT                   /protein_id="EDL00868.1"
FT                   /translation="LRHLPIHPFKASLIHNVPVVSPAVTMLPAELSLSSLYELSSFSSC
FT                   SFFLKCLSSRYFLMPRESRYEPGLLPLCHLGLKLGHILVFSFLSFQIIPWCENAKFSSV
FT                   LSLSSMPPPCEHAVFTHRLFSLSSRIL"
FT   assembly_gap    10401663..10401908
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    10430714..10430733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10443696..10443715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10448561..10448580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10464523..10464542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10474166..10474185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10500503..10500632
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    10507971..10508055
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    10536045..10536165
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   gene            complement(10536563..>10550811)
FT                   /gene="5330416C01Rik"
FT                   /locus_tag="mCG_142524"
FT                   /note="gene_id=mCG142524.0"
FT   mRNA            complement(join(10536563..10536781,10537366..10537468,
FT                   10537771..10538746,10539318..10539463,10546127..10547761,
FT                   10548480..10548563,10550687..10550811))
FT                   /gene="5330416C01Rik"
FT                   /locus_tag="mCG_142524"
FT                   /product="RIKEN cDNA 5330416C01, transcript variant
FT                   mCT180636"
FT                   /note="gene_id=mCG142524.0 transcript_id=mCT180636.0
FT                   created on 19-FEB-2003"
FT   assembly_gap    10542811..10543145
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   CDS             complement(10546624..10546881)
FT                   /codon_start=1
FT                   /gene="5330416C01Rik"
FT                   /locus_tag="mCG_142524"
FT                   /product="RIKEN cDNA 5330416C01, isoform CRA_b"
FT                   /note="gene_id=mCG142524.0 transcript_id=mCT180636.0
FT                   protein_id=mCP103559.0 isoform=CRA_b"
FT                   /protein_id="EDL00867.1"
FT                   /translation="MGRTEVALETPSAWSWSREQLDPAMVDWEGDSGRPETNTNHMASG
FT                   RNLGACDMQMKYLQRQPKRGGGTKTMIDIRSPQIPVGAVQ"
FT   mRNA            complement(join(10548092..10548563,10550687..>10550811))
FT                   /gene="5330416C01Rik"
FT                   /locus_tag="mCG_142524"
FT                   /product="RIKEN cDNA 5330416C01, transcript variant
FT                   mCT180637"
FT                   /note="gene_id=mCG142524.0 transcript_id=mCT180637.0
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(10548201..10548563,10550687..>10550809))
FT                   /codon_start=1
FT                   /gene="5330416C01Rik"
FT                   /locus_tag="mCG_142524"
FT                   /product="RIKEN cDNA 5330416C01, isoform CRA_a"
FT                   /note="gene_id=mCG142524.0 transcript_id=mCT180637.0
FT                   protein_id=mCP103558.0 isoform=CRA_a"
FT                   /protein_id="EDL00866.1"
FT                   /translation="VIRCWLGTALHGVLPSFETRWFCTAQRLLSISVVQTRLFVKVMME
FT                   NTDIRHTWDLWILLTIFESSIGRVVRSRVHWSWLCWCSSVCLGVTVASEPDSRCVAMEE
FT                   QSAVCCINCASAIHKQDCQTASPSVCSFYCPIKRTIWKMPPGQSIHILHLTQGSLPT"
FT   assembly_gap    10555104..10555236
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   gene            complement(10562528..10563051)
FT                   /locus_tag="mCG_114988"
FT                   /note="gene_id=mCG114988.1"
FT   mRNA            complement(10562528..10563051)
FT                   /locus_tag="mCG_114988"
FT                   /product="mCG114988"
FT                   /note="gene_id=mCG114988.1 transcript_id=mCT116086.0
FT                   created on 26-NOV-2002"
FT   CDS             complement(10562571..10563029)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114988"
FT                   /product="mCG114988"
FT                   /note="gene_id=mCG114988.1 transcript_id=mCT116086.0
FT                   protein_id=mCP51869.1"
FT                   /protein_id="EDL00865.1"
FT                   /translation="MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVL
FT                   RKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLD
FT                   NKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGQTVGVSKKK"
FT   assembly_gap    10603629..10604577
FT                   /estimated_length=949
FT                   /gap_type="unknown"
FT   assembly_gap    10605444..10605895
FT                   /estimated_length=452
FT                   /gap_type="unknown"
FT   assembly_gap    10608636..10609437
FT                   /estimated_length=802
FT                   /gap_type="unknown"
FT   gene            10609781..>10610518
FT                   /locus_tag="mCG_1047185"
FT                   /note="gene_id=mCG1047185.1"
FT   mRNA            join(10609781..10610085,10610453..>10610518)
FT                   /locus_tag="mCG_1047185"
FT                   /product="mCG1047185"
FT                   /note="gene_id=mCG1047185.1 transcript_id=mCT164889.0
FT                   created on 19-FEB-2003"
FT   CDS             join(10609954..10610085,10610453..10610518)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047185"
FT                   /product="mCG1047185"
FT                   /note="gene_id=mCG1047185.1 transcript_id=mCT164889.0
FT                   protein_id=mCP51724.1"
FT                   /protein_id="EDL00864.1"
FT                   /translation="MHTVYLTIFNPHTFPNSSQIHSTQLLPNLVLSLSLSLSLSLSLSC
FT                   VCVCVCVCVCVCETYQGLHP"
FT   assembly_gap    10610086..10610452
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    10622218..10622237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10624689..10624708
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10673816..10673938
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    10683771..10683928
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    10691827..10693729
FT                   /estimated_length=1903
FT                   /gap_type="unknown"
FT   assembly_gap    10695387..10695406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10696411..10696430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10706961..10706980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10711738..10722559)
FT                   /locus_tag="mCG_1047184"
FT                   /note="gene_id=mCG1047184.1"
FT   mRNA            complement(join(10711738..10713567,10721788..10721959,
FT                   10722347..10722559))
FT                   /locus_tag="mCG_1047184"
FT                   /product="mCG1047184"
FT                   /note="gene_id=mCG1047184.1 transcript_id=mCT164888.1
FT                   created on 19-FEB-2003"
FT   CDS             complement(10712333..10712563)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047184"
FT                   /product="mCG1047184"
FT                   /note="gene_id=mCG1047184.1 transcript_id=mCT164888.1
FT                   protein_id=mCP51932.1"
FT                   /protein_id="EDL00863.1"
FT                   /translation="MSYTVGSWKIKGNSCLIWCSARPKFLSCPQKAGEVRSSLKSLLGP
FT                   FQPQQLHCLTSPNFGGDGSIPDILITAHQNS"
FT   assembly_gap    10728786..10728832
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    10737363..10737382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10738463..10738595
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    10740002..10740514
FT                   /estimated_length=513
FT                   /gap_type="unknown"
FT   gene            complement(10744517..11014586)
FT                   /gene="Rgnef"
FT                   /locus_tag="mCG_114987"
FT                   /note="gene_id=mCG114987.1"
FT   mRNA            complement(join(10744517..10745738,10775223..10775517,
FT                   10776590..10777075,10782487..10782534,10782635..10782673,
FT                   10785272..10785372,10788265..10788396,10790328..10790510,
FT                   10791461..10791552,10792615..10792793,10797378..10797454,
FT                   10799518..10799772,10802338..10802455,10803519..10803641,
FT                   10807111..10807358,10811370..10811510,10813033..10813154,
FT                   10813234..10813378,10815227..10815275,10816262..10816317,
FT                   10823978..10824110,10824377..10824500,10827282..10827324,
FT                   10831188..10831299,10834018..10834222,10839780..10840060,
FT                   10842598..10842719,10875120..10875180,10875619..10875674,
FT                   10889573..10889639,10896723..10896903,10899567..10899750,
FT                   10920480..10920773,10922655..10922802,10983666..10983709,
FT                   11014526..11014586))
FT                   /gene="Rgnef"
FT                   /locus_tag="mCG_114987"
FT                   /product="Rho-guanine nucleotide exchange factor"
FT                   /note="gene_id=mCG114987.1 transcript_id=mCT116085.1
FT                   created on 26-NOV-2002"
FT   CDS             complement(join(10745569..10745738,10775223..10775517,
FT                   10776590..10777075,10782487..10782534,10782635..10782673,
FT                   10785272..10785372,10788265..10788396,10790328..10790510,
FT                   10791461..10791552,10792615..10792793,10797378..10797454,
FT                   10799518..10799772,10802338..10802455,10803519..10803641,
FT                   10807111..10807358,10811370..10811510,10813033..10813154,
FT                   10813234..10813378,10815227..10815275,10816262..10816317,
FT                   10823978..10824110,10824377..10824500,10827282..10827324,
FT                   10831188..10831299,10834018..10834222,10839780..10840060,
FT                   10842598..10842719,10875120..10875180,10875619..10875674,
FT                   10889573..10889639,10896723..10896903,10899567..10899750,
FT                   10920480..10920773,10922655..10922802,10983666..10983698))
FT                   /codon_start=1
FT                   /gene="Rgnef"
FT                   /locus_tag="mCG_114987"
FT                   /product="Rho-guanine nucleotide exchange factor"
FT                   /note="gene_id=mCG114987.1 transcript_id=mCT116085.1
FT                   protein_id=mCP51851.1"
FT                   /db_xref="GOA:G5E8P2"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="MGI:MGI:1346016"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8P2"
FT                   /protein_id="EDL00862.1"
FT                   /translation="MELSCSEVPLYGQKTVYAKFGKNVYLPEDAEFYFVYGGSHQRHVV
FT                   IADRVQDNVLQSSIPGHWLQETVTVSVCLCSEGYSPVTMGSGSVTYVDNMACRLARLLV
FT                   TQADRLTACSHQTLLTPFALTVEALPALDEELVLALTQLELPLGWTVLGNSSLEVSLHR
FT                   ESLLHLAVRWALPKLFHFLLCLPGGVKALKLPNEEATTPLDLALQGGHSTLVEDITNFQ
FT                   GSHSPGFSRLRLNEEATLQFVHSSETLTLTVNHTAEHLLEADIKLFRKYFWDRAFLVKA
FT                   LEQEAKTEKATMPSGAAETEEEVRNLESGRSPSEEEEDAKSIKSQVDGPSEHEDQDRLP
FT                   LDRSFDGLKKSKHVPASLAAGQLSDVLNGGDEVYANCMVIDQVGDLDINYINLEGLSTH
FT                   TSPESGRSMLGPQACMHTLPPDTSPCGRPLIENSEGTLDAAASQSFVTPSSSRTSNLNL
FT                   SFGLHGFEKEQSHLKKRSSSLDALVADSEGEGGSEPPICYAVGSQSSPRTGLPSGDELD
FT                   SFETNTEPDCNISRTESLSLSSTLHSKESLLSGIRSRSYSCSSPKISSGKSRLVRDFTV
FT                   CSTSEEQRSYSFQEPPGEKRIQEEEWDEYVIPAKSESEKYKVSRTFSFLMNRMTSPRNK
FT                   SKMKNKDTKEKEKMNRHQFVPGTFSGVLQCSGCDKTLLGKESLQCANCKANTHKGCKDA
FT                   VPPCTKKFQEKYNKNKPQSILGSSSVRDVPAPGLSLHPSSSMPIGLPAGRKEFAAQVHP
FT                   LSRSVPGTTLESFRRAVTSLESEGDSWRSRSHSDELFQSMGSSPSTESFMMEDVVDSSL
FT                   WIDLSSDAQEFEAESWSLVVDPSFCSRQEKDVIKRQDVIFELMQTEVHHIQTLLIMSEV
FT                   FRKGMKEELQLDHSTVDKIFPCLDELLETHRHFFFSMKERRQESCAGSDRNFVINQIGD
FT                   ILVQQFSEENASKMKRIYGEFCSHHKEAMSLFKELQQNKKFQNFIKIRNSNLLARRRGI
FT                   PECILLVTQRITKYPVLVERILQYTKERTEEHRDLCKALGLIKDMIAAVDLKVSEYEKN
FT                   QKWLEILNKIENKTYTKLKNGHVFRKQALLSQERALLHDGLVYWKTATGRFKDILALLL
FT                   TDVLLFLQEKDQKYIFAAVDQKPSVISLQKLIAREVANEERGMFLISASSAGPEMYEIH
FT                   TNSKEERNNWMRRIQQAVESCPEEEGGRTSESDEERRKAEARVAKIQQCQEILSNQDQQ
FT                   ICTYLEEKLHIYAELGELSGFEDVHLEPHLLIKPDPGEPPQAASLLAAALREAESLQVA
FT                   VKASKMGDVSQSSEESPGGTVLMDTPSTQDVPASPTASLVTEGTEGRGCWDVDPGLQGV
FT                   VTDLAVSDAGEKVEYRSFSGSSQSEIIQAIQNLTRLLYSLQAALTIQDSHIEIHKLVLQ
FT                   QRESLAPSHSFRGGPLQDQEKSRYLEKQREELANIHKLQHQFQQEQRRWHRTCDQQQRE
FT                   QEAQESWLQARERECQSQEELLLRHRSELDHQLQEYQQSLERLREGQRMVERERQKMRV
FT                   QQGLLGHCKHSRQRSLPAVFSPGSKEVTELNRAESLCHENSFFINEAFGHMSLNTSNKP
FT                   NPSGVPWDAHPLEGSHFDLARTSESPTELKIDISQPPDVNSELWTTGPGHQRPALQENS
FT                   KESYKNVADLDSFQSESSSPQDSNQRGPQPQTLTTEAKLSLPMAAGHGGDAGDGAEENI
FT                   LYL"
FT   assembly_gap    10751281..10751300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10754188..10754219
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    10810559..10810752
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    10816896..10817474
FT                   /estimated_length=579
FT                   /gap_type="unknown"
FT   assembly_gap    10826162..10826209
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    10827521..10827540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10841037..10841071
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    10854745..10854764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10864506..10864537
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    10902256..10902541
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    10942107..10942178
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    10981679..10981712
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    11007947..11008393
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   assembly_gap    11014119..11014143
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    11017049..11017068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11026952..11027052
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    11027947..11028096
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    11032802..11032906
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    11044661..11044799
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    11048736..11048840
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            11085373..11087167
FT                   /locus_tag="mCG_114991"
FT                   /note="gene_id=mCG114991.1"
FT   mRNA            join(11085373..11085642,11086308..11087167)
FT                   /locus_tag="mCG_114991"
FT                   /product="mCG114991"
FT                   /note="gene_id=mCG114991.1 transcript_id=mCT116089.1
FT                   created on 26-NOV-2002"
FT   gene            complement(11085929..11101371)
FT                   /gene="Utp15"
FT                   /locus_tag="mCG_114992"
FT                   /note="gene_id=mCG114992.1"
FT   mRNA            complement(join(11085929..11087740,11088936..11088994,
FT                   11089149..11089282,11090293..11090394,11091109..11091258,
FT                   11092008..11092092,11093283..11093418,11095464..11095589,
FT                   11096199..11096377,11097468..11097652,11097737..11097829,
FT                   11099162..11099333,11101234..11101371))
FT                   /gene="Utp15"
FT                   /locus_tag="mCG_114992"
FT                   /product="UTP15, U3 small nucleolar ribonucleoprotein,
FT                   homolog (yeast), transcript variant mCT116090"
FT                   /note="gene_id=mCG114992.1 transcript_id=mCT116090.1
FT                   created on 26-NOV-2002"
FT   mRNA            complement(join(11085929..11087740,11088936..11088994,
FT                   11089149..11089282,11090293..11090394,11091109..11091258,
FT                   11092008..11092092,11093283..11093425,11097766..11097829,
FT                   11099162..11099333,11101234..>11101370))
FT                   /gene="Utp15"
FT                   /locus_tag="mCG_114992"
FT                   /product="UTP15, U3 small nucleolar ribonucleoprotein,
FT                   homolog (yeast), transcript variant mCT176316"
FT                   /note="gene_id=mCG114992.1 transcript_id=mCT176316.0
FT                   created on 26-NOV-2002"
FT   CDS             11086419..11086616
FT                   /codon_start=1
FT                   /locus_tag="mCG_114991"
FT                   /product="mCG114991"
FT                   /note="gene_id=mCG114991.1 transcript_id=mCT116089.1
FT                   protein_id=mCP51704.1"
FT                   /protein_id="EDL00861.1"
FT                   /translation="MRQNHYNLSPKDILGSGFHHQTFINLSGVTEGRHGSHSRAVSMLV
FT                   KATDCPSGTPQKAKKKRISL"
FT   CDS             complement(join(11087493..11087740,11088936..11088994,
FT                   11089149..11089282,11090293..11090394,11091109..11091258,
FT                   11092008..11092092,11093283..11093418,11095464..11095589,
FT                   11096199..11096377,11097468..11097652,11097737..11097829,
FT                   11099162..11099251))
FT                   /codon_start=1
FT                   /gene="Utp15"
FT                   /locus_tag="mCG_114992"
FT                   /product="UTP15, U3 small nucleolar ribonucleoprotein,
FT                   homolog (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG114992.1 transcript_id=mCT116090.1
FT                   protein_id=mCP51705.1 isoform=CRA_a"
FT                   /protein_id="EDL00859.1"
FT                   /translation="MAGYKPVAIQTYPVLGEKITQDTLYWNNYKTPVQIKEFGAVSKVD
FT                   FSPQLPYNYAVTASSRIHIYGRYSQEPVKTFSRFKDTAYCATFRQDGQLLVAGSEDGVV
FT                   QLFDINGRAPLRQFEGHTKAVHTVDFTADNYHVVSGADDYTVKLWDIPNSKEILTFKEH
FT                   SDYVRCGCASKLNPDLFVTGSYDHTVKIFDARTNKNVLCVEHGQPVESVLLFPSGGLLV
FT                   SAGGRYVKVWDMLKGGQLLVSLKNHHKTVTCLCLSSSGQRLLSGSLDRKVKVYSTTSYK
FT                   VVHSFDYAASILSLALSHQDETIVVGMTNGILSVKHRKSEAKKTSLPRRRRPAYRTFIK
FT                   GKNYLKQRDDIMVSRPAKKHLEGYDKDLKSFRVSQALDRVLEPKCVIRTPEVTVSIIKE
FT                   LTRRGVLANALAGRDEKEVTRVLNFLIRNLSQPRFAPVLINAAEIIIDIYLPVIGQSSV
FT                   VDKKFIVLQELVEKEIDYQRELLETLGMMDMLFATMTRNDSDPVPEHVPAELPEEKTES
FT                   PTQPSDTDKNS"
FT   CDS             complement(join(11087493..11087740,11088936..11088994,
FT                   11089149..11089282,11090293..11090394,11091109..11091258,
FT                   11092008..11092092,11093283..11093425,11097766..>11097786))
FT                   /codon_start=1
FT                   /gene="Utp15"
FT                   /locus_tag="mCG_114992"
FT                   /product="UTP15, U3 small nucleolar ribonucleoprotein,
FT                   homolog (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG114992.1 transcript_id=mCT176316.0
FT                   protein_id=mCP99238.0 isoform=CRA_b"
FT                   /protein_id="EDL00860.1"
FT                   /translation="TFLLSFHSTGGRYVKVWDMLKGGQLLVSLKNHHKTVTCLCLSSSG
FT                   QRLLSGSLDRKVKVYSTTSYKVVHSFDYAASILSLALSHQDETIVVGMTNGILSVKHRK
FT                   SEAKKTSLPRRRRPAYRTFIKGKNYLKQRDDIMVSRPAKKHLEGYDKDLKSFRVSQALD
FT                   RVLEPKCVIRTPEVTVSIIKELTRRGVLANALAGRDEKEVTRVLNFLIRNLSQPRFAPV
FT                   LINAAEIIIDIYLPVIGQSSVVDKKFIVLQELVEKEIDYQRELLETLGMMDMLFATMTR
FT                   NDSDPVPEHVPAELPEEKTESPTQPSDTDKNS"
FT   gene            <11101509..11112272
FT                   /gene="Ankra2"
FT                   /locus_tag="mCG_114985"
FT                   /note="gene_id=mCG114985.2"
FT   mRNA            join(<11101509..11101835,11105671..11105829,
FT                   11106785..11106850,11109410..11109507,11110009..11110134,
FT                   11110581..11110647,11111127..11111207,11111733..11112272)
FT                   /gene="Ankra2"
FT                   /locus_tag="mCG_114985"
FT                   /product="ankyrin repeat, family A (RFXANK-like), 2,
FT                   transcript variant mCT189360"
FT                   /note="gene_id=mCG114985.2 transcript_id=mCT189360.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<11101516..11101835,11105671..11105829,
FT                   11106785..11106850,11109410..11109507,11110009..11110134,
FT                   11110581..11110647,11111127..11111207,11112162..11112265)
FT                   /gene="Ankra2"
FT                   /locus_tag="mCG_114985"
FT                   /product="ankyrin repeat, family A (RFXANK-like), 2,
FT                   transcript variant mCT176315"
FT                   /note="gene_id=mCG114985.2 transcript_id=mCT176315.0
FT                   created on 26-NOV-2002"
FT   mRNA            join(<11101550..11101835,11105671..11105829,
FT                   11106785..11106850,11109410..11109507,11110009..11110134,
FT                   11110581..11110647,11111127..11112271)
FT                   /gene="Ankra2"
FT                   /locus_tag="mCG_114985"
FT                   /product="ankyrin repeat, family A (RFXANK-like), 2,
FT                   transcript variant mCT189358"
FT                   /note="gene_id=mCG114985.2 transcript_id=mCT189358.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(11101601..11101835,11104510..11104891,
FT                   11105671..11105829,11106785..11106850,11109410..11109507,
FT                   11110009..11110134,11110581..11110647,11111127..11111207,
FT                   11111733..11112267)
FT                   /gene="Ankra2"
FT                   /locus_tag="mCG_114985"
FT                   /product="ankyrin repeat, family A (RFXANK-like), 2,
FT                   transcript variant mCT116083"
FT                   /note="gene_id=mCG114985.2 transcript_id=mCT116083.0
FT                   created on 26-NOV-2002"
FT   mRNA            join(<11101630..11101835,11104510..11104891,
FT                   11105671..11105829,11106785..11106850,11109410..11109507,
FT                   11110009..11110134,11110581..11110647,11111127..11111945)
FT                   /gene="Ankra2"
FT                   /locus_tag="mCG_114985"
FT                   /product="ankyrin repeat, family A (RFXANK-like), 2,
FT                   transcript variant mCT189359"
FT                   /note="gene_id=mCG114985.2 transcript_id=mCT189359.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<11101637..11101835,11105671..11105829,
FT                   11106785..11106850,11109410..11109507,11110009..11110134,
FT                   11110581..11110647,11111127..11111207,11112162..11112223)
FT                   /codon_start=1
FT                   /gene="Ankra2"
FT                   /locus_tag="mCG_114985"
FT                   /product="ankyrin repeat, family A (RFXANK-like), 2,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG114985.2 transcript_id=mCT176315.0
FT                   protein_id=mCP99237.0 isoform=CRA_e"
FT                   /protein_id="EDL00858.1"
FT                   /translation="RLGPKQARGSGPIWLGQARAALPLSSGRVYHPPDRPLSPDPLAAS
FT                   ERERVSPRGRRAGTPARTPVAPECNIHTSPSPGIQVRHVYTPSTTKHFSPIKQSTTLTN
FT                   KHRGNEVSTTPLLANSLSAHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHG
FT                   QIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPL
FT                   LYAVHGNHVKCVKMLLENGADPTIETDSGYNSMDLAVALGYRGGLTVSVWEGNNVLVEL
FT                   KSTV"
FT   CDS             join(<11101637..11101835,11105671..11105829,
FT                   11106785..11106850,11109410..11109507,11110009..11110134,
FT                   11110581..11110647,11111127..11111207,11111733..11111788)
FT                   /codon_start=1
FT                   /gene="Ankra2"
FT                   /locus_tag="mCG_114985"
FT                   /product="ankyrin repeat, family A (RFXANK-like), 2,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG114985.2 transcript_id=mCT189360.0
FT                   protein_id=mCP110346.0 isoform=CRA_d"
FT                   /protein_id="EDL00857.1"
FT                   /translation="RLGPKQARGSGPIWLGQARAALPLSSGRVYHPPDRPLSPDPLAAS
FT                   ERERVSPRGRRAGTPARTPVAPECNIHTSPSPGIQVRHVYTPSTTKHFSPIKQSTTLTN
FT                   KHRGNEVSTTPLLANSLSAHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHG
FT                   QIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPL
FT                   LYAVHGNHVKCVKMLLENGADPTIETDSGYNSMDLAVALGYRGVQQAIESHLLKLLQNI
FT                   RE"
FT   CDS             join(<11101637..11101835,11105671..11105829,
FT                   11106785..11106850,11109410..11109507,11110009..11110134,
FT                   11110581..11110647,11111127..11111239)
FT                   /codon_start=1
FT                   /gene="Ankra2"
FT                   /locus_tag="mCG_114985"
FT                   /product="ankyrin repeat, family A (RFXANK-like), 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG114985.2 transcript_id=mCT189358.0
FT                   protein_id=mCP110344.0 isoform=CRA_b"
FT                   /protein_id="EDL00855.1"
FT                   /translation="RLGPKQARGSGPIWLGQARAALPLSSGRVYHPPDRPLSPDPLAAS
FT                   ERERVSPRGRRAGTPARTPVAPECNIHTSPSPGIQVRHVYTPSTTKHFSPIKQSTTLTN
FT                   KHRGNEVSTTPLLANSLSAHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHG
FT                   QIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPL
FT                   LYAVHGNHVKCVKMLLENGADPTIETDSGYNSMDLAVALGYRGGEYFRTLGSF"
FT   CDS             join(<11104582..11104891,11105671..11105829,
FT                   11106785..11106850,11109410..11109507,11110009..11110134,
FT                   11110581..11110647,11111127..11111239)
FT                   /codon_start=1
FT                   /gene="Ankra2"
FT                   /locus_tag="mCG_114985"
FT                   /product="ankyrin repeat, family A (RFXANK-like), 2,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG114985.2 transcript_id=mCT189359.0
FT                   protein_id=mCP110345.0 isoform=CRA_c"
FT                   /protein_id="EDL00856.1"
FT                   /translation="RSVLIIKAMATSANLDIGAQLIVEECPSSYISGMPDIKLEHQLDP
FT                   NPDEGAAQGVAMGMKFILPNRFDMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKA
FT                   ECNIHTSPSPGIQVRHVYTPSTTKHFSPIKQSTTLTNKHRGNEVSTTPLLANSLSAHQL
FT                   AAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGR
FT                   ESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLENGADP
FT                   TIETDSGYNSMDLAVALGYRGGEYFRTLGSF"
FT   CDS             join(11104606..11104891,11105671..11105829,
FT                   11106785..11106850,11109410..11109507,11110009..11110134,
FT                   11110581..11110647,11111127..11111207,11111733..11111788)
FT                   /codon_start=1
FT                   /gene="Ankra2"
FT                   /locus_tag="mCG_114985"
FT                   /product="ankyrin repeat, family A (RFXANK-like), 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG114985.2 transcript_id=mCT116083.0
FT                   protein_id=mCP51843.1 isoform=CRA_a"
FT                   /protein_id="EDL00854.1"
FT                   /translation="MATSANLDIGAQLIVEECPSSYISGMPDIKLEHQLDPNPDEGAAQ
FT                   GVAMGMKFILPNRFDMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKAECNIHTSP
FT                   SPGIQVRHVYTPSTTKHFSPIKQSTTLTNKHRGNEVSTTPLLANSLSAHQLAAQGEMLY
FT                   LATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLAC
FT                   SKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLENGADPTIETDSGY
FT                   NSMDLAVALGYRGVQQAIESHLLKLLQNIRE"
FT   assembly_gap    11118603..11118622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11127489..11127508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11128766..11128785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11130746..11131039
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    11132254..11132530
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    11135266..11135285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11139540..11139559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11140672..11141093
FT                   /estimated_length=422
FT                   /gap_type="unknown"
FT   assembly_gap    11143052..11144217
FT                   /estimated_length=1166
FT                   /gap_type="unknown"
FT   assembly_gap    11152810..11152941
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   gene            complement(11157614..11164695)
FT                   /gene="Btf3"
FT                   /locus_tag="mCG_114993"
FT                   /note="gene_id=mCG114993.1"
FT   mRNA            complement(join(11157614..11157922,11158702..11158758,
FT                   11160831..11161032,11161378..11161491,11163973..11164041,
FT                   11164328..11164695))
FT                   /gene="Btf3"
FT                   /locus_tag="mCG_114993"
FT                   /product="basic transcription factor 3, transcript variant
FT                   mCT176317"
FT                   /note="gene_id=mCG114993.1 transcript_id=mCT176317.0
FT                   created on 26-NOV-2002"
FT   mRNA            complement(join(11157619..11157922,11158702..11158758,
FT                   11160831..11161032,11161378..11161491,11163973..11164041,
FT                   11164569..11164692))
FT                   /gene="Btf3"
FT                   /locus_tag="mCG_114993"
FT                   /product="basic transcription factor 3, transcript variant
FT                   mCT116091"
FT                   /note="gene_id=mCG114993.1 transcript_id=mCT116091.1
FT                   created on 26-NOV-2002"
FT   CDS             complement(join(11157876..11157922,11158702..11158758,
FT                   11160831..11161032,11161378..11161491,11163973..11164041,
FT                   11164328..11164453))
FT                   /codon_start=1
FT                   /gene="Btf3"
FT                   /locus_tag="mCG_114993"
FT                   /product="basic transcription factor 3, isoform CRA_a"
FT                   /note="gene_id=mCG114993.1 transcript_id=mCT176317.0
FT                   protein_id=mCP99239.0 isoform=CRA_a"
FT                   /protein_id="EDL00852.1"
FT                   /translation="MRRTGAPTQADSRGRGRARGGWPGAEATPSLPLGGSRGRESQMKE
FT                   TIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEV
FT                   NMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRL
FT                   AEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN"
FT   CDS             complement(join(11157876..11157922,11158702..11158758,
FT                   11160831..11161032,11161378..11161491,11163973..11164041))
FT                   /codon_start=1
FT                   /gene="Btf3"
FT                   /locus_tag="mCG_114993"
FT                   /product="basic transcription factor 3, isoform CRA_b"
FT                   /note="gene_id=mCG114993.1 transcript_id=mCT116091.1
FT                   protein_id=mCP51712.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UJR8"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="MGI:MGI:1202875"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UJR8"
FT                   /protein_id="EDL00853.1"
FT                   /translation="MKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQ
FT                   FSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLP
FT                   SILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN"
FT   assembly_gap    11158769..11158788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11164168..11164187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11164189..11165007
FT                   /locus_tag="mCG_146983"
FT                   /note="gene_id=mCG146983.0"
FT   mRNA            11164189..11165007
FT                   /locus_tag="mCG_146983"
FT                   /product="mCG146983"
FT                   /note="gene_id=mCG146983.0 transcript_id=mCT187246.0
FT                   created on 13-JAN-2004"
FT   CDS             11164584..11164958
FT                   /codon_start=1
FT                   /locus_tag="mCG_146983"
FT                   /product="mCG146983"
FT                   /note="gene_id=mCG146983.0 transcript_id=mCT187246.0
FT                   protein_id=mCP108197.0"
FT                   /protein_id="EDL00851.1"
FT                   /translation="MAPRGELRFTLRGSRADQLREGAHTRGRKMAARGRPEITRRHFLQ
FT                   NSGSGVGVAAHAQPGAGPRLFLSFRPAAGREQHRRAGTRGRRPRSWERPRIDRTVRLPV
FT                   ELWLNQSALWPPRRASSFVQ"
FT   assembly_gap    11174084..11174393
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    11185188..11185274
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    11186602..11186621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11196466..11196485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11198781..11201703
FT                   /locus_tag="mCG_114990"
FT                   /note="gene_id=mCG114990.1"
FT   mRNA            join(11198781..11199239,11199868..11201703)
FT                   /locus_tag="mCG_114990"
FT                   /product="mCG114990"
FT                   /note="gene_id=mCG114990.1 transcript_id=mCT116088.1
FT                   created on 26-NOV-2002"
FT   CDS             join(11199146..11199239,11199868..11200184)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114990"
FT                   /product="mCG114990"
FT                   /note="gene_id=mCG114990.1 transcript_id=mCT116088.1
FT                   protein_id=mCP51873.1"
FT                   /protein_id="EDL00850.1"
FT                   /translation="MTLSTEMSDASGLAEETDIDVVGEGEDDEEEAGGPGAAALARSPF
FT                   SIESLIGRTRGPAAAGAHVSSGAASGTAPGPGGGGCAVQAAAGPAVALTRSLVVAAAAA
FT                   ASSVSSSAALGTLHQGTALSSVENFTARISNC"
FT   assembly_gap    11199240..11199867
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    11203929..11203948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11209811..11209830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11214618..11214674
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    11219727..11219746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11245912..11247151)
FT                   /pseudo
FT                   /locus_tag="mCG_114986"
FT                   /note="gene_id=mCG114986.1"
FT   mRNA            complement(11245912..11247151)
FT                   /pseudo
FT                   /locus_tag="mCG_114986"
FT                   /note="gene_id=mCG114986.1 transcript_id=mCT116084.1
FT                   created on 26-NOV-2002"
FT   assembly_gap    11253908..11255205
FT                   /estimated_length=1298
FT                   /gap_type="unknown"
FT   assembly_gap    11257177..11257268
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    11262577..11262870
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    11266176..11266650
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   gene            complement(11266651..>11277914)
FT                   /locus_tag="mCG_1047119"
FT                   /note="gene_id=mCG1047119.1"
FT   mRNA            complement(join(11266651..11267397,11271898..11272072,
FT                   11277711..>11277914))
FT                   /locus_tag="mCG_1047119"
FT                   /product="mCG1047119"
FT                   /note="gene_id=mCG1047119.1 transcript_id=mCT164823.0
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(11267255..11267397,11271898..11272072,
FT                   11277711..>11277914))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047119"
FT                   /product="mCG1047119"
FT                   /note="gene_id=mCG1047119.1 transcript_id=mCT164823.0
FT                   protein_id=mCP51723.0"
FT                   /protein_id="EDL00849.1"
FT                   /translation="TLLLSLPSTSFREINLLLYPSNLPCWGAGGKRLLQKRPFSIERHS
FT                   WVCLRILVSLHDERHDFLFYFPQHLERNQSSSLKLRMKPPLPGALQTVGRNCCGCLPSP
FT                   GPSLSLLQDLLTVEASSPLLVTAHSLWKRPVFMSYTLRKVRDSAHVPRNCKLLTAGMGV
FT                   ILEEHALASA"
FT   assembly_gap    11268297..11269610
FT                   /estimated_length=1314
FT                   /gap_type="unknown"
FT   assembly_gap    11318934..11319065
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    11323547..11323566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11332156..>11332626)
FT                   /locus_tag="mCG_114989"
FT                   /note="gene_id=mCG114989.1"
FT   mRNA            complement(11332156..>11332626)
FT                   /locus_tag="mCG_114989"
FT                   /product="mCG114989"
FT                   /note="gene_id=mCG114989.1 transcript_id=mCT116087.0
FT                   created on 20-NOV-2002"
FT   CDS             complement(11332250..>11332624)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114989"
FT                   /product="mCG114989"
FT                   /note="gene_id=mCG114989.1 transcript_id=mCT116087.0
FT                   protein_id=mCP51872.0"
FT                   /protein_id="EDL00848.1"
FT                   /translation="SSAAGSNAQWHQRGLLWPLSQQSGGRTGCGIHCSAEKKCQLWDPE
FT                   HRPHHLCRDWGDVAILHGRFPRAQSGPCPSAGDESSVHRFCIYAAHLGQVHAIVDWATS
FT                   ICHLKKKKKEKNPTNLGPKV"
FT   assembly_gap    11338826..11338845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11346939..11347023
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    11351352..11351474
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    11354467..11354553
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    11413173..11413192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11414703..11414785
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    11435191..11435210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11438866..11439027
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   gene            11455322..11456716
FT                   /locus_tag="mCG_116572"
FT                   /note="gene_id=mCG116572.1"
FT   mRNA            11455322..11456716
FT                   /locus_tag="mCG_116572"
FT                   /product="mCG116572"
FT                   /note="gene_id=mCG116572.1 transcript_id=mCT117695.1
FT                   created on 20-NOV-2002"
FT   CDS             11455843..11456466
FT                   /codon_start=1
FT                   /locus_tag="mCG_116572"
FT                   /product="mCG116572"
FT                   /note="gene_id=mCG116572.1 transcript_id=mCT117695.1
FT                   protein_id=mCP51810.1"
FT                   /protein_id="EDL00847.1"
FT                   /translation="MKPHDIFEANELFENGNMTQVQMTLVALAGLVKTKGFHTTIDIGV
FT                   KYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQ
FT                   TTISLQIGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKTASQKGMSV
FT                   YWLGRQVYDPKYCASPTEPVIHNGSQGTGTSPNCGKGGTILQDS"
FT   assembly_gap    11480472..11480889
FT                   /estimated_length=418
FT                   /gap_type="unknown"
FT   assembly_gap    11482476..11482495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11484425..11498904
FT                   /estimated_length=14480
FT                   /gap_type="unknown"
FT   assembly_gap    11500174..11500193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11516102..11516256
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    11519639..11520169
FT                   /estimated_length=531
FT                   /gap_type="unknown"
FT   assembly_gap    11528225..11528251
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    11532996..11533250
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   gene            complement(11533789..>11542660)
FT                   /gene="Gm905"
FT                   /locus_tag="mCG_116573"
FT                   /note="gene_id=mCG116573.1"
FT   mRNA            complement(join(11533789..11534400,11536229..11536364,
FT                   11539899..11540612,11542239..>11542660))
FT                   /gene="Gm905"
FT                   /locus_tag="mCG_116573"
FT                   /product="gene model 905, (NCBI)"
FT                   /note="gene_id=mCG116573.1 transcript_id=mCT117696.1
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(11534202..11534400,11536229..11536364,
FT                   11539899..11540612,11542239..>11542371))
FT                   /codon_start=1
FT                   /gene="Gm905"
FT                   /locus_tag="mCG_116573"
FT                   /product="gene model 905, (NCBI)"
FT                   /note="gene_id=mCG116573.1 transcript_id=mCT117696.1
FT                   protein_id=mCP51811.1"
FT                   /protein_id="EDL00846.1"
FT                   /translation="VSWSERKYKSSSVLLLFLCWCLRICLKTGEAQRLATKLKTPKKPK
FT                   PATAGGKETHFFTSGNNEEAFSFLAMSSVGTAEPDGDQRDRHVSKLIFFLFVFGAALLC
FT                   VGVLLSIFGYQACQYKPLSHCSIVLKIAGPSCAVVGLGAVILARSRARLHLRERQRQGL
FT                   QDPDQSFFCGESRQFAQCLIFGFLFLTSGMLISILGIWVPGCDSDWAQEPLNETNTGEG
FT                   EPQICGFLSLQIMGPLVVLVGLCFFVVAHVKKKNNLSSSRDTSEVEGGHAHSTEPVHIT
FT                   VGDSVIIFPPPPPPYFPESSAAAPSPGANSLHQIENPPSYSSLFNYGRTPTPENQGAAS
FT                   EREQELIYTISGQGSSSERSYTGHLPLDLPPRYEEKETAPATPLGAPSDASPP"
FT   assembly_gap    11543052..11543251
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    11552485..11552607
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    11555628..11555823
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    11556332..11556966
FT                   /estimated_length=635
FT                   /gap_type="unknown"
FT   gene            complement(11562223..11565797)
FT                   /locus_tag="mCG_142523"
FT                   /note="gene_id=mCG142523.0"
FT   mRNA            complement(join(11562223..11562709,11565615..11565797))
FT                   /locus_tag="mCG_142523"
FT                   /product="mCG142523"
FT                   /note="gene_id=mCG142523.0 transcript_id=mCT180635.0
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(11562348..11562709,11565615..11565681))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142523"
FT                   /product="mCG142523"
FT                   /note="gene_id=mCG142523.0 transcript_id=mCT180635.0
FT                   protein_id=mCP103557.0"
FT                   /protein_id="EDL00845.1"
FT                   /translation="MIDRTSETRLTAIVTGEDWPVNSVKTVYRSGTLIKWNREERAFLC
FT                   MLLNKNCHARFPKSFPGKASLFAVSYLHRLTFSRTVVCKRASFCISSPTLQPHQHCILT
FT                   NTSHCTFCLFVCLFCFFETGLLCVALAVLELVCRSGWP"
FT   assembly_gap    11564925..11565032
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    11566121..11566311
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   gene            complement(11572761..11664065)
FT                   /gene="Fcho2"
FT                   /locus_tag="mCG_116571"
FT                   /note="gene_id=mCG116571.1"
FT   mRNA            complement(join(11572761..11575129,11575414..11575578,
FT                   11579548..11579612,11580136..11580335,11581436..11581568,
FT                   11581877..11582032,11584382..11584493,11592596..11592725,
FT                   11594986..11595089,11597401..11597489,11599037..11599064,
FT                   11613504..11613548,11624743..11624839,11626311..11626409,
FT                   11633710..11633814,11638308..11638460,11638677..11638818,
FT                   11645238..11645312,11655268..11655371,11664006..11664065))
FT                   /gene="Fcho2"
FT                   /locus_tag="mCG_116571"
FT                   /product="FCH domain only 2"
FT                   /note="gene_id=mCG116571.1 transcript_id=mCT117694.1
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(11575107..11575129,11575414..11575578,
FT                   11579548..11579612,11580136..11580335,11581436..11581568,
FT                   11581877..11582032,11584382..11584493,11592596..11592725,
FT                   11594986..11595089,11597401..11597489,11599037..11599064,
FT                   11613504..11613548,11624743..11624839,11626311..11626409,
FT                   11633710..11633814,11638308..11638460,11638677..11638818,
FT                   11645238..11645312,11655268..11655371,11664006..11664038))
FT                   /codon_start=1
FT                   /gene="Fcho2"
FT                   /locus_tag="mCG_116571"
FT                   /product="FCH domain only 2"
FT                   /note="gene_id=mCG116571.1 transcript_id=mCT117694.1
FT                   protein_id=mCP51802.1 partial"
FT                   /protein_id="EDL00843.1"
FT                   /translation="MVMAHFVENFWGEKNNGXXXXXXXLYHNMKHGQISTKELADFVRE
FT                   RATIEEAYSRSMTKLAKSASNYSQLGTFAPMWDVFKTSTEKLANCHLDLVRKLQELIKE
FT                   VQKYGEEQVKSHKKTKEEVAGTLEAVQAIQNITQALQKSKENYTAKCVEQERLKKEGAT
FT                   QREIEKAAVKSKKATDTYKLYVEKYALTKADFEQKMTETAQKFQDIEETHLIHIKEIIG
FT                   SLSNAVKEIHLQIGQVHEEFINNMANTTIESLIQKFAESKGTGKERPGLIEFEECDPAS
FT                   AVEESKPSSLPTEKGTNDLLAWDPLFGSSLESSSAPLTSSSSARPTTPLSLGTLVPPPR
FT                   PASRPKLASGKLSGINEIPRPFSPPVTSNTSPPPTAPLARAESSSSISSSASLSAANTP
FT                   TVGVSRGPSPVSLGNQDTLPVAIALTESVNAYFKGADPTKCIVKITGDVTISFPSGIIK
FT                   VFTSNPSPAVLCFRVKNISRLEQILPNSQLVFSDPSQCDSNTKDFWMNMQAVTIYLKKL
FT                   SEQNPAASYYNVDVLKYQVSSNGIQSTPLNLATYWKCSASTTDLRVDYKYNPEAMVAPS
FT                   VLSNIQVVVPVDGGVTNMQSLPPAIWNAEQMKAFWKLSGISEKSDSGGSGSLRAKFDLS
FT                   EGPSKPTTLAVQFLSEGNTLSGVDIELVGTGYRLSLVKKRFATGRYLADC"
FT   assembly_gap    11591062..11591228
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    11603102..11603936
FT                   /estimated_length=835
FT                   /gap_type="unknown"
FT   assembly_gap    11606321..11606340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11608589..11609211
FT                   /estimated_length=623
FT                   /gap_type="unknown"
FT   assembly_gap    11620650..11620669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11647557..11653416
FT                   /locus_tag="mCG_144917"
FT                   /note="gene_id=mCG144917.0"
FT   mRNA            join(<11647557..11650093,11652513..11652711,
FT                   11652874..11652900,11653382..11653416)
FT                   /locus_tag="mCG_144917"
FT                   /product="mCG144917"
FT                   /note="gene_id=mCG144917.0 transcript_id=mCT184341.0
FT                   created on 05-JUN-2003"
FT   CDS             <11648873..11649124
FT                   /codon_start=1
FT                   /locus_tag="mCG_144917"
FT                   /product="mCG144917"
FT                   /note="gene_id=mCG144917.0 transcript_id=mCT184341.0
FT                   protein_id=mCP105297.0"
FT                   /protein_id="EDL00844.1"
FT                   /translation="APEQLGPDSESMSEKKSKNQPTRKGKGTREALHRLRVLTADIRQN
FT                   WGTSWKRGERIVGVREEGLRTLWAVLNPQNPLSRAHRH"
FT   assembly_gap    11650099..11650118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11655335..11655354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11663844..11663988
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   gene            11665673..11666131
FT                   /pseudo
FT                   /locus_tag="mCG_1047090"
FT                   /note="gene_id=mCG1047090.1"
FT   mRNA            join(11665673..11665901,11665975..11666131)
FT                   /pseudo
FT                   /locus_tag="mCG_1047090"
FT                   /note="gene_id=mCG1047090.1 transcript_id=mCT164794.1
FT                   created on 19-FEB-2003"
FT   gene            complement(11687954..11775145)
FT                   /gene="Tnpo1"
FT                   /locus_tag="mCG_116574"
FT                   /note="gene_id=mCG116574.1"
FT   mRNA            complement(join(11687954..11693553,11695354..11695496,
FT                   11696260..11696334,11698087..11698186,11699040..11699115,
FT                   11701788..11701883,11702327..11702425,11704070..11704157,
FT                   11704239..11704505,11705816..11705902,11707313..11707484,
FT                   11708772..11708997,11709650..11709802,11712731..11712899,
FT                   11713451..11713511,11713992..11714110,11716070..11716192,
FT                   11719388..11719469,11724734..11724867,11727750..11727856,
FT                   11733653..11733802,11737604..11737679,11739782..11739895,
FT                   11775010..11775145))
FT                   /gene="Tnpo1"
FT                   /locus_tag="mCG_116574"
FT                   /product="transportin 1"
FT                   /note="gene_id=mCG116574.1 transcript_id=mCT117697.1
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(11695389..11695496,11696260..11696334,
FT                   11698087..11698186,11699040..11699115,11701788..11701883,
FT                   11702327..11702425,11704070..11704157,11704239..11704505,
FT                   11705816..11705902,11707313..11707484,11708772..11708997,
FT                   11709650..11709802,11712731..11712899,11713451..11713511,
FT                   11713992..11714110,11716070..11716192,11719388..11719469,
FT                   11724734..11724867,11727750..11727856,11733653..11733802,
FT                   11737604..11737679,11739782..11739886))
FT                   /codon_start=1
FT                   /gene="Tnpo1"
FT                   /locus_tag="mCG_116574"
FT                   /product="transportin 1"
FT                   /note="gene_id=mCG116574.1 transcript_id=mCT117697.1
FT                   protein_id=mCP51815.1"
FT                   /protein_id="EDL00842.1"
FT                   /translation="MEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPD
FT                   FNNYLIFVLTKLKSEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSP
FT                   LIRATVGILITTIASKGELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEIL
FT                   DSDVLDRPLNIMIPKFLQFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFA
FT                   LAGDEEAEVRKNVCRALVMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWL
FT                   TLAEQPICKDVLVRHLPKLIPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFH
FT                   RSRTVAQQHEEDGIEEEDDDDDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHIL
FT                   PLLKELLFHHEWVVKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSIT
FT                   CWTLSRYAHWVVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTELVP
FT                   YLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNML
FT                   KDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQAMLNNAQPEQYEA
FT                   PDKDFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPEVRQSSFALLGDL
FT                   TKACFQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGEISIQMGIEMQPYIPMVLHQ
FT                   LVEIINRPNTPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDS
FT                   AFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRR
FT                   FSDQFPLPLKERLAAFYGV"
FT   assembly_gap    11708204..11708223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11716478..11716672
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    11739464..11739769
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    11743528..11743547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11747632..11747651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11753125..11753384
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    11773245..11773264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11785508..>11794691)
FT                   /locus_tag="mCG_144918"
FT                   /note="gene_id=mCG144918.0"
FT   mRNA            complement(join(11785508..11786898,11789038..11789185,
FT                   11794567..>11794691))
FT                   /locus_tag="mCG_144918"
FT                   /product="mCG144918"
FT                   /note="gene_id=mCG144918.0 transcript_id=mCT184342.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(11786783..11786898,11789038..11789185,
FT                   11794567..>11794599))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144918"
FT                   /product="mCG144918"
FT                   /note="gene_id=mCG144918.0 transcript_id=mCT184342.0
FT                   protein_id=mCP105298.0"
FT                   /protein_id="EDL00841.1"
FT                   /translation="LSKGEESIIQYLKPKALEAKEAVLADTERNPACHPPSSGPRVRSS
FT                   EGSTHTLEREPRKNKPSEGWLSEVSVSLLFCFSGRRLCDHTVRLIPKACRNFQ"
FT   assembly_gap    11801309..11801996
FT                   /estimated_length=688
FT                   /gap_type="unknown"
FT   assembly_gap    11817409..11817428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11823109..11823536
FT                   /estimated_length=428
FT                   /gap_type="unknown"
FT   assembly_gap    11830304..11830455
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            complement(11833874..>11834350)
FT                   /locus_tag="mCG_142522"
FT                   /note="gene_id=mCG142522.0"
FT   mRNA            complement(11833874..>11834350)
FT                   /locus_tag="mCG_142522"
FT                   /product="mCG142522"
FT                   /note="gene_id=mCG142522.0 transcript_id=mCT180634.0
FT                   created on 19-FEB-2003"
FT   CDS             complement(11833929..>11834348)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142522"
FT                   /product="mCG142522"
FT                   /note="gene_id=mCG142522.0 transcript_id=mCT180634.0
FT                   protein_id=mCP103556.0"
FT                   /protein_id="EDL00840.1"
FT                   /translation="ALLLSIPKGQGETTSTMAKPTFKRQCYIKRHLRPLYRKHSRCSSI
FT                   NLGHGNYSLYINRVLKEVVPNRGISSYSVDIMNILINDIFERIATEACQQMFLRKRCTL
FT                   TPGDIQQAVHLLLPKKLATLAVTFGSKAVHRFIHS"
FT   assembly_gap    11837509..11837528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11848708..11863177
FT                   /locus_tag="mCG_146980"
FT                   /note="gene_id=mCG146980.0"
FT   mRNA            join(11848708..11848815,11862312..11863177)
FT                   /locus_tag="mCG_146980"
FT                   /product="mCG146980"
FT                   /note="gene_id=mCG146980.0 transcript_id=mCT187243.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    11854176..11855030
FT                   /estimated_length=855
FT                   /gap_type="unknown"
FT   assembly_gap    11859497..11859516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             11862702..11862896
FT                   /codon_start=1
FT                   /locus_tag="mCG_146980"
FT                   /product="mCG146980"
FT                   /note="gene_id=mCG146980.0 transcript_id=mCT187243.0
FT                   protein_id=mCP108191.0"
FT                   /protein_id="EDL00839.1"
FT                   /translation="MDSASITHLLNIHLRASFMVGTLYIVISQMVIGSVSWQPASLKLQ
FT                   CKCTKNPTEYVLKNLSQAF"
FT   assembly_gap    11871012..11871338
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    11874350..11874369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11884859..11884878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11909254..11909413
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   gene            complement(11918640..>11926084)
FT                   /locus_tag="mCG_1047181"
FT                   /note="gene_id=mCG1047181.1"
FT   mRNA            complement(join(11918640..11918914,11920823..11920964,
FT                   11921047..11921152,11925776..11925807,11925960..>11926084))
FT                   /locus_tag="mCG_1047181"
FT                   /product="mCG1047181"
FT                   /note="gene_id=mCG1047181.1 transcript_id=mCT164885.0
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(11921133..11921152,11925776..11925807,
FT                   11925960..11926084))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047181"
FT                   /product="mCG1047181"
FT                   /note="gene_id=mCG1047181.1 transcript_id=mCT164885.0
FT                   protein_id=mCP51915.0"
FT                   /protein_id="EDL00838.1"
FT                   /translation="MTVHPPYSAAVSSLIQRPSFALTEVNLQNPRVIRQKCYKSKVNSA
FT                   CLPQVNEGRSLSL"
FT   assembly_gap    11926736..11928806
FT                   /estimated_length=2071
FT                   /gap_type="unknown"
FT   assembly_gap    11930753..11930960
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    11947162..11948378
FT                   /estimated_length=1217
FT                   /gap_type="unknown"
FT   assembly_gap    11958707..11958726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11960549..11960568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11962964..11962983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11966512..11968213
FT                   /locus_tag="mCG_1047180"
FT                   /note="gene_id=mCG1047180.1"
FT   mRNA            join(11966512..11966662,11967408..11967816,
FT                   11967839..11968213)
FT                   /locus_tag="mCG_1047180"
FT                   /product="mCG1047180"
FT                   /note="gene_id=mCG1047180.1 transcript_id=mCT164884.0
FT                   created on 19-FEB-2003"
FT   CDS             11967449..11967760
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047180"
FT                   /product="mCG1047180"
FT                   /note="gene_id=mCG1047180.1 transcript_id=mCT164884.0
FT                   protein_id=mCP51911.1"
FT                   /protein_id="EDL00837.1"
FT                   /translation="MGTREMAMWTKVLVTKPDRLGLVPRTYTAEGENLSPQVVLRPSSS
FT                   LECFELCRTVESSLPLPGKDSCSLRLQSFPSNLTCRLLKTTKLLLDLQDSQASLIVFF"
FT   assembly_gap    11969636..11973075
FT                   /estimated_length=3440
FT                   /gap_type="unknown"
FT   assembly_gap    11974625..11974644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11975938..11975957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11977202..11977221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11980590..11980609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12008448..12008467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12014561..12014580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12021036..12021101
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   gene            12025526..>12087380
FT                   /gene="Zfp366"
FT                   /locus_tag="mCG_116570"
FT                   /note="gene_id=mCG116570.1"
FT   mRNA            join(12025526..12025567,12069091..12070201,
FT                   12070260..12070428,12074881..12075072,12084723..12084897,
FT                   12086830..>12087380)
FT                   /gene="Zfp366"
FT                   /locus_tag="mCG_116570"
FT                   /product="zinc finger protein 366"
FT                   /note="gene_id=mCG116570.1 transcript_id=mCT117693.1
FT                   created on 19-NOV-2002"
FT   assembly_gap    12045202..12045221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(12069105..12070201,12070260..12070428,
FT                   12074881..12075072,12084723..12084897,12086830..12087380)
FT                   /codon_start=1
FT                   /gene="Zfp366"
FT                   /locus_tag="mCG_116570"
FT                   /product="zinc finger protein 366"
FT                   /note="gene_id=mCG116570.1 transcript_id=mCT117693.1
FT                   protein_id=mCP51801.1"
FT                   /protein_id="EDL00836.1"
FT                   /translation="MQKAMKMVKDEDGPLNAAAKSIPSFPHCLQPEASRGKAPQRHPFP
FT                   EALRGPFSQFRYEPSPGDLDGFPEVFEGGGSRKRKSMPTKVPYTHPAEEASIAQESKSL
FT                   GPPNLTLLFPQPQRPKCDSQMIDLCNVGLQFYRTLEHLGGKPVKQEPVKPSAMWPQPTP
FT                   PAFLPAPYPYYPKVHPGLMFPFFVPSSSPFPFSRHTFLPKQPPEPVLPRKVEPLESEET
FT                   KQKVERVDVNVQIDDSYYVDVGGAQKRWQCPTCEKSYTSKYNLVTHILGHSGIKPHACS
FT                   RCGKLFKQLSHLHTHMLTHQGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVKPHNCRVCS
FT                   RGFAYPSELKAHEAKHASGRENICVEGPIQYNCSECDKTFQYPSQLQNHMMKHKDIRPY
FT                   ICSECGMEFVQPHHLKQHSLTHKGVKEHKCGICGREFTLLANMKRHVLIHTNIRAYQCH
FT                   LCYKSFVQKQTLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGHLHLHSDSKPFKCLYCP
FT                   SKFTLKGNLTRHMKVKHGVMERGLHSQGLGRGRLVLVQSAGVLRNLEQEEPFDLSQKRS
FT                   ANGPMFQSDVDSTQDCLCQEEEEEAGEEDNCYEVEPYSPSLAPESQQLCAPEDLSTKQE
FT                   QTLQDPGEGCRDQDAPEEQQEDRSEDHEGSDIDCEGKDIDCAIREERLSSRLLQSGGQG
FT                   PSFSDYLYFKHRDEGLKELLERKMEKQAVLLGI"
FT   assembly_gap    12072526..12072545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12084483..12084528
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    12088340..12088359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12093517..12093536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12116392..12116457
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    12156825..12156844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12160095..12184964)
FT                   /gene="Ptcd2"
FT                   /locus_tag="mCG_116575"
FT                   /note="gene_id=mCG116575.1"
FT   mRNA            complement(join(12160095..12160837,12162005..12162118,
FT                   12166923..12166997,12170237..12170350,12172724..12172815,
FT                   12173176..12173254,12176943..12177060,12180173..12180302,
FT                   12183591..12183683,12184832..12184964))
FT                   /gene="Ptcd2"
FT                   /locus_tag="mCG_116575"
FT                   /product="pentatricopeptide repeat domain 2"
FT                   /note="gene_id=mCG116575.1 transcript_id=mCT117698.1
FT                   created on 19-NOV-2002"
FT   CDS             complement(join(12160613..12160837,12162005..12162118,
FT                   12166923..12166997,12170237..12170350,12172724..12172815,
FT                   12173176..12173254,12176943..12177060,12180173..12180302,
FT                   12183591..12183683,12184832..12184937))
FT                   /codon_start=1
FT                   /gene="Ptcd2"
FT                   /locus_tag="mCG_116575"
FT                   /product="pentatricopeptide repeat domain 2"
FT                   /note="gene_id=mCG116575.1 transcript_id=mCT117698.1
FT                   protein_id=mCP51967.1"
FT                   /protein_id="EDL00835.1"
FT                   /translation="MATVFRPLERLRVPRPSLHPGVTGSGSACCRCTLGAKRYLLTDNI
FT                   VKLKEFQHKKIAIAYNLPGTKEIYFRNLEEKLTQNKLILKEELKTLLYLCQSLEDVQLA
FT                   KAVIYRYHAENKNFTLGEYKFGPVFMRLCYELDLEDSAVELVRDKHLQGFFLDSTSFNI
FT                   LMDMLFTKGKYERALQVLIEMKNQDVRFSKETYILAFAICYKLNTLESLKICTTLREEA
FT                   LIKGDIICRRAYCFVVALALNKNQLKNAVSIFSQIVNPESIVCINLNILIHIQSNMLES
FT                   LLKILEDSLDTNLSKFVRRHTFSEEVLAKVREKLKDSPALIARFDEVYGKLHVNGQITV
FT                   HSLDALLCHVPRDKRSNLLLLKKRAVSHRTLQPLSRSLLTE"
FT   gene            12185056..12258905
FT                   /gene="Mrps27"
FT                   /locus_tag="mCG_116577"
FT                   /note="gene_id=mCG116577.1"
FT   mRNA            join(12185056..12185144,12188600..12188677,
FT                   12203352..12203422,12205610..12205668,12242489..12242603,
FT                   12246137..12246215,12247621..12247736,12252501..12252603,
FT                   12253970..12254112,12255504..12255674,12258083..12258905)
FT                   /gene="Mrps27"
FT                   /locus_tag="mCG_116577"
FT                   /product="mitochondrial ribosomal protein S27, transcript
FT                   variant mCT117700"
FT                   /note="gene_id=mCG116577.1 transcript_id=mCT117700.0
FT                   created on 19-NOV-2002"
FT   mRNA            join(12185070..12185144,12188600..12188677,
FT                   12203352..12203422,12205610..12205668,12242489..12242603,
FT                   12246137..12246203,12258162..12258904)
FT                   /gene="Mrps27"
FT                   /locus_tag="mCG_116577"
FT                   /product="mitochondrial ribosomal protein S27, transcript
FT                   variant mCT176036"
FT                   /note="gene_id=mCG116577.1 transcript_id=mCT176036.0
FT                   created on 19-NOV-2002"
FT   CDS             join(12185072..12185144,12188600..12188677,
FT                   12203352..12203422,12205610..12205668,12242489..12242603,
FT                   12246137..12246215,12247621..12247736,12252501..12252603,
FT                   12253970..12254112,12255504..12255674,12258083..12258322)
FT                   /codon_start=1
FT                   /gene="Mrps27"
FT                   /locus_tag="mCG_116577"
FT                   /product="mitochondrial ribosomal protein S27, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG116577.1 transcript_id=mCT117700.0
FT                   protein_id=mCP51973.1 isoform=CRA_a"
FT                   /protein_id="EDL00832.1"
FT                   /translation="MAAPMVRCGMLLARRLDASRLSLAGKRCLLSAAYVDSHQWEAREK
FT                   EEYHLADLASLMDKAYERKLPVSSLSISRFVDNIASREDLDSAEYYLYKFRHSPNCWYL
FT                   RDWTIHSWIRQCLKYGAQDKALYTLVNKVQYGIFPDNFTFNLLMDYFIKKGNYKDALSV
FT                   VFEIMMQEAFDVPSTQFLSLYVLYRCLAEKTELTWEEERDFGASLLLSGLKQRNTVGLS
FT                   SQLYGYALLGKVELQRGVRAVYHGMPLMWTPGYLDRALQVMERVASSPEDLKLGREVLD
FT                   VLDGVLKVVTCPDGQTSEAQPQEGEDGLGSANLVEQLDTEEPEQSKLPRYLERFQASRS
FT                   KLQELNRVESESLLTLTTQLVKEKLPACEAEDLATYEQKLREWHLERVQLIQREQEQRE
FT                   KAKQEYQALSAAEKAA"
FT   CDS             join(12185072..12185144,12188600..12188677,
FT                   12203352..12203422,12205610..12205668,12242489..12242603,
FT                   12246137..12246203,12258162..12258322)
FT                   /codon_start=1
FT                   /gene="Mrps27"
FT                   /locus_tag="mCG_116577"
FT                   /product="mitochondrial ribosomal protein S27, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG116577.1 transcript_id=mCT176036.0
FT                   protein_id=mCP98958.0 isoform=CRA_b"
FT                   /protein_id="EDL00833.1"
FT                   /translation="MAAPMVRCGMLLARRLDASRLSLAGKRCLLSAAYVDSHQWEAREK
FT                   EEYHLADLASLMDKAYERKLPVSSLSISRFVDNIASREDLDSAEYYLYKFRHSPNCWYL
FT                   RDWTIHSWIRQCLKYGAQDKALYTLVNKVQYGIFPDNFTFNLLMDYFIKKEKLPACEAE
FT                   DLATYEQKLREWHLERVQLIQREQEQREKAKQEYQALSAAEKAA"
FT   assembly_gap    12210068..12210141
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    12221838..12221857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12223564..12223583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12244154..12244173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12251302..12256186)
FT                   /locus_tag="mCG_1050922"
FT                   /note="gene_id=mCG1050922.0"
FT   mRNA            complement(join(12251302..12254263,12254534..12254824,
FT                   12255449..12256186))
FT                   /locus_tag="mCG_1050922"
FT                   /product="mCG1050922"
FT                   /note="gene_id=mCG1050922.0 transcript_id=mCT194711.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(12252893..12253156)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050922"
FT                   /product="mCG1050922"
FT                   /note="gene_id=mCG1050922.0 transcript_id=mCT194711.0
FT                   protein_id=mCP115740.0"
FT                   /protein_id="EDL00834.1"
FT                   /translation="MAAYPKGPGPLLISNSQVHFLSLTNFLNDLCNTAVLNTNLNTLPP
FT                   GCTNTWDQQVTVPERCSLTFLPHLESKSKTQMIVGGHWESIG"
FT   gene            complement(12265283..>12359920)
FT                   /gene="Mtap1b"
FT                   /locus_tag="mCG_116569"
FT                   /note="gene_id=mCG116569.1"
FT   mRNA            complement(join(12265283..12269798,12271059..12271297,
FT                   12273052..12279542,12285464..12285604,12288040..12288122,
FT                   12351484..12351585,12359684..>12359920))
FT                   /gene="Mtap1b"
FT                   /locus_tag="mCG_116569"
FT                   /product="microtubule-associated protein 1 B"
FT                   /note="gene_id=mCG116569.1 transcript_id=mCT117692.1
FT                   created on 11-NOV-2002"
FT   CDS             complement(join(12269643..12269798,12271059..12271297,
FT                   12273052..>12277150))
FT                   /codon_start=1
FT                   /gene="Mtap1b"
FT                   /locus_tag="mCG_116569"
FT                   /product="microtubule-associated protein 1 B"
FT                   /note="gene_id=mCG116569.1 transcript_id=mCT117692.1
FT                   protein_id=mCP51933.1"
FT                   /protein_id="EDL00830.1"
FT                   /translation="PTEDDESAKAEADVHLKEKRESVVSGDDRAEEDMDDVLEKGEAEQ
FT                   SEEEGEEEDKAEDAREEGYEPDKTEAEDYVMAVADKAAEAGVTEEQYGYLGTSAKQPGI
FT                   QSPSREPASSIHDETLPGGSESEATASDEENREDQPEEFTATSGYTQSTIEISSEPTPM
FT                   DEMSTPRDVMSDETNNEETESPSQEFVNITKYESSLYSQEYSKPAVASFNGLSEGSKTD
FT                   ATDGKDYNASASTISPPSSMEEDKFSKSALRDAYCSEEKELKASAELDIKDVSDERLSP
FT                   AKSPSLSPSPPSPIEKTPLGERSVNFSLTPNEIKVSAEGEARSVSPGVTQAVVEEHCAS
FT                   PEEKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVTEKPQAVPVSFEFSEAKDE
FT                   NERASLSPMDEPVPDSESPVEKVLSPLRSPPLLGSESPYEDFLSADSKVLGRRSESPFE
FT                   GKNGKQGFPDRESPVSDLTSTGLYQDKQEEKSTGFIPIKEDFGPEKKTSDVETMSSQSA
FT                   LALDERKLGGDVSPTQIDVSQFGSFKEDTKMSISEGTVSDKSATPVDEGVAEDTYSHME
FT                   GVASVSTASVATSSFPEPTTDDVSPSLHAEVGSPHSTEVDDSLSVSVVQTPTTFQETEM
FT                   SPSKEECPRPMSISPPDFSPKTAKSRTPVQDHRSEQSSMSIEFGQESPEHSFAMDFSRQ
FT                   SPDHPTLGASVLHITENGPTEVDYSPSDIQDSSLSHKIPPTEEPSYTQDNDLSELISVS
FT                   QVEASPSTSSAHTPSQIASPLQEDTLSDVVPPREMSLYASLASEKVQSLEGEKLSPKSD
FT                   ISPLTPRESSPLYSPGFSDSTSAAKETAAAHQASSSPPIDAATAEPYGFRSSMLFDTMQ
FT                   HHLALNRDLTTSSVEKDSGGKTPGDFNYAYQKPENAAGSPDEEDYDYESQEKTIRTHDV
FT                   GGYYYEKTERTIKSPCDSGYSYETIEKTTKTPEDGGYTCEITEKTTRTPEEGGYSYEIS
FT                   EKTTRTPEVSGYTYEKTERSRRLLDDISNGYDDTEDGGHTLGDCSYSYETTEKITSFPE
FT                   SESYSYETSTKTTRSPDTSAYCYETMEKITKTPQASTYSYETSDRCYTTEKKSPSEARQ
FT                   DVDLCLVSSCEFKHPKTELSPSFINPNPLEWFAGEEPTEESEKPLTQSGGAPPPSGGKQ
FT                   QGRQCDETPPTSVSESAPSQTDSDVPPETEECPSITADANIDSEDESETIPTDKTVTYK
FT                   HMDPPPAPMQDRSPSPRHPDVSMVDPDALAVDQNLGKALKKDLKEKTKTKKPGTKTKSS
FT                   SPVKKGDGKSKPLAASPKPGALKESSDKVSRVASPKKKESVEKATKTTTTPEVKATRGE
FT                   EKDKETKNAANASASKSAKTATTGPGTTKTAKSSTVPPGLPVYLDLCYIPNHSNSKNVD
FT                   VEFFKRVRSSYYVVSGNDPAAEEPSRAVLDALLEGKAQWGSNMQVTLIPTHDSEVMREW
FT                   YQETHEKQQDLNIMVLASSSTVVMQDESFPACKIEL"
FT   assembly_gap    12295659..12295721
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    12318516..12318845
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    12323944..12323963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12336431..12336555
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   gene            complement(12345842..12347808)
FT                   /locus_tag="mCG_141524"
FT                   /note="gene_id=mCG141524.0"
FT   mRNA            complement(12345842..12347808)
FT                   /locus_tag="mCG_141524"
FT                   /product="mCG141524"
FT                   /note="gene_id=mCG141524.0 transcript_id=mCT175792.0
FT                   created on 11-NOV-2002"
FT   CDS             complement(12346002..12346325)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141524"
FT                   /product="mCG141524"
FT                   /note="gene_id=mCG141524.0 transcript_id=mCT175792.0
FT                   protein_id=mCP98714.0"
FT                   /protein_id="EDL00831.1"
FT                   /translation="MVPAWERVILLQTPSFHRPSLSSLPSLLAGRAACLPSLGHICPCP
FT                   IVPFRLMGPDHSTEPAIVKTAQSHTGLGVLWCLWHEAFDTCKICMPLGFQVSGVLYIHS
FT                   LAH"
FT   gene            <12360081..12369450
FT                   /locus_tag="mCG_1047177"
FT                   /note="gene_id=mCG1047177.1"
FT   mRNA            join(<12360081..12360238,12368955..12369450)
FT                   /locus_tag="mCG_1047177"
FT                   /product="mCG1047177"
FT                   /note="gene_id=mCG1047177.1 transcript_id=mCT164881.1
FT                   created on 11-NOV-2002"
FT   CDS             <12368973..12369284
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047177"
FT                   /product="mCG1047177"
FT                   /note="gene_id=mCG1047177.1 transcript_id=mCT164881.1
FT                   protein_id=mCP51887.0"
FT                   /protein_id="EDL00829.1"
FT                   /translation="SLTSFSKLLHRKPQCDSSAVHSLFPICRPSADLCVLQTDVAMAVC
FT                   LCVFSSLGTDGWSRADRLRVLLYFNMSCLLLSRDLKGSQLLSSCHITTSSSKLPGFSS"
FT   assembly_gap    12374977..12375216
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    12380740..12381034
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    12382791..12382810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12384737..12388213
FT                   /estimated_length=3477
FT                   /gap_type="unknown"
FT   assembly_gap    12395734..12395753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12397058..12397077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12410208..12410227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12430298..12430317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12440164..12440183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12450016..12450474
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   assembly_gap    12451424..12451443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12471725..12471744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12473316..12473335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12475186..12475329
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    12498693..12499507
FT                   /estimated_length=815
FT                   /gap_type="unknown"
FT   assembly_gap    12503660..12503679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12504865..12504884
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12506010..12506632
FT                   /estimated_length=623
FT                   /gap_type="unknown"
FT   assembly_gap    12509896..12509915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12513054..12513141
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    12526959..12526978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12537248..12537310
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    12551806..12551825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12556019..12556038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12598082..12598101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12603113..12603132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12615611..12616608
FT                   /estimated_length=998
FT                   /gap_type="unknown"
FT   assembly_gap    12618771..12619480
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   assembly_gap    12647420..12647439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12652300..12652994
FT                   /estimated_length=695
FT                   /gap_type="unknown"
FT   assembly_gap    12660051..12660415
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    12673466..12673633
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    12704656..12704675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12707353..12707664
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    12708176..12709767
FT                   /estimated_length=1592
FT                   /gap_type="unknown"
FT   assembly_gap    12720349..12720368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12726344..12726363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12733466..12733485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12734673..12734692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12736820..12737038
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   gene            complement(12738640..12741080)
FT                   /gene="Cart"
FT                   /locus_tag="mCG_116164"
FT                   /note="gene_id=mCG116164.1"
FT   mRNA            complement(join(12738640..12738959,12740393..12740515,
FT                   12740912..>12741070))
FT                   /gene="Cart"
FT                   /locus_tag="mCG_116164"
FT                   /product="cocaine and amphetamine regulated transcript,
FT                   transcript variant mCT117281"
FT                   /note="gene_id=mCG116164.1 transcript_id=mCT117281.1
FT                   created on 21-SEP-2002"
FT   mRNA            complement(join(12738730..12738959,12740393..12740476,
FT                   12740912..12741080))
FT                   /gene="Cart"
FT                   /locus_tag="mCG_116164"
FT                   /product="cocaine and amphetamine regulated transcript,
FT                   transcript variant mCT173342"
FT                   /note="gene_id=mCG116164.1 transcript_id=mCT173342.0
FT                   created on 21-SEP-2002"
FT   CDS             complement(join(12738915..12738959,12740393..12740476,
FT                   12740912..12741070))
FT                   /codon_start=1
FT                   /gene="Cart"
FT                   /locus_tag="mCG_116164"
FT                   /product="cocaine and amphetamine regulated transcript,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG116164.1 transcript_id=mCT173342.0
FT                   protein_id=mCP96261.0 isoform=CRA_b"
FT                   /protein_id="EDL00828.1"
FT                   /translation="MESSRLRLLPLLGAALLLLLPLLGARAQEDAELQPRALDIYSAVD
FT                   DASHEKELIEALQEVLKKLKSKRIPIYEKKYGQVPMCVTVPEELPAILSS"
FT   CDS             complement(join(12738915..12738959,12740393..12740515,
FT                   12740912..12741070))
FT                   /codon_start=1
FT                   /gene="Cart"
FT                   /locus_tag="mCG_116164"
FT                   /product="cocaine and amphetamine regulated transcript,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG116164.1 transcript_id=mCT117281.1
FT                   protein_id=mCP51865.1 isoform=CRA_a"
FT                   /protein_id="EDL00827.1"
FT                   /translation="MESSRLRLLPLLGAALLLLLPLLGARAQEDAELQPRALDIYSAVD
FT                   DASHEKELPRRQLRAPGAMLQIEALQEVLKKLKSKRIPIYEKKYGQVPMCVTVPEELPA
FT                   ILSS"
FT   assembly_gap    12738960..12739864
FT                   /estimated_length=905
FT                   /gap_type="unknown"
FT   assembly_gap    12742097..12742116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12754863..12754930
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    12772846..12772865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12789809..12857453)
FT                   /gene="Mccc2"
FT                   /locus_tag="mCG_116168"
FT                   /note="gene_id=mCG116168.1"
FT   mRNA            complement(join(12789809..12790236,12793432..12793517,
FT                   12795412..12795526,12795891..12796047,12800083..12800149,
FT                   12802178..12802254,12805098..12805170,12808931..12809026,
FT                   12809124..12809223,12813498..12813562,12818129..12818242,
FT                   12830380..12830492,12832092..12832219,12833056..12833157,
FT                   12835411..12835495,12842090..12842156,12857227..12857453))
FT                   /gene="Mccc2"
FT                   /locus_tag="mCG_116168"
FT                   /product="methylcrotonoyl-Coenzyme A carboxylase 2 (beta)"
FT                   /note="gene_id=mCG116168.1 transcript_id=mCT117285.1
FT                   created on 08-NOV-2002"
FT   CDS             complement(join(12790119..12790236,12793432..12793517,
FT                   12795412..12795526,12795891..12796047,12800083..12800149,
FT                   12802178..12802254,12805098..12805170,12808931..12809026,
FT                   12809124..12809223,12813498..12813562,12818129..12818242,
FT                   12830380..12830492,12832092..12832219,12833056..12833157,
FT                   12835411..12835495,12842090..12842156,12857227..12857355))
FT                   /codon_start=1
FT                   /gene="Mccc2"
FT                   /locus_tag="mCG_116168"
FT                   /product="methylcrotonoyl-Coenzyme A carboxylase 2 (beta)"
FT                   /note="gene_id=mCG116168.1 transcript_id=mCT117285.1
FT                   protein_id=mCP51739.1"
FT                   /db_xref="GOA:B2RUK5"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="MGI:MGI:1925288"
FT                   /db_xref="UniProtKB/TrEMBL:B2RUK5"
FT                   /protein_id="EDL00826.1"
FT                   /translation="MWGALRSALRPCCRAAVPPQRAYHGDSVARLGTQPDSASSTYQEN
FT                   YEQMKALVSQLHERAQYVRLGGSEKARARHTSRGKLLPRDRIDNLIDPGSPFLEFSQFA
FT                   GYQLYGDEEVPAGGIITGIGRVSGVECMIVANDATVKGGTYYPVTVKKHVRAQEIALQN
FT                   RLPCIYLVDSGGANLPRQADTFPDRDHFGRIFYNQAIMSSKNITQIAVVMGSCTAGGAY
FT                   VPAMADENIIVQKQGTIFLAGPPLVKAATGEEVSAEDLGGADLHCRKSGVTDHYALDDH
FT                   HALHLTRKVVRSLNYQKKMDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIARIVD
FT                   GSRFNEFKALYGDTLVTGFARIFGYPVGIIGNNGVLFSESAKKGAHFVQLCCQRNIPLL
FT                   FLQNITGFMVGRDYEAEGIAKDGAKMVAAVACAKVPKITVIIGGSYGAGNYGMCGRAYS
FT                   PRFLYMWPNARISVMGGEQAATVLATVARDQKAREGKQFSSAEEAALKEPIIKRFEEEG
FT                   NPYYSSARLWDDGIIDPVDTRLVLGLSLSAALNAPIQRTDFGIFRM"
FT   assembly_gap    12811740..12812171
FT                   /estimated_length=432
FT                   /gap_type="unknown"
FT   assembly_gap    12821632..12822009
FT                   /estimated_length=378
FT                   /gap_type="unknown"
FT   assembly_gap    12853171..12853190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12859838..12945762)
FT                   /locus_tag="mCG_116166"
FT                   /note="gene_id=mCG116166.1"
FT   mRNA            complement(join(12859838..12862251,12865439..12865694,
FT                   12867236..12867494,12869274..12869310,12872628..12872832,
FT                   12876899..12877085,12877594..12877654,12879575..12879752,
FT                   12879937..12880087,12883181..12883341,12883819..12884044,
FT                   12885518..12885610,12886031..12886067,12888468..12888581,
FT                   12891378..12891771,12892687..12892871,12893090..12893297,
FT                   12894715..12894860,12896839..12897046,12897898..12898079,
FT                   12900465..12900684,12901228..12901409,12902033..12903248,
FT                   12906101..12906231,12907619..12907808,12909207..12909298,
FT                   12911814..12911973,12916124..12916282,12917242..12917380,
FT                   12919565..12919846,12920392..12920532,12925874..12925928,
FT                   12931086..12931180,12933923..12934056,12935143..12935271,
FT                   12939267..12939326,12940215..12940324,12940682..12940958,
FT                   12945355..12945762))
FT                   /locus_tag="mCG_116166"
FT                   /product="mCG116166"
FT                   /note="gene_id=mCG116166.1 transcript_id=mCT117283.1
FT                   created on 08-NOV-2002"
FT   CDS             complement(join(12862120..12862251,12865439..12865694,
FT                   12867236..12867494,12869274..12869310,12872628..12872832,
FT                   12876899..12877085,12877594..12877654,12879575..12879752,
FT                   12879937..12880087,12883181..12883341,12883819..12884044,
FT                   12885518..12885610,12886031..12886067,12888468..12888581,
FT                   12891378..12891771,12892687..12892871,12893090..12893297,
FT                   12894715..12894860,12896839..12897046,12897898..12898079,
FT                   12900465..12900684,12901228..12901409,12902033..12903248,
FT                   12906101..12906231,12907619..12907808,12909207..12909298,
FT                   12911814..12911973,12916124..12916282,12917242..12917380,
FT                   12919565..12919846,12920392..12920532,12925874..12925928,
FT                   12931086..12931180,12933923..12934056,12935143..12935271,
FT                   12939267..12939326,12940215..12940324,12940682..12940958,
FT                   12945355..12945566))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116166"
FT                   /product="mCG116166"
FT                   /note="gene_id=mCG116166.1 transcript_id=mCT117283.1
FT                   protein_id=mCP51876.1"
FT                   /protein_id="EDL00825.1"
FT                   /translation="MFRRARLSVKPNVRPGVGTRGSAAPNPQRGPEAPRPPEPATESAP
FT                   KPAEPTDVPAVDSGGAEPQEQAPGSSDEKTGDKNNAAESSTLSSASSQRRKRVSSTSSL
FT                   VQPSGSAPSQSRPLSTVDHDAPQPNPTPAKEKQPCSDRYRIYKARKLREMLKEELRKEK
FT                   KQWKNKFSTNESQRPPDRSKMTMRDFIYYLPDNNPMTSSVEQEKKPEKSLAPTPTREQE
FT                   NQSTQDANDNEDVEEEVDDGPLLVPRVKVAEDGSIILDEESLTVEVLRTKGPCVVEEND
FT                   PIFERGSTTTYSSFRKNYYSKPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKN
FT                   KFKREEKTNGWRIDKAFQEKRPFDFDFFAHLLQKVLAEEEKRKQKSTKCQSLKEKASKP
FT                   RKNLKAKTVTSEEVNDDPDESVNSNISDPERSQNDAETVNEEESPSSSGQHLEQAMLEQ
FT                   DQNQEKKRRRNQGEANKQEATNLLERVLVHSSPPAAEIHKNTCPSEENESECNKEQIPS
FT                   LTQNIDDIAGLAPSEETEMRMDPIPSTCNQQDIMPLARESSESCAVALPVWEPGNTASA
FT                   DMAHAESSCSEGRGADLKTAAPETEQTENVKPKSRSRLQRPKPNLARAVGKKSAVSQDR
FT                   QDERNKNSPSETAAEKNHMEKETVNESETSVAKNTDGESPGAKTVSDLSEKSCVQQDSQ
FT                   AKVLRPTRLMRSRMQRPKPNVVKAAERKEILTSQEKFGAHVEKSEDESCVVIPPQTENE
FT                   SHKNLQCEDTVSEPGRKDPFENIQPDQPQVLSDCPSIHEGNKENKRKQVPVLRTRFQKP
FT                   KPNTGRRRRRRISSKEGIPEETPISGEIPATWEEIPSLDTSLREEVLSVPLAPLTATAS
FT                   TKDSESDVKDSGRNDTASNAEMSEMTDVTMEMETGLETIGRDTCPGEMGAEMIDIPMET
FT                   EAGLKASLNETSCMEKVPELIDTTGEICTNLGETGRKEVFLQENGPKEVGPVSEPETGL
FT                   QETGKDLAMKESTPDTTDSTEEREAYSEETERQEKISALIKDAEEAKARGEMETPLEEI
FT                   GGGTSQRGKAAGAPVEQSASEEEPQGSACREEVAVESSTAEGKELNLRETGEDDVSSMV
FT                   VVLGEKTDIEETNGDPKETERESSVSWERGSGEIQVGEEMVEDLGKPEKIDVAPREREP
FT                   EEHSSGQPEADVILSSSDGSTGSPQDKVNISSKISVMPTLVEEKETTDKDISSHLGHVE
FT                   SCSQNLGRHETDQGMPLPDALERFSDTNLSKPLPQEQQPLQVKPAPFLRSRFKKPKPNL
FT                   SRAALKRATIEAEHCVPGKKSEACKVEAAMLQQDSDQAALSPQHNVPSLMASRENDKSG
FT                   HEEEEEAAILPCTQTEKDASPPNSSEPKEGSQLTPNQENGLLVPIGTPMMNTVTQETRQ
FT                   NVVQTTLPVRGRLQRPRPNVQKARQRQIVEKGEARDIAKNEGPELQKDETRTCLTVANS
FT                   SHIESGVAVDMSSRVSECQVSESQGHADPVENLSVNKASVVHEQMRHENKPYVPSPALL
FT                   IRRRFQKAKPNLGGARRKDEQPGVEKGRTDESTALTAEDHLLQKEDCDTQLSLQAREKA
FT                   DMPLEVSVRKECIHSEESGSDRNDAQPNAGPSEGSRDETAKEQPTSLGLEEQSLSKQIR
FT                   SSCPQLWKESSYPKTVSSRRTPLSSASECEIEHSWKRTQRKTKPNLTKGRGSKRIRGKT
FT                   AKKEPRASKSVLVTLRASQKEDEDDAEDFDSDYEEETYHLAPEELSKAPVFVPVGLRSP
FT                   EPVSAQIEETMEELEITMDVADMTVVEHQLSHMDTTAQAVQAEKAVYPPSFEMDVGEQT
FT                   QEEPGPSDGSTEAAITLLTMGDIVLQSEIIPGQGDVGVCVFPDVHSEDKSHAPFSPDNV
FT                   NQKVVHDYPEVCSPVISTSHASFEENRIVSKEQSNRDAAVEEEAVEETLPTRNTTSTMS
FT                   THLRMESMVVTPELNSEKTLEISESHGHQEVASFCITKETEVEIQRETEGDDSKAVELE
FT                   DKSHAPVTAAETKEEEQSQCVGDVEGASVSQEAILPARIEDHEETLQEVQESGTAVASS
FT                   EIGQQTLDSGQSFGESAAKEALKETPKGSDVPVLHGPESVPSHIPEAQQENTGPQAVTV
FT                   NPFADGQQDGEDEQAFILTLVEIPTHATEGFTDAAMQLMPSSLLPAPILVRSGNAAERG
FT                   DLSGSLQTSLVVQDAPSLSPSRSGSSEKPPANLDLTSRKRFCCSPDESIHVPPAKKSSL
FT                   VPGIDYQECTSEVCSEELNVFEKTAESCMGQGIFPTSESTHATSKPQKEHSEPTDTGSS
FT                   GSLDEIKDACVENMAQLPQSEIVSDKEEKTEPASNSEQRDIVTSSSKPPLTRPGRRPLG
FT                   FLSLLCPKNSLESDEVTQTHSKKRLKPQIPVSRRNLRKPNLHNTSQKKNQDSSAPPPSP
FT                   SVTAPLSGTAGSPESSAAQVSSDQPLLKEECKNGPKGAPEEEVTPVSEFVFSDIFIEVD
FT                   ETL"
FT   assembly_gap    12881680..12881699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12886929..12887201
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   gene            complement(12948501..12950044)
FT                   /locus_tag="mCG_146984"
FT                   /note="gene_id=mCG146984.0"
FT   mRNA            complement(12948501..12950044)
FT                   /locus_tag="mCG_146984"
FT                   /product="mCG146984"
FT                   /note="gene_id=mCG146984.0 transcript_id=mCT187247.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(12948860..12949090)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146984"
FT                   /product="mCG146984"
FT                   /note="gene_id=mCG146984.0 transcript_id=mCT187247.0
FT                   protein_id=mCP108198.0"
FT                   /protein_id="EDL00824.1"
FT                   /translation="MYKSWGHRQMHLALKTGRTHRNKHLSMTNWLFWVFCCSISNREFS
FT                   SYLCEECDEDVDCDFIESVSCFGRKVFFSKY"
FT   gene            12949753..12956281
FT                   /gene="Serf1"
FT                   /locus_tag="mCG_116158"
FT                   /note="gene_id=mCG116158.1"
FT   mRNA            join(12949753..12949934,12950728..12950836,
FT                   12955675..12955941)
FT                   /gene="Serf1"
FT                   /locus_tag="mCG_116158"
FT                   /product="small EDRK-rich factor 1, transcript variant
FT                   mCT117275"
FT                   /note="gene_id=mCG116158.1 transcript_id=mCT117275.0
FT                   created on 08-NOV-2002"
FT   mRNA            join(12949789..12949934,12950728..12950836,
FT                   12952458..12952726)
FT                   /gene="Serf1"
FT                   /locus_tag="mCG_116158"
FT                   /product="small EDRK-rich factor 1, transcript variant
FT                   mCT175480"
FT                   /note="gene_id=mCG116158.1 transcript_id=mCT175480.0
FT                   created on 08-NOV-2002"
FT   mRNA            join(12949860..12949934,12950728..12950836,
FT                   12955675..12955783,12956032..12956281)
FT                   /gene="Serf1"
FT                   /locus_tag="mCG_116158"
FT                   /product="small EDRK-rich factor 1, transcript variant
FT                   mCT175479"
FT                   /note="gene_id=mCG116158.1 transcript_id=mCT175479.0
FT                   created on 08-NOV-2002"
FT   CDS             join(12949928..12949934,12950728..12950836,
FT                   12955675..12955747)
FT                   /codon_start=1
FT                   /gene="Serf1"
FT                   /locus_tag="mCG_116158"
FT                   /product="small EDRK-rich factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG116158.1 transcript_id=mCT117275.0
FT                   protein_id=mCP51709.1 isoform=CRA_a"
FT                   /protein_id="EDL00820.1"
FT                   /translation="MARGNQREIARQKNMKKTQEISKGKRKEDSLTASQRKQRDSEIMQ
FT                   QKQKIANEKKSMQTTEK"
FT   CDS             join(12949928..12949934,12950728..12950836,
FT                   12955675..12955747)
FT                   /codon_start=1
FT                   /gene="Serf1"
FT                   /locus_tag="mCG_116158"
FT                   /product="small EDRK-rich factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG116158.1 transcript_id=mCT175479.0
FT                   protein_id=mCP98398.0 isoform=CRA_a"
FT                   /protein_id="EDL00822.1"
FT                   /translation="MARGNQREIARQKNMKKTQEISKGKRKEDSLTASQRKQRDSEIMQ
FT                   QKQKIANEKKSMQTTEK"
FT   CDS             join(12949928..12949934,12950728..12950836,
FT                   12952458..12952461)
FT                   /codon_start=1
FT                   /gene="Serf1"
FT                   /locus_tag="mCG_116158"
FT                   /product="small EDRK-rich factor 1, isoform CRA_c"
FT                   /note="gene_id=mCG116158.1 transcript_id=mCT175480.0
FT                   protein_id=mCP98399.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="MGI:MGI:1337114"
FT                   /db_xref="UniProtKB/TrEMBL:B2KF71"
FT                   /protein_id="EDL00823.1"
FT                   /translation="MARGNQREIARQKNMKKTQEISKGKRKEDSLTASQRKQR"
FT   mRNA            join(<12950046..12950232,12950728..12950836,
FT                   12955675..12955941)
FT                   /gene="Serf1"
FT                   /locus_tag="mCG_116158"
FT                   /product="small EDRK-rich factor 1, transcript variant
FT                   mCT175481"
FT                   /note="gene_id=mCG116158.1 transcript_id=mCT175481.0
FT                   created on 08-NOV-2002"
FT   CDS             join(<12950178..12950232,12950728..12950836,
FT                   12955675..12955747)
FT                   /codon_start=1
FT                   /gene="Serf1"
FT                   /locus_tag="mCG_116158"
FT                   /product="small EDRK-rich factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG116158.1 transcript_id=mCT175481.0
FT                   protein_id=mCP98400.0 isoform=CRA_b"
FT                   /protein_id="EDL00821.1"
FT                   /translation="RAPEVWKPRVPSSSFVLEGGNQREIARQKNMKKTQEISKGKRKED
FT                   SLTASQRKQRDSEIMQQKQKIANEKKSMQTTEK"
FT   assembly_gap    12959564..12960045
FT                   /estimated_length=482
FT                   /gap_type="unknown"
FT   assembly_gap    12960972..12962833
FT                   /estimated_length=1862
FT                   /gap_type="unknown"
FT   assembly_gap    12963660..12964801
FT                   /estimated_length=1142
FT                   /gap_type="unknown"
FT   gene            12966634..12979451
FT                   /gene="Smn1"
FT                   /locus_tag="mCG_116165"
FT                   /note="gene_id=mCG116165.1"
FT   mRNA            join(12966634..12966728,12968350..12968421,
FT                   12968633..12968752,12969568..12969768,12969978..12970124,
FT                   12972842..12972937,12974118..12974228,12975017..12975124,
FT                   12977451..12977501,12979142..12979451)
FT                   /gene="Smn1"
FT                   /locus_tag="mCG_116165"
FT                   /product="survival motor neuron 1, transcript variant
FT                   mCT175484"
FT                   /note="gene_id=mCG116165.1 transcript_id=mCT175484.0
FT                   created on 08-NOV-2002"
FT   mRNA            join(<12966657..12966728,12968350..12968421,
FT                   12968633..12968752,12969568..12969768,12969978..12970124,
FT                   12972842..12972937,12974118..12974228,12977451..12977501,
FT                   12979142..12979451)
FT                   /gene="Smn1"
FT                   /locus_tag="mCG_116165"
FT                   /product="survival motor neuron 1, transcript variant
FT                   mCT117282"
FT                   /note="gene_id=mCG116165.1 transcript_id=mCT117282.1
FT                   created on 08-NOV-2002"
FT   CDS             join(12966657..12966728,12968350..12968421,
FT                   12968633..12968752,12969568..12969768,12969978..12970124,
FT                   12972842..12972937,12974118..12974228,12977451..12977498)
FT                   /codon_start=1
FT                   /gene="Smn1"
FT                   /locus_tag="mCG_116165"
FT                   /product="survival motor neuron 1, isoform CRA_a"
FT                   /note="gene_id=mCG116165.1 transcript_id=mCT117282.1
FT                   protein_id=mCP51867.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q549F9"
FT                   /db_xref="InterPro:IPR002999"
FT                   /db_xref="InterPro:IPR010304"
FT                   /db_xref="MGI:MGI:109257"
FT                   /db_xref="UniProtKB/TrEMBL:Q549F9"
FT                   /protein_id="EDL00818.1"
FT                   /translation="MAMGSGGAGSEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVA
FT                   SFKHALKNGDICETPDKPKGTARRKPAKKNKSQKKNATTPLKQWKVGDKCSAVWSEDGC
FT                   IYPATITSIDFKRETCVVVYTGYGNREEQNLSDLLSPTCEVANSTEQNTQENESQVSTD
FT                   DSEHSSRSLRSKAHSKSKAAPWTSFLPPPPPMPGSGLGPGKPGLKFNGPPPPPPLPPPP
FT                   FLPCWMPPFPSGPPIIPPPPPISPDCLDDTDALGSMLISWYMSGYHTGYYMGFRQNKKE
FT                   GKCSHTN"
FT   CDS             join(12966657..12966728,12968350..12968421,
FT                   12968633..12968752,12969568..12969768,12969978..12970124,
FT                   12972842..12972937,12974118..12974228,12975017..12975079)
FT                   /codon_start=1
FT                   /gene="Smn1"
FT                   /locus_tag="mCG_116165"
FT                   /product="survival motor neuron 1, isoform CRA_b"
FT                   /note="gene_id=mCG116165.1 transcript_id=mCT175484.0
FT                   protein_id=mCP98403.0 isoform=CRA_b"
FT                   /protein_id="EDL00819.1"
FT                   /translation="MAMGSGGAGSEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVA
FT                   SFKHALKNGDICETPDKPKGTARRKPAKKNKSQKKNATTPLKQWKVGDKCSAVWSEDGC
FT                   IYPATITSIDFKRETCVVVYTGYGNREEQNLSDLLSPTCEVANSTEQNTQENESQVSTD
FT                   DSEHSSRSLRSKAHSKSKAAPWTSFLPPPPPMPGSGLGPGKPGLKFNGPPPPPPLPPPP
FT                   FLPCWMPPFPSGPPIIPPPPPISPDCLDDTDALGSMLISWYMSGYHTGYYMVSQVLEIA
FT                   PWGLGILGKPHH"
FT   gene            complement(12985824..>13043785)
FT                   /locus_tag="mCG_116161"
FT                   /note="gene_id=mCG116161.1"
FT   mRNA            complement(join(12985824..12986484,12990473..12990637,
FT                   12993835..12993921,12994259..12994411,12996616..12996783,
FT                   13001871..13004114,13004591..13004648,13008218..13008299,
FT                   13020006..13020105,13021108..13021227,13024641..13024692,
FT                   13025493..13025574,13029129..13029228,13030567..13031138,
FT                   13038781..13038822,13043720..>13043785))
FT                   /locus_tag="mCG_116161"
FT                   /product="mCG116161, transcript variant mCT189350"
FT                   /note="gene_id=mCG116161.1 transcript_id=mCT189350.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(12985824..12986484,12990473..12990637,
FT                   12993835..12993921,12994259..12994411,12996616..12996783,
FT                   13001871..13004114,13004591..13004648,13008218..13008299,
FT                   13020006..13020105,13021108..13021227,13024641..13024692,
FT                   13025493..13025574,13029129..13029228,13030567..13031138,
FT                   13038781..13038822,13043649..13043785))
FT                   /locus_tag="mCG_116161"
FT                   /product="mCG116161, transcript variant mCT117278"
FT                   /note="gene_id=mCG116161.1 transcript_id=mCT117278.0
FT                   created on 05-NOV-2002"
FT   CDS             complement(join(12986120..12986484,12990473..12990637,
FT                   12993835..12993921,12994259..12994411,12996616..12996783,
FT                   13001871..13004114,13004591..13004648,13008218..13008299,
FT                   13020006..13020105,13021108..13021227,13024641..13024692,
FT                   13025493..13025574,13029129..13029228,13030567..13031138,
FT                   13038781..>13038782))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116161"
FT                   /product="mCG116161, isoform CRA_b"
FT                   /note="gene_id=mCG116161.1 transcript_id=mCT189350.0
FT                   protein_id=mCP110348.0 isoform=CRA_b"
FT                   /protein_id="EDL00817.1"
FT                   /translation="RKMAAQGEAVEEIICEFDDDLVSELSTLLRVDALSVLKRQQEEDH
FT                   KTRMKMKKGFNSQMRSEAKRLKTFETYDKFRSWTPQEMAAAGFYHTGVKLGVQCFCCSL
FT                   ILFSTRLRKLPIENHKKLRPECEFLLGKDVGNIGKYDIRVKSPEKMLRGDKARYHEEEA
FT                   RLESFEDWPFYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGCLGNWEEGDDPWKEHAKW
FT                   FPKCEFLQSKKSPEEITQYVQSYEGFLHVTGEHFVNSWVRRELPMVSAYCNDSVFANEE
FT                   LRMDTFKDWPHESPGAVEALVKAGLFYTGKRDIVQCFSCGGCMEKWAEGDNPIEDHTKF
FT                   FPNCVFLQTLKSSAEVIPALQSHCALPEAMETTSESNHGDAAAVHSTVVDVSPSEAQEL
FT                   EPASSFVSVLCRDQDHSEAQGRGCASSGTYLPSTDLGQSEAQWLQEARSLSEQLRDTYT
FT                   KATFRHMNLPEVYSSLGTDHLISCDVSIISKHISQPVQGSLTIPEVFSNLNSVMCVEGE
FT                   AGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPGQELAKIICAQLLGAGGCI
FT                   SEVCLSSIIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTCLLIAVHTNKVRGI
FT                   RPYLDTSLEIKEFPFYNTVSVLRKLFSHDIMRVRKFINYFGFHEELQGIHKTPLFVAAV
FT                   CTDWFKNPSDQPFQDVALFKAYMQYLSLKHKGAAKPLQATVSSCGQLALTGLFSSCFEF
FT                   NSDNLAEAGVDEDEELTTCLMSKFTAQRLRPVYRFLGPLFQEFLAAVRLTELLSSDRQE
FT                   DQDLGLYYLRQINSPLKAMSIYHTFLKYVSSHPSSKAAPTVVSHLLQLVDENESLENMS
FT                   ENEDYMKLHPEALLWIECLRGLWQLSPESFSLFISENLLRICLNFAHESNTVAACSPVI
FT                   LQFLRGRTLDLKVLSLQYFWDHPETLLLLKSIKISLNGNNWVQRIDFSLIEKSFEKVQP
FT                   PTIDQDYAIAFQPINEVQKNLSEKKHIIKKYEDMKHQIPLNISTGYWKLSPKPYKIPKL
FT                   EVQVTNTGPADQALLQVLMEVFSASQSIEFRLSDSSGFLESICPALELSKASVTKCSMS
FT                   RLELSREDQKLLLTLPTLQSLEVSETNQLPEQLFHNLHKFLGLKELCVRLDGKPDVLSV
FT                   LPREFPNLHHMEKLSIRTSTESDLSKLVKLIQNSPNLHVFHLKCNFLSNCEPLMTVLAS
FT                   CKKLREIEFSGRCFEAMTFVNILPNFVFLKILNLRDQQFPDKETSEKFAQALGSLRNLE
FT                   KLFVPTGDGIHQVAKLIVRQCLQLPCLRVLVFAETLDDDSVLEIAKGATRGGFQKLENL
FT                   DLTLNHKITEEGYRNFFQVLDNLPNLKNLDISRHIPECIQIQAITVKALGQCVSRLPSL
FT                   TRLGMLSWLLDEEDIKVINDVKERHPQSKRLTVHWRWVVPFSPVIQK"
FT   CDS             complement(join(12986120..12986484,12990473..12990637,
FT                   12993835..12993921,12994259..12994411,12996616..12996783,
FT                   13001871..13004114,13004591..13004648,13008218..13008299,
FT                   13020006..13020105,13021108..13021227,13024641..13024692,
FT                   13025493..13025574,13029129..13029228,13030567..13031134))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116161"
FT                   /product="mCG116161, isoform CRA_a"
FT                   /note="gene_id=mCG116161.1 transcript_id=mCT117278.0
FT                   protein_id=mCP51728.1 isoform=CRA_a"
FT                   /protein_id="EDL00816.1"
FT                   /translation="MAAQGEAVEEIICEFDDDLVSELSTLLRVDALSVLKRQQEEDHKT
FT                   RMKMKKGFNSQMRSEAKRLKTFETYDKFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLIL
FT                   FSTRLRKLPIENHKKLRPECEFLLGKDVGNIGKYDIRVKSPEKMLRGDKARYHEEEARL
FT                   ESFEDWPFYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGCLGNWEEGDDPWKEHAKWFP
FT                   KCEFLQSKKSPEEITQYVQSYEGFLHVTGEHFVNSWVRRELPMVSAYCNDSVFANEELR
FT                   MDTFKDWPHESPGAVEALVKAGLFYTGKRDIVQCFSCGGCMEKWAEGDNPIEDHTKFFP
FT                   NCVFLQTLKSSAEVIPALQSHCALPEAMETTSESNHGDAAAVHSTVVDVSPSEAQELEP
FT                   ASSFVSVLCRDQDHSEAQGRGCASSGTYLPSTDLGQSEAQWLQEARSLSEQLRDTYTKA
FT                   TFRHMNLPEVYSSLGTDHLISCDVSIISKHISQPVQGSLTIPEVFSNLNSVMCVEGEAG
FT                   SGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPGQELAKIICAQLLGAGGCISE
FT                   VCLSSIIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTCLLIAVHTNKVRGIRP
FT                   YLDTSLEIKEFPFYNTVSVLRKLFSHDIMRVRKFINYFGFHEELQGIHKTPLFVAAVCT
FT                   DWFKNPSDQPFQDVALFKAYMQYLSLKHKGAAKPLQATVSSCGQLALTGLFSSCFEFNS
FT                   DNLAEAGVDEDEELTTCLMSKFTAQRLRPVYRFLGPLFQEFLAAVRLTELLSSDRQEDQ
FT                   DLGLYYLRQINSPLKAMSIYHTFLKYVSSHPSSKAAPTVVSHLLQLVDENESLENMSEN
FT                   EDYMKLHPEALLWIECLRGLWQLSPESFSLFISENLLRICLNFAHESNTVAACSPVILQ
FT                   FLRGRTLDLKVLSLQYFWDHPETLLLLKSIKISLNGNNWVQRIDFSLIEKSFEKVQPPT
FT                   IDQDYAIAFQPINEVQKNLSEKKHIIKKYEDMKHQIPLNISTGYWKLSPKPYKIPKLEV
FT                   QVTNTGPADQALLQVLMEVFSASQSIEFRLSDSSGFLESICPALELSKASVTKCSMSRL
FT                   ELSREDQKLLLTLPTLQSLEVSETNQLPEQLFHNLHKFLGLKELCVRLDGKPDVLSVLP
FT                   REFPNLHHMEKLSIRTSTESDLSKLVKLIQNSPNLHVFHLKCNFLSNCEPLMTVLASCK
FT                   KLREIEFSGRCFEAMTFVNILPNFVFLKILNLRDQQFPDKETSEKFAQALGSLRNLEKL
FT                   FVPTGDGIHQVAKLIVRQCLQLPCLRVLVFAETLDDDSVLEIAKGATRGGFQKLENLDL
FT                   TLNHKITEEGYRNFFQVLDNLPNLKNLDISRHIPECIQIQAITVKALGQCVSRLPSLTR
FT                   LGMLSWLLDEEDIKVINDVKERHPQSKRLTVHWRWVVPFSPVIQK"
FT   assembly_gap    13048955..13048974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13050294..13050313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13055671..>13087738)
FT                   /locus_tag="mCG_116159"
FT                   /note="gene_id=mCG116159.1"
FT   mRNA            complement(join(13055671..13056893,13058575..13058739,
FT                   13061016..13061102,13061407..13061559,13071571..13071628,
FT                   13072478..13072559,13073580..13073679,13074662..13074781,
FT                   13077340..13077391,13085335..13085416,13087638..>13087738))
FT                   /locus_tag="mCG_116159"
FT                   /product="mCG116159, transcript variant mCT175482"
FT                   /note="gene_id=mCG116159.1 transcript_id=mCT175482.0
FT                   created on 05-NOV-2002"
FT   mRNA            complement(join(13055671..13056893,13058575..13058739,
FT                   13061016..13061102,13061407..13061559,13063644..13063811,
FT                   13065424..13067535,13071571..13071628,13072478..13072559,
FT                   13073580..13073679,13074662..13074781,13077340..13077391,
FT                   13085335..13085416,13087638..>13087738))
FT                   /locus_tag="mCG_116159"
FT                   /product="mCG116159, transcript variant mCT117276"
FT                   /note="gene_id=mCG116159.1 transcript_id=mCT117276.1
FT                   created on 05-NOV-2002"
FT   CDS             complement(join(13056529..13056893,13058575..13058739,
FT                   13061016..13061102,13061407..13061559,13071571..13071628,
FT                   13072478..13072559,13073580..13073679,13074662..13074781,
FT                   13077340..13077391,13085335..13085416,13087638..>13087738))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116159"
FT                   /product="mCG116159, isoform CRA_b"
FT                   /note="gene_id=mCG116159.1 transcript_id=mCT175482.0
FT                   protein_id=mCP98401.0 isoform=CRA_b"
FT                   /protein_id="EDL00815.1"
FT                   /translation="GKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFPKCEFLQSKKSSK
FT                   EIAQYIQSYEGFVHVTGEHFVKSWVRRELPMVSAYCNDSVFANEELRMDMFKDWPQESP
FT                   VGVEALVRAGFFYTGKKDIVRCFSCGGCLEKWAEGDDPMEDHIKFFPECVFLQTLKSSA
FT                   EVIPTLQSQYALPEATETTRESNHGDAAAVHSTVVVKFIQNFPNLHVFHLKCDFLSNCE
FT                   SLMAVLASCKKLREIEFSGRCFEAMTFVNILPNFVSLKILNLKDQQFPDKETSEKFAQA
FT                   LGSLRNLEELLIPTGDGIHQVAKLIVRQCLQLPCLRVLTFHDILDNDSVIEIARAATSG
FT                   GFQKLENLDISMNHKITEEGYRNFFQALDNLPNLQELNICRNIPGRIQVQATTVKALGQ
FT                   CVSRLPSLIRLHMLSWLLDEEDMKVINDVKERHPQSKRLIIFWKLIVPFSPVILE"
FT   CDS             complement(join(13056529..13056893,13058575..13058739,
FT                   13061016..13061102,13061407..13061559,13063644..13063811,
FT                   13065424..13067535,13071571..13071628,13072478..13072559,
FT                   13073580..13073679,13074662..13074781,13077340..13077391,
FT                   13085335..13085416,13087638..>13087738))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116159"
FT                   /product="mCG116159, isoform CRA_a"
FT                   /note="gene_id=mCG116159.1 transcript_id=mCT117276.1
FT                   protein_id=mCP51710.1 isoform=CRA_a"
FT                   /protein_id="EDL00814.1"
FT                   /translation="GKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFPKCEFLQSKKSSK
FT                   EIAQYIQSYEGFVHVTGEHFVKSWVRRELPMVSAYCNDSVFANEELRMDMFKDWPQESP
FT                   VGVEALVRAGFFYTGKKDIVRCFSCGGCLEKWAEGDDPMEDHIKFFPECVFLQTLKSSA
FT                   EVIPTLQSQYALPEATETTRESNHGDAAAVHSTVVDLGRSEAQWFQEARSLSEQLRDNY
FT                   TKATFRHMNLPEVCSSLGTDHLLSCDVSIISKHISQPVQEALTIPEVFSNLNSVMCVEG
FT                   EAGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLDNIICTQLLGAGGC
FT                   ISEACLSSIIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTCLLIAVHTNRVRD
FT                   IRLYLGTSLEIQEFPFYNTVSVLRKFFSHDIICVEKLIIYFIDNKDLQGVYKTPLFVAA
FT                   VCTDWIQNASAQDKFQDVTLFQSYMQYLSLKYKATAEPLQATVSSCGQLALTGLFSSCF
FT                   EFNSDDLAEAGVDEDEKLTTLLMSKFTAQRLRPVYRFLGPLFQEFLAAVRLTELLSSDR
FT                   QEDQDLGLYYLRQIDSPLKAINSFNIFLYYVSSHSSSKAAPTVVSHLLQLVDEKESLEN
FT                   MSENEDYMKLHPQTFLWFQFVRGLWLVSPESSSSFVSEHLLRLALIFAYESNTVAECSP
FT                   FILQFLRGKTLALRVLNLQYFRDHPESLLLLRSLKVSINGNKMSSYVDYSFKTYFENLQ
FT                   PPAIDEEYTSAFEHISEWRRNFAQDEEIIKNYENIRPRALPDISEGYWKLSPKPCKIPK
FT                   LEVQVNNTDAADQALLQVLMEVFSASQSIEFRLFNSSGFLESICPALELSKASVTKCSM
FT                   SRLELSRAEQELLLTLPALQSLEVSETNQLPDQLFHNLHKFLGLKELCVRLDGKPNVLS
FT                   VLPGEFPNLLHMEKLSIQTSTESDLSKLVKFIQNFPNLHVFHLKCDFLSNCESLMAVLA
FT                   SCKKLREIEFSGRCFEAMTFVNILPNFVSLKILNLKDQQFPDKETSEKFAQALGSLRNL
FT                   EELLIPTGDGIHQVAKLIVRQCLQLPCLRVLTFHDILDNDSVIEIARAATSGGFQKLEN
FT                   LDISMNHKITEEGYRNFFQALDNLPNLQELNICRNIPGRIQVQATTVKALGQCVSRLPS
FT                   LIRLHMLSWLLDEEDMKVINDVKERHPQSKRLIIFWKLIVPFSPVILE"
FT   assembly_gap    13079387..13083392
FT                   /estimated_length=4006
FT                   /gap_type="unknown"
FT   assembly_gap    13087936..13096041
FT                   /estimated_length=8106
FT                   /gap_type="unknown"
FT   gene            complement(13098633..13131179)
FT                   /locus_tag="mCG_141456"
FT                   /note="gene_id=mCG141456.0"
FT   mRNA            complement(join(13098633..13101425,13103207..13103371,
FT                   13105637..13105723,13108234..13108386,13110386..13110553,
FT                   13112240..13114351,13114835..13114892,13115684..13115765,
FT                   13116736..13116835,13117848..13117967,13120527..13120578,
FT                   13121705..13121786,13128939..13129038,13129488..13130179,
FT                   13131116..13131179))
FT                   /locus_tag="mCG_141456"
FT                   /product="mCG141456"
FT                   /note="gene_id=mCG141456.0 transcript_id=mCT175474.0
FT                   created on 05-NOV-2002"
FT   CDS             complement(join(13101061..13101425,13103207..13103371,
FT                   13105637..13105723,13108234..13108386,13110386..13110553,
FT                   13112240..13114351,13114835..13114892,13115684..13115765,
FT                   13116736..13116835,13117848..13117967,13120527..13120578,
FT                   13121705..13121786,13128939..13129038,13129488..13130055))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141456"
FT                   /product="mCG141456"
FT                   /note="gene_id=mCG141456.0 transcript_id=mCT175474.0
FT                   protein_id=mCP98393.0"
FT                   /protein_id="EDL00813.1"
FT                   /translation="MAEHGESSEDRISEIDYEFLAELSARFGMNLVQLAKSQEEEDHKE
FT                   RMKMKKGFNSQMRSEAKRLKTFESYDTFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLIL
FT                   FGNSLRKLPIERHKKLRPECEFLQGKDVGNIGKYDIRVKSPEKMLRGGKARYHEEEARL
FT                   ESFEDWPFYAHGTSPRALSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFP
FT                   KCEFLQSKKSSEEIAQYIQDYEGFVHVTGEHFVKSWVRRELPMVSAYCNDSVFTNEELR
FT                   MDMFKDWPQESPVGFEALVRAGFFYTGKKDIVRCFSCGGCLEKWAEGDDPMEDHIKFFP
FT                   ECVFLQTLKSSAEVIPTLQSQYALPEATETTRESNHDDAAAVHSTVVDLGRSEAQWFQE
FT                   ARSLSEQLRDTYTKTSFCHMNLPEVCSSLGTDHLLSCDVSIISKHISQPVQGALTIPEV
FT                   FSNLSSVMCVEGEAGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLAN
FT                   IICTQLLGAGGCISEVCLSSSIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLFRTC
FT                   LLIAVHTNRVRDIRPYLGTSLEIQEFPFYNTVFVLRKFFSHDIICVEKLIIYFSENKDL
FT                   QGVYKTPLFVAAVCNDWNQNASAQDDFQDVTLFHSYMQYLSLKYKATAESLQATVSSCG
FT                   QLALTGLFSSCFEFNSDDLAEAGVDEDVKLTTFLMSKFTAQRLRPVYRFLGPLFQEFLA
FT                   AVRLTELLSSDRQEDQDLGLYYLRQIDSPLKAINSFNIFLYYVSSHSSSKAAPTVVSHL
FT                   LQLVDEKESLENMSENEDYMKLHPQTFLWFQFVRGLWLVSPESFSSFVSEHLLRLALIF
FT                   AYESNTVAECSPFILQFLRGRTLALRVLNLEYFWDHPESLLLLRSLKVSINGNKMSSYV
FT                   DYSFKTYFENLQPPAINEEYTSAFEHVSEWRRNFAQDEEIIKNYENIWPRALPDISEGY
FT                   WNLSPKPCKIPKLEVQVNNMGPADQALLQVLMEVFSASQSIEFHLFNSSGFLESIRPAL
FT                   ELSKASVTKCSMSRLELSRAEQELLLTLPALQSLEVSETNQLPDQLFHNLHKFLGLKEL
FT                   CVRLDGKPDVLSVLPEEFLNLHHMEKLSIRTSTESDLSKLVKFIQNFPNLHVFHLKCDF
FT                   LSNCESLMTALASCKKLREIEFSGQCFEAMTFVNILPNFVSLKILSLKGQQFADKETSE
FT                   KFAQALGSLRNLEELLVPTGDGIHQVAKLIVRQCLQLPCLRVLAFHDILDDESVIEIAR
FT                   AATSGSFQKLENLDISMNHKITEEGYRNFFQALDNLPNLQMLNICRNIPGRIQVQATTV
FT                   KALGHCVSRLPSLTRLGMLSWLLDEEDMKVINDVKERHPQSKRLTIFWKWIVPFSPVVL
FT                   E"
FT   assembly_gap    13107146..13107165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13107462..13107481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13136936..13136955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13145351..13145370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13146680..13207018)
FT                   /locus_tag="mCG_141457"
FT                   /note="gene_id=mCG141457.0"
FT   mRNA            complement(join(13146680..13147037,13149020..13150037,
FT                   13150178..13150342,13154764..13154850,13154919..13154925,
FT                   13155169..13155321,13158057..13158224,13161109..13163218,
FT                   13166112..13166193,13169513..13169612,13170348..13170467,
FT                   13182147..13182198,13182950..13183031,13186079..13186178,
FT                   13186508..13187078,13190926..13190967,13206952..13207018))
FT                   /locus_tag="mCG_141457"
FT                   /product="mCG141457"
FT                   /note="gene_id=mCG141457.0 transcript_id=mCT175475.0
FT                   created on 19-FEB-2003"
FT   assembly_gap    13147161..13147180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13147789..13147808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13152933..13152952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(13161368..13163218,13166112..13166193,
FT                   13169513..13169612,13170348..13170467,13182147..13182198,
FT                   13182950..13183031,13186079..13186178,13186508..13187075))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141457"
FT                   /product="mCG141457"
FT                   /note="gene_id=mCG141457.0 transcript_id=mCT175475.0
FT                   protein_id=mCP98394.0"
FT                   /protein_id="EDL00811.1"
FT                   /translation="MAEHGESSEDRISEIDYEFLPELSALLGVDAFQVAKSQEEEEHKE
FT                   RMKMKKGFNSQMRSEAKRLKTFETYDTFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLIL
FT                   FGNSLRKLPIERHKKLRPECEFLLGKDVGNIGKYDIRVKSPEKMLRGGKARYHEEEARL
FT                   ESFEDWPFYAHGTSPRALSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFP
FT                   KCEFLQSKISSEEIAQYIQGYEGFVHVTGEHFVNSWVRRELPMVSAYCNDSVFAYEELR
FT                   MDTFKDWPHESPVAVDALVRAGLFYTGRKDIVQCFSCGGCMENWAEGDDPIQEHNKFFP
FT                   NCVFLQTLKSSAEVIPALQSHCALPEAMLGQSETQWFQEARSLSEQLRDTYTKAIFRHM
FT                   NLPEVCSSLGTDHLISCDVSIISKHVSRPVQGALTIPEVFSNLSSVMCVEGETGSGKTT
FT                   FLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLANIICAQLLGAGGCISEVCLSS
FT                   IIQQLQHQVLFLLDDYCGLASLPQALHTLITKNYLSRTCLLIAVHTNRVRDIRPYLDRS
FT                   LEIKEFPLSNTVYILKKFFSHNIKRLLEFMVYFAQNEELQGIHKTPLFVAVVCTDWFEN
FT                   PSDQRFHDVALFKSYMQYLSLKHKGAAKPLQATVSSCGQLALTGLFSSCFEFNSDDLAE
FT                   AGVDEDEELTTCLMSKFTAQRLRPVYRFLGPLFQEFLAAMRLTELLSSDRQEDQDLGLY
FT                   YLRQINSPLKALTTYNNFLKYVFSHPSSKAGPTVVSHLLHLVDETELLENTYKNEDYVN
FT                   HPPETSRIMKELKELWLLYPEYLSSFVSEHLLRIALNLAYESNTVAECSPFILQFLRGR
FT                   TLALKVLNLQYFRDHPESLLLVKSLEVSINGNEIPAVLDYSVMEKRYEALQPPTIDQDY
FT                   LSSFEKMKDWAKNVSENEEKFWSFMNNQNFNPPKISSGYWKLSPKPYKIPRLEV"
FT   assembly_gap    13163283..13163302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13182699..13182718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13193104..13194301
FT                   /estimated_length=1198
FT                   /gap_type="unknown"
FT   gene            <13197707..>13198346
FT                   /locus_tag="mCG_116167"
FT                   /note="gene_id=mCG116167.1"
FT   mRNA            <13197707..>13198346
FT                   /locus_tag="mCG_116167"
FT                   /product="mCG116167"
FT                   /note="gene_id=mCG116167.1 transcript_id=mCT117284.1
FT                   created on 05-NOV-2002"
FT   CDS             <13197960..13198346
FT                   /codon_start=1
FT                   /locus_tag="mCG_116167"
FT                   /product="mCG116167"
FT                   /note="gene_id=mCG116167.1 transcript_id=mCT117284.1
FT                   protein_id=mCP51717.1"
FT                   /protein_id="EDL00812.1"
FT                   /translation="FLFNDSRVTFTSFQSVYKITSRFPKDTAYVLLYKKQRRANGVGSD
FT                   NSASVSINGDPPLQKELMDAITKDNKLYLHEQGLNAQAWALQAASASCSFQTNGFDDND
FT                   PPGSCGPTFGGDGGGFNTVGRLIF"
FT   assembly_gap    13201028..13204695
FT                   /estimated_length=3668
FT                   /gap_type="unknown"
FT   gene            complement(13211235..13256307)
FT                   /locus_tag="mCG_116160"
FT                   /note="gene_id=mCG116160.1"
FT   mRNA            complement(join(13211235..13212640,13214349..13214513,
FT                   13217129..13217215,13217504..13217656,13226536..13226703,
FT                   13228871..13230982,13231446..13231503,13232658..13232739,
FT                   13235895..13235994,13236688..13236807,13239899..13239950,
FT                   13240776..13240857,13247079..13247178,13247630..13248200,
FT                   13249748..13249953))
FT                   /locus_tag="mCG_116160"
FT                   /product="mCG116160, transcript variant mCT117277"
FT                   /note="gene_id=mCG116160.1 transcript_id=mCT117277.0
FT                   created on 05-NOV-2002"
FT   mRNA            complement(join(13211239..13212640,13214349..13214513,
FT                   13217129..13217215,13217504..13217656,13226536..13226703,
FT                   13228871..13230982,13231446..13231503,13232658..13232739,
FT                   13235895..13235994,13236688..13236807,13239899..13239950,
FT                   13240776..13240857,13247079..13247178,13247630..13248200,
FT                   13249748..13249789,13256241..13256307))
FT                   /locus_tag="mCG_116160"
FT                   /product="mCG116160, transcript variant mCT175483"
FT                   /note="gene_id=mCG116160.1 transcript_id=mCT175483.0
FT                   created on 05-NOV-2002"
FT   CDS             complement(join(13212276..13212640,13214349..13214513,
FT                   13217129..13217215,13217504..13217656,13226536..13226703,
FT                   13228871..13230982,13231446..13231503,13232658..13232739,
FT                   13235895..13235994,13236688..13236807,13239899..13239950,
FT                   13240776..13240857,13247079..13247178,13247630..13248197))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116160"
FT                   /product="mCG116160, isoform CRA_a"
FT                   /note="gene_id=mCG116160.1 transcript_id=mCT117277.0
FT                   protein_id=mCP51716.1 isoform=CRA_a"
FT                   /protein_id="EDL00808.1"
FT                   /translation="MAEHGESSEDRISEIDYEFLPELSALLGVDAVQLAKSQEEEEHKE
FT                   RMKMKKGFNSQMRSEAKRLKTFETYDTFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLIL
FT                   FGNSLRKLPIERHKKLRPECEFLQGKDVGNIGKYDIRVKSPEKMLRGGKARYHEEEARL
FT                   ESFEDWPFYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFP
FT                   KCEFLQSKKSSEEIAQYIQGYEGFVHVTGEHFVNSWVRRELPMVSAYCNDSVFANEELR
FT                   MDTFKDWPHESPVAVDALVRAGLFYTGKKGIVQCFSCGGCMEKCTEGDDPIQEHNKFFP
FT                   NCIFLQTPKSSAEVIPALLSHCALPEAMETTSESNHDDPAAVHSTVVGLGRSEAQWFQE
FT                   ARSLSEQLRDNYTKATFRHMNLPEVCSSLGTDHLIGCDVSIISKHISQPVQGALTIPEV
FT                   FSNLSSVMCVEGETGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLAN
FT                   IICAQLLGAGGCISEVCLSSIIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTC
FT                   LLIAVHTNRVRGIRSYLDTSLEIKEFPLSNTVYILKKFFSHNIKRLLEFMVYFGQNEDL
FT                   QGIHKTPLFVAAVCTDWFENPSDQPFQDMALFKSYMQYLSLKHKGAAKPLQATVSSCGQ
FT                   LALTGLFSSCFEFNSDDLAEAGVDEDEELTTCLMSKFTAQRLRPVYRFLGPLFQEFLAA
FT                   MRLTELLSSDRQEDQDLGLYYLRQINSPLKALTTYNNFLKYVFSHPSSKAGPTVVSHLL
FT                   HLVDETELLENTYKNEDYVNHPPGTSRIMKGLKELWLLSPEYYSSFVSEHLLRIALNFA
FT                   YESNTVAECSPFILQFLRGRTLALKVLNLQYFRDHPESLLLVKSLEVSINGNKVPKVVD
FT                   YSVMEKSFETLQPPTIDQDYASAFEQMKEHEKNLSENEETIKSIKNIFPLQPPKISSGY
FT                   WKLSPKPCKIPRLEVGVTNMGPADQALLQVLMEVFSASQSIEFRLSDSSGFLESIRPAL
FT                   ELSKASVTKCSMSRLELSRAEQELLLTLPALQSLEVSETNQLPEQLFHNLHKFLGLKEL
FT                   CVRLDGKPNVLSVLPREFPNLLHMEKLSIRTSTESDLSKLVKLIQNSPNLHVFHLKCDF
FT                   LSNCDSLMAVLASCKKLREIEFSGRCFEAMPFVNILPNFISLKILNLISQQFPDKETSE
FT                   KFAQALGSLRNLEELLVPTGDGIHQVAKLIVRQCLQLPCLRVLVFHYILDNDSVIEIAR
FT                   VATSGGFQKLEKLDLSMNHKITEEGYRNFFQALDNLPNLQNLNICRHIPECIQVQATTV
FT                   KALGQCVSRLPSLTRLHMLSWLLDEEDMKVINDVKERHPQSKRLIIFWKWIVPFSPVVL
FT                   E"
FT   CDS             complement(join(13212276..13212640,13214349..13214513,
FT                   13217129..13217215,13217504..13217656,13226536..13226703,
FT                   13228871..13230982,13231446..13231503,13232658..13232739,
FT                   13235895..13235994,13236688..13236807,13239899..13239950,
FT                   13240776..13240857,13247079..13247178,13247630..13248197))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116160"
FT                   /product="mCG116160, isoform CRA_a"
FT                   /note="gene_id=mCG116160.1 transcript_id=mCT175483.0
FT                   protein_id=mCP98402.0 isoform=CRA_a"
FT                   /protein_id="EDL00809.1"
FT                   /translation="MAEHGESSEDRISEIDYEFLPELSALLGVDAVQLAKSQEEEEHKE
FT                   RMKMKKGFNSQMRSEAKRLKTFETYDTFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLIL
FT                   FGNSLRKLPIERHKKLRPECEFLQGKDVGNIGKYDIRVKSPEKMLRGGKARYHEEEARL
FT                   ESFEDWPFYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFP
FT                   KCEFLQSKKSSEEIAQYIQGYEGFVHVTGEHFVNSWVRRELPMVSAYCNDSVFANEELR
FT                   MDTFKDWPHESPVAVDALVRAGLFYTGKKGIVQCFSCGGCMEKCTEGDDPIQEHNKFFP
FT                   NCIFLQTPKSSAEVIPALLSHCALPEAMETTSESNHDDPAAVHSTVVGLGRSEAQWFQE
FT                   ARSLSEQLRDNYTKATFRHMNLPEVCSSLGTDHLIGCDVSIISKHISQPVQGALTIPEV
FT                   FSNLSSVMCVEGETGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLAN
FT                   IICAQLLGAGGCISEVCLSSIIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTC
FT                   LLIAVHTNRVRGIRSYLDTSLEIKEFPLSNTVYILKKFFSHNIKRLLEFMVYFGQNEDL
FT                   QGIHKTPLFVAAVCTDWFENPSDQPFQDMALFKSYMQYLSLKHKGAAKPLQATVSSCGQ
FT                   LALTGLFSSCFEFNSDDLAEAGVDEDEELTTCLMSKFTAQRLRPVYRFLGPLFQEFLAA
FT                   MRLTELLSSDRQEDQDLGLYYLRQINSPLKALTTYNNFLKYVFSHPSSKAGPTVVSHLL
FT                   HLVDETELLENTYKNEDYVNHPPGTSRIMKGLKELWLLSPEYYSSFVSEHLLRIALNFA
FT                   YESNTVAECSPFILQFLRGRTLALKVLNLQYFRDHPESLLLVKSLEVSINGNKVPKVVD
FT                   YSVMEKSFETLQPPTIDQDYASAFEQMKEHEKNLSENEETIKSIKNIFPLQPPKISSGY
FT                   WKLSPKPCKIPRLEVGVTNMGPADQALLQVLMEVFSASQSIEFRLSDSSGFLESIRPAL
FT                   ELSKASVTKCSMSRLELSRAEQELLLTLPALQSLEVSETNQLPEQLFHNLHKFLGLKEL
FT                   CVRLDGKPNVLSVLPREFPNLLHMEKLSIRTSTESDLSKLVKLIQNSPNLHVFHLKCDF
FT                   LSNCDSLMAVLASCKKLREIEFSGRCFEAMPFVNILPNFISLKILNLISQQFPDKETSE
FT                   KFAQALGSLRNLEELLVPTGDGIHQVAKLIVRQCLQLPCLRVLVFHYILDNDSVIEIAR
FT                   VATSGGFQKLEKLDLSMNHKITEEGYRNFFQALDNLPNLQNLNICRHIPECIQVQATTV
FT                   KALGQCVSRLPSLTRLHMLSWLLDEEDMKVINDVKERHPQSKRLIIFWKWIVPFSPVVL
FT                   E"
FT   gene            <13218877..>13219422
FT                   /locus_tag="mCG_1047083"
FT                   /note="gene_id=mCG1047083.1"
FT   mRNA            <13218877..>13219422
FT                   /locus_tag="mCG_1047083"
FT                   /product="mCG1047083"
FT                   /note="gene_id=mCG1047083.1 transcript_id=mCT164787.0
FT                   created on 05-NOV-2002"
FT   CDS             13218877..13219422
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047083"
FT                   /product="mCG1047083"
FT                   /note="gene_id=mCG1047083.1 transcript_id=mCT164787.0
FT                   protein_id=mCP51989.0"
FT                   /protein_id="EDL00810.1"
FT                   /translation="MGQEFSKQSPFVSGPKESLKTRGTRVKKKDLESEYGCGVAALKSG
FT                   AIAPGTERTGSMAPAKKGAEKKKGRSANNEVVTREYTINIHKRIHGVDFKKRAPRALKE
FT                   IRKFAMKEMGTPDVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVI
FT                   YVPVTTFKNLQTVNVDEN"
FT   gene            complement(13263711..13296047)
FT                   /gene="Gtf2h2"
FT                   /locus_tag="mCG_116162"
FT                   /note="gene_id=mCG116162.1"
FT   mRNA            complement(join(13263711..13263881,13265307..13265421,
FT                   13272383..13272494,13274348..13274387,13279943..13280045,
FT                   13280578..13280684,13282665..13282728,13283999..13284106,
FT                   13284463..13284550,13284671..13284761,13286399..13286504,
FT                   13289532..13289586,13289935..13289985,13292307..13292393,
FT                   13292594..13292630,13292940..13293017,13293527..13293615,
FT                   13295709..13295806))
FT                   /gene="Gtf2h2"
FT                   /locus_tag="mCG_116162"
FT                   /product="general transcription factor II H, polypeptide 2,
FT                   transcript variant mCT117279"
FT                   /note="gene_id=mCG116162.1 transcript_id=mCT117279.1
FT                   created on 17-MAY-2002"
FT   CDS             complement(join(13265408..13265421,13272383..13272494,
FT                   13274348..13274387,13279943..13280045,13280578..13280684,
FT                   13282665..13282728,13283999..13284106,13284463..13284550,
FT                   13284671..13284761,13286399..13286504,13289532..13289586,
FT                   13289935..13289985,13292307..13292393,13292594..13292630,
FT                   13292940..13293017,13293527..13293582))
FT                   /codon_start=1
FT                   /gene="Gtf2h2"
FT                   /locus_tag="mCG_116162"
FT                   /product="general transcription factor II H, polypeptide 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG116162.1 transcript_id=mCT117279.1
FT                   protein_id=mCP51852.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q91YN8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004595"
FT                   /db_xref="InterPro:IPR007198"
FT                   /db_xref="InterPro:IPR012170"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="MGI:MGI:1345669"
FT                   /db_xref="UniProtKB/TrEMBL:Q91YN8"
FT                   /protein_id="EDL00806.1"
FT                   /translation="MDEEPERTKRWEGGYERTWEILKEDETGSLKATIEDILFKAKRKR
FT                   VFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQI
FT                   GIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHT
FT                   SREVLIIFSSLTTCDPSNIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETGGTYHVI
FT                   LDETHYKELLAHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDNNST
FT                   EPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEISLEEY
FT                   KGERFCYGCQGELKDQHVYVCTVCQNVFCVDCDVFVHDSLHCCPGCIHKIPTPSGPSL"
FT   mRNA            complement(join(13272154..13272494,13274348..13274387,
FT                   13279943..13280045,13280578..13280684,13282665..13282728,
FT                   13283999..13284106,13284671..13284761,13289532..13289586,
FT                   13289935..13289985,13292307..13292393,13292594..13292630,
FT                   13292940..13293017,13293527..13293615,13295923..13296047))
FT                   /gene="Gtf2h2"
FT                   /locus_tag="mCG_116162"
FT                   /product="general transcription factor II H, polypeptide 2,
FT                   transcript variant mCT168946"
FT                   /note="gene_id=mCG116162.1 transcript_id=mCT168946.0
FT                   created on 17-MAY-2002"
FT   CDS             complement(join(13284082..13284106,13284671..13284761,
FT                   13289532..13289586,13289935..13289985,13292307..13292393,
FT                   13292594..13292630,13292940..13293017,13293527..13293582))
FT                   /codon_start=1
FT                   /gene="Gtf2h2"
FT                   /locus_tag="mCG_116162"
FT                   /product="general transcription factor II H, polypeptide 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG116162.1 transcript_id=mCT168946.0
FT                   protein_id=mCP91827.0 isoform=CRA_b"
FT                   /db_xref="GOA:S4R2R0"
FT                   /db_xref="InterPro:IPR007198"
FT                   /db_xref="InterPro:IPR012170"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="MGI:MGI:1345669"
FT                   /db_xref="UniProtKB/TrEMBL:S4R2R0"
FT                   /protein_id="EDL00807.1"
FT                   /translation="MDEEPERTKRWEGGYERTWEILKEDETGSLKATIEDILFKAKRKR
FT                   VFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQI
FT                   GIIVTKSKRAEKLTELSDTCLDIQVEKCSSSSAASPPVIHLIFTISSRHIPCYLR"
FT   gene            complement(13300881..13356114)
FT                   /gene="Ocln"
FT                   /locus_tag="mCG_116163"
FT                   /note="gene_id=mCG116163.2"
FT   mRNA            complement(join(13300881..13302427,13306460..13306501,
FT                   13309649..13309820,13314905..13315120,13318521..13318669,
FT                   13338402..13338563,13342701..13343373,13344508..13344624,
FT                   13355783..>13355894))
FT                   /gene="Ocln"
FT                   /locus_tag="mCG_116163"
FT                   /product="occludin, transcript variant mCT189353"
FT                   /note="gene_id=mCG116163.2 transcript_id=mCT189353.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(13301277..13302427,13306460..13306501,
FT                   13309649..13309820,13314905..13315120,13318521..13318669,
FT                   13338402..13338563,13342701..13343373,13344508..13344624,
FT                   13355960..13356114))
FT                   /gene="Ocln"
FT                   /locus_tag="mCG_116163"
FT                   /product="occludin, transcript variant mCT117280"
FT                   /note="gene_id=mCG116163.2 transcript_id=mCT117280.0
FT                   created on 17-MAY-2002"
FT   CDS             complement(join(13302326..13302427,13306460..13306501,
FT                   13309649..13309820,13314905..13315120,13318521..13318669,
FT                   13338402..13338563,13342701..13343373,13344508..>13344572))
FT                   /codon_start=1
FT                   /gene="Ocln"
FT                   /locus_tag="mCG_116163"
FT                   /product="occludin, isoform CRA_b"
FT                   /note="gene_id=mCG116163.2 transcript_id=mCT189353.0
FT                   protein_id=mCP110349.0 isoform=CRA_b"
FT                   /protein_id="EDL00805.1"
FT                   /translation="PVTSAMSVRPFESPPPYRPDEFKPNHYAPSNDMYGGEMHVRPMLS
FT                   QPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTGLFG
FT                   GSLNYPYSGFGYGGGYGGGYGGYGYGYGGYTDPRAAKGFLLAMAAFCFIASLVIFVTSV
FT                   IRSGMSRTRRYYLIVIIVSAILGIMVFIATIVYIMGVNPTAQASGSMYGSQIYMICNQF
FT                   YTPGGTGLYVDQYLYHYCVVDPQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSN
FT                   ILWDKEHIYDEQPPNVEEWVKNVSAGTQDMPPPPSDYAERVDSPMAYSSNGKVNGKRSY
FT                   PESFYKSTPLVPEVAQEIPLTLSVDDFRQPRYSSNGNLETPSKRAPTKGKAGKGKRTDP
FT                   DHYETDYTTGGESCEELEEDWVREYPPITSDQQRQLYKRNFDAGLQEYKSLQAELDDVN
FT                   KELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKRNYCKQLKSKLSHIKRM
FT                   VGDYDRRKP"
FT   CDS             complement(join(13302326..13302427,13306460..13306501,
FT                   13309649..13309820,13314905..13315120,13318521..13318669,
FT                   13338402..13338563,13342701..13343373,13344508..13344557))
FT                   /codon_start=1
FT                   /gene="Ocln"
FT                   /locus_tag="mCG_116163"
FT                   /product="occludin, isoform CRA_a"
FT                   /note="gene_id=mCG116163.2 transcript_id=mCT117280.0
FT                   protein_id=mCP51861.1 isoform=CRA_a"
FT                   /db_xref="GOA:B2RS24"
FT                   /db_xref="InterPro:IPR002958"
FT                   /db_xref="InterPro:IPR008253"
FT                   /db_xref="InterPro:IPR010844"
FT                   /db_xref="InterPro:IPR031176"
FT                   /db_xref="MGI:MGI:106183"
FT                   /db_xref="UniProtKB/TrEMBL:B2RS24"
FT                   /protein_id="EDL00804.1"
FT                   /translation="MSVRPFESPPPYRPDEFKPNHYAPSNDMYGGEMHVRPMLSQPAYS
FT                   FYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTGLFGGSLNY
FT                   PYSGFGYGGGYGGGYGGYGYGYGGYTDPRAAKGFLLAMAAFCFIASLVIFVTSVIRSGM
FT                   SRTRRYYLIVIIVSAILGIMVFIATIVYIMGVNPTAQASGSMYGSQIYMICNQFYTPGG
FT                   TGLYVDQYLYHYCVVDPQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDK
FT                   EHIYDEQPPNVEEWVKNVSAGTQDMPPPPSDYAERVDSPMAYSSNGKVNGKRSYPESFY
FT                   KSTPLVPEVAQEIPLTLSVDDFRQPRYSSNGNLETPSKRAPTKGKAGKGKRTDPDHYET
FT                   DYTTGGESCEELEEDWVREYPPITSDQQRQLYKRNFDAGLQEYKSLQAELDDVNKELSR
FT                   LDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKRNYCKQLKSKLSHIKRMVGDYD
FT                   RRKP"
FT   assembly_gap    13314244..13314316
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    13330662..13331979
FT                   /estimated_length=1318
FT                   /gap_type="unknown"
FT   assembly_gap    13348622..13348689
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    13363497..13367891
FT                   /estimated_length=4395
FT                   /gap_type="unknown"
FT   assembly_gap    13378007..13378051
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    13388242..13388354
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   gene            complement(13394160..>13415234)
FT                   /gene="Marveld2"
FT                   /locus_tag="mCG_116126"
FT                   /note="gene_id=mCG116126.1"
FT   mRNA            complement(join(13394160..13395610,13396001..13396051,
FT                   13398658..13398829,13399086..13399234,13405976..13406011,
FT                   13409617..13410768,13415110..>13415234))
FT                   /gene="Marveld2"
FT                   /locus_tag="mCG_116126"
FT                   /product="MARVEL (membrane-associating) domain containing
FT                   2"
FT                   /note="gene_id=mCG116126.1 transcript_id=mCT117243.1
FT                   created on 17-MAY-2002"
FT   CDS             complement(join(13410666..13410768,13415110..13415234))
FT                   /codon_start=1
FT                   /gene="Marveld2"
FT                   /locus_tag="mCG_116126"
FT                   /product="MARVEL (membrane-associating) domain containing
FT                   2"
FT                   /note="gene_id=mCG116126.1 transcript_id=mCT117243.1
FT                   protein_id=mCP51762.1"
FT                   /protein_id="EDL00803.1"
FT                   /translation="MPASWPQLGGQAGGALRLGHAPGARSQFRCPRQSVLFRRPRRCEN
FT                   HKCRQVTQGPGFGTGAIVRFPGTRLVQMVP"
FT   gene            complement(13415344..13449357)
FT                   /gene="Rad17"
FT                   /locus_tag="mCG_116114"
FT                   /note="gene_id=mCG116114.1"
FT   mRNA            complement(join(13415344..13416116,13417278..13417335,
FT                   13420999..13421119,13422621..13422767,13425871..13426017,
FT                   13426121..13426206,13427761..13427943,13429417..13429528,
FT                   13431244..13431313,13431558..13431683,13431813..13431865,
FT                   13432225..13432361,13435304..13435460,13441857..13441940,
FT                   13443329..13443583,13448049..13448152,13449194..13449357))
FT                   /gene="Rad17"
FT                   /locus_tag="mCG_116114"
FT                   /product="RAD17 homolog (S. pombe)"
FT                   /note="gene_id=mCG116114.1 transcript_id=mCT168936.0
FT                   created on 19-JUN-2003"
FT   gene            <13415542..13464249
FT                   /locus_tag="mCG_116122"
FT                   /note="gene_id=mCG116122.1"
FT   mRNA            join(<13415542..13415557,13452556..13452655,
FT                   13461735..13461793,13461891..13462036,13463667..13464167)
FT                   /locus_tag="mCG_116122"
FT                   /product="mCG116122, transcript variant mCT168943"
FT                   /note="gene_id=mCG116122.1 transcript_id=mCT168943.0
FT                   created on 17-MAY-2002"
FT   CDS             join(<13415543..13415557,13452556..13452655,
FT                   13461735..13461793,13461891..13462036,13463667..13463859)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116122"
FT                   /product="mCG116122, isoform CRA_b"
FT                   /note="gene_id=mCG116122.1 transcript_id=mCT168943.0
FT                   protein_id=mCP91826.0 isoform=CRA_b"
FT                   /protein_id="EDL00801.1"
FT                   /translation="SPYILLTGTPGVGKTTLGKELASRSGLKYVNVGDLAREGQLYDGY
FT                   DEEYGCPILDEDRVVDELEHQMQEGGVIVDYHGCDFFPERWFHIVFVLRTDNGVLYKRL
FT                   ETRGYNEKKLQDNIQCEIFQVLYEEAIASYKEEIVHQLPSNEPEQLEDNINQISKWIEQ
FT                   WVKDHNP"
FT   CDS             complement(join(13415828..13416116,13417278..13417335,
FT                   13420999..13421119,13422621..13422767,13425871..13426017,
FT                   13426121..13426206,13427761..13427943,13429417..13429528,
FT                   13431244..13431313,13431558..13431683,13431813..13431865,
FT                   13432225..13432361,13435304..13435460,13441857..13441940,
FT                   13443329..13443583,13448049..13448090))
FT                   /codon_start=1
FT                   /gene="Rad17"
FT                   /locus_tag="mCG_116114"
FT                   /product="RAD17 homolog (S. pombe)"
FT                   /note="gene_id=mCG116114.1 transcript_id=mCT168936.0
FT                   protein_id=mCP91828.0"
FT                   /db_xref="GOA:Q3UYY2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004582"
FT                   /db_xref="InterPro:IPR018324"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1333807"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UYY2"
FT                   /protein_id="EDL00802.1"
FT                   /translation="MSETFLRPKVSSTKVTDWVAPAFDDFEANTAITTITASSLTFSNS
FT                   SHRRKYLPSTLESNRLSARKRGRLSLEQTHGLETSRERLSDNEPWVDKYKPETQHELAV
FT                   HKKKIEEVETWLKAQVLEVKPKQGGSVLLITGPPGCGKTTTIKILSKELGIQVQEWVNP
FT                   ILPDFQKDDYKELLSLESNFSVVPYQSQIAVFNDFLLRATKYSKLQMLGDDLTTDKKII
FT                   LVEELPNQFYRDPNALHEILRKHVQIGRCPLVFIVSDSVSGDNNQRLLFPRNIQEECSV
FT                   SNISFNPVAPTIMMKFLNRIVTIEASKNGEKIIVPNKTSLELLCQGCSGDIRSAINSLQ
FT                   FSSSKGENSSWSKKKRMSLKSDAAISKSKQKKKHNSTLENQEIQAIGGKDVSLFLFRAL
FT                   GKILYCKRAPLTELDSPRLPAHLSEHDRDTLLVQPEEIVEMSHMPGDFFNLYLHQNYID
FT                   FFAEVDDLVPASEFLSFADILGGDWNTRSLLREYSTSVATRGVMHSNKARGFAHCQGGS
FT                   SFRPLHKPQWFLIQKKYRENCLAAKALFVDFCLPALCLQTQLLPYLALLTIPMRNKAQI
FT                   SFIQDVGRLPLKRSFGRLKMEALTDRELGLIDPDSGDESPHSGGQPAQEAPGEPAQAAQ
FT                   NADPETWSLPLSQNSGSDLPASQPQPFSSKVDMEEEEEEEEDIIIEDYDSEET"
FT   assembly_gap    13423710..13423862
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    13435737..13435854
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    13437680..13437699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13445433..13445577
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   mRNA            join(13449344..13449817,13452563..13452655,
FT                   13461735..13461793,13461891..13462036,13463667..13464249)
FT                   /locus_tag="mCG_116122"
FT                   /product="mCG116122, transcript variant mCT117239"
FT                   /note="gene_id=mCG116122.1 transcript_id=mCT117239.1
FT                   created on 17-MAY-2002"
FT   CDS             join(13449790..13449817,13452563..13452655,
FT                   13461735..13461793,13461891..13462036,13463667..13463859)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116122"
FT                   /product="mCG116122, isoform CRA_a"
FT                   /note="gene_id=mCG116122.1 transcript_id=mCT117239.1
FT                   protein_id=mCP51926.1 isoform=CRA_a"
FT                   /protein_id="EDL00800.1"
FT                   /translation="MKLPNILLTGTPGVGKTTLGKELASRSGLKYVNVGDLAREGQLYD
FT                   GYDEEYGCPILDEDRVVDELEHQMQEGGVIVDYHGCDFFPERWFHIVFVLRTDNGVLYK
FT                   RLETRGYNEKKLQDNIQCEIFQVLYEEAIASYKEEIVHQLPSNEPEQLEDNINQISKWI
FT                   EQWVKDHNP"
FT   assembly_gap    13453878..13455287
FT                   /estimated_length=1410
FT                   /gap_type="unknown"
FT   gene            13466767..13494320
FT                   /gene="5830436D01Rik"
FT                   /locus_tag="mCG_116125"
FT                   /note="gene_id=mCG116125.1"
FT   mRNA            join(13466767..13467691,13473906..13474013,
FT                   13475689..13476043,13477158..13477216,13479623..13479709,
FT                   13482128..13482213,13484954..13485036,13488165..13488265,
FT                   13491383..13491554,13492216..13492346,13493957..13494320)
FT                   /gene="5830436D01Rik"
FT                   /locus_tag="mCG_116125"
FT                   /product="RIKEN cDNA 5830436D01, transcript variant
FT                   mCT117242"
FT                   /note="gene_id=mCG116125.1 transcript_id=mCT117242.1
FT                   created on 05-NOV-2002"
FT   mRNA            join(13466767..13467691,13475745..13476043,
FT                   13477158..13477216,13479623..13479709,13482128..13482213,
FT                   13484954..13485036,13488165..13488265,13490141..13490248,
FT                   13491383..13491554,13493957..13494319)
FT                   /gene="5830436D01Rik"
FT                   /locus_tag="mCG_116125"
FT                   /product="RIKEN cDNA 5830436D01, transcript variant
FT                   mCT175478"
FT                   /note="gene_id=mCG116125.1 transcript_id=mCT175478.0
FT                   created on 05-NOV-2002"
FT   CDS             join(13475755..13476043,13477158..13477216,
FT                   13479623..13479709,13482128..13482213,13484954..13485036,
FT                   13488165..13488265,13491383..13491554,13492216..13492346,
FT                   13493957..13494265)
FT                   /codon_start=1
FT                   /gene="5830436D01Rik"
FT                   /locus_tag="mCG_116125"
FT                   /product="RIKEN cDNA 5830436D01, isoform CRA_a"
FT                   /note="gene_id=mCG116125.1 transcript_id=mCT117242.1
FT                   protein_id=mCP51966.1 isoform=CRA_a"
FT                   /protein_id="EDL00798.1"
FT                   /translation="MSKVPRSSSEAEDIWETEDDMTEGDLGYGLGRKPGGIYEVPCSIT
FT                   SKKRSDGKNSSPPPFPRKGEERSETSFQYSRRKGFQDTSAEGYRASRLSSTDSNSELSD
FT                   EQLRRRLHEALEDVEILKTELEASQRQLEGKEEALKILQSMEINALQWEMEFDQDRFKN
FT                   IEESWIQKCDRLNCDNAVLRENLKLRTEEIKMLKSKNAVLNQRYLEALAMLDIKEQKMG
FT                   QEESGFTDVSGLELETLQKSKEEAHITADAFRIAFEQQLMRKNEQALRLAGGDLCKRAA
FT                   TWINRQHQADDGYPAQRRKKTLGQRLLGILPSENSSKGAEDQDNMQEVFKMLVDLLNDK
FT                   EEALAHQRKVSYMLARALEDKDTASERNKEKIPMSQTFPFKTAWHDASELCGLRDPVQS
FT                   NHVSEPVACICSIQHPPKVSDCPRTLKRSCSLPSTLFYK"
FT   CDS             join(13475755..13476043,13477158..13477216,
FT                   13479623..13479709,13482128..13482213,13484954..13485036,
FT                   13488165..13488265,13490141..13490248,13491383..13491554,
FT                   13493957..13493964)
FT                   /codon_start=1
FT                   /gene="5830436D01Rik"
FT                   /locus_tag="mCG_116125"
FT                   /product="RIKEN cDNA 5830436D01, isoform CRA_b"
FT                   /note="gene_id=mCG116125.1 transcript_id=mCT175478.0
FT                   protein_id=mCP98397.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3UWA1"
FT                   /db_xref="InterPro:IPR034608"
FT                   /db_xref="MGI:MGI:1923291"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWA1"
FT                   /protein_id="EDL00799.1"
FT                   /translation="MSKVPRSSSEAEDIWETEDDMTEGDLGYGLGRKPGGIYEVPCSIT
FT                   SKKRSDGKNSSPPPFPRKGEERSETSFQYSRRKGFQDTSAEGYRASRLSSTDSNSELSD
FT                   EQLRRRLHEALEDVEILKTELEASQRQLEGKEEALKILQSMEINALQWEMEFDQDRFKN
FT                   IEESWIQKCDRLNCDNAVLRENLKLRTEEIKMLKSKNAVLNQRYLEALAMLDIKEQKMG
FT                   QEESGFTDVSGLELAVLGACLCHGPGGSPCSCAKMAASTRKLVLQLRHELETLQKSKEE
FT                   AHITADAFRIAFEQQLMRKNEQALRLAGGDLCKRAATWINRQHQADDVE"
FT   gene            complement(13500479..13528976)
FT                   /gene="Cdk7"
FT                   /locus_tag="mCG_116124"
FT                   /note="gene_id=mCG116124.1"
FT   mRNA            complement(join(13500479..13501352,13502237..13502384,
FT                   13504213..13504362,13507942..13508028,13509365..13509464,
FT                   13514369..13514487,13515440..13515550,13517097..13517165,
FT                   13518381..13518448,13520475..13520508,13528461..13528520,
FT                   13528777..13528976))
FT                   /gene="Cdk7"
FT                   /locus_tag="mCG_116124"
FT                   /product="cyclin-dependent kinase 7 (homolog of Xenopus
FT                   MO15 cdk-activating kinase), transcript variant mCT117241"
FT                   /note="gene_id=mCG116124.1 transcript_id=mCT117241.1
FT                   created on 16-MAY-2002"
FT   mRNA            complement(join(13500479..13501352,13502237..13502384,
FT                   13504213..13504362,13507942..13508028,13509365..13509464,
FT                   13514369..13514487,13517097..13517165,13518381..13518448,
FT                   13520475..13520508,13528461..13528520,13528777..>13528915))
FT                   /gene="Cdk7"
FT                   /locus_tag="mCG_116124"
FT                   /product="cyclin-dependent kinase 7 (homolog of Xenopus
FT                   MO15 cdk-activating kinase), transcript variant mCT168944"
FT                   /note="gene_id=mCG116124.1 transcript_id=mCT168944.0
FT                   created on 16-MAY-2002"
FT   CDS             complement(join(13501324..13501352,13502237..13502384,
FT                   13504213..13504362,13507942..13508028,13509365..13509464,
FT                   13514369..13514487,13517097..13517165,13518381..13518448,
FT                   13520475..13520508,13528461..13528520,13528777..>13528914))
FT                   /codon_start=1
FT                   /gene="Cdk7"
FT                   /locus_tag="mCG_116124"
FT                   /product="cyclin-dependent kinase 7 (homolog of Xenopus
FT                   MO15 cdk-activating kinase), isoform CRA_b"
FT                   /note="gene_id=mCG116124.1 transcript_id=mCT168944.0
FT                   protein_id=mCP91818.0 isoform=CRA_b"
FT                   /protein_id="EDL00797.1"
FT                   /translation="AFGRFKFLRGGGLSLGARVWFLTRMAVDVKSRAKRYEKLDFLGEG
FT                   QFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDA
FT                   FGHKSNISLVFDFMETDLEDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTR
FT                   WYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEE
FT                   QWPDMCSLPDYVTFKSFPGVPLQHIFIAAGDDLLELIQGLFLFNPCTRTTASQALKTKY
FT                   FSNRPGPTPGCQLPRPNCPVEALKEPANPTVATKRKRAEALEQGILPKKLIF"
FT   CDS             complement(join(13501324..13501352,13502237..13502384,
FT                   13504213..13504362,13507942..13508028,13509365..13509464,
FT                   13514369..13514487,13515440..13515550,13517097..13517165,
FT                   13518381..13518448,13520475..13520508,13528461..13528520,
FT                   13528777..13528842))
FT                   /codon_start=1
FT                   /gene="Cdk7"
FT                   /locus_tag="mCG_116124"
FT                   /product="cyclin-dependent kinase 7 (homolog of Xenopus
FT                   MO15 cdk-activating kinase), isoform CRA_a"
FT                   /note="gene_id=mCG116124.1 transcript_id=mCT117241.1
FT                   protein_id=mCP51934.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3THG5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:102956"
FT                   /db_xref="UniProtKB/TrEMBL:Q3THG5"
FT                   /protein_id="EDL00796.1"
FT                   /translation="MAVDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKL
FT                   GHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKD
FT                   NSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFG
FT                   SPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQL
FT                   TRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGVPLQHIFIAAGDDLLELIQGLFLFNPC
FT                   TRTTASQALKTKYFSNRPGPTPGCQLPRPNCPVEALKEPANPTVATKRKRAEALEQGIL
FT                   PKKLIF"
FT   assembly_gap    13505447..13505466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13515677..13515712
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    13523394..13523602
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   gene            complement(13533955..>13541736)
FT                   /locus_tag="mCG_116118"
FT                   /note="gene_id=mCG116118.1"
FT   mRNA            complement(join(13533955..13534269,13538247..13538310,
FT                   13541609..>13541730))
FT                   /locus_tag="mCG_116118"
FT                   /product="mCG116118, transcript variant mCT168941"
FT                   /note="gene_id=mCG116118.1 transcript_id=mCT168941.0
FT                   created on 08-NOV-2002"
FT   mRNA            complement(join(13533957..13534269,13536093..13536280,
FT                   13541609..>13541736))
FT                   /locus_tag="mCG_116118"
FT                   /product="mCG116118, transcript variant mCT168942"
FT                   /note="gene_id=mCG116118.1 transcript_id=mCT168942.0
FT                   created on 08-NOV-2002"
FT   mRNA            complement(join(13533957..13534269,13536093..13536274,
FT                   13538247..13538310,13541609..>13541736))
FT                   /locus_tag="mCG_116118"
FT                   /product="mCG116118, transcript variant mCT175477"
FT                   /note="gene_id=mCG116118.1 transcript_id=mCT175477.0
FT                   created on 08-NOV-2002"
FT   mRNA            complement(join(13533957..13534269,13536093..13536280,
FT                   13538247..13538310,13541609..13541715))
FT                   /locus_tag="mCG_116118"
FT                   /product="mCG116118, transcript variant mCT117235"
FT                   /note="gene_id=mCG116118.1 transcript_id=mCT117235.0
FT                   created on 08-NOV-2002"
FT   CDS             complement(join(13534202..13534269,13538247..13538310,
FT                   13541609..>13541728))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116118"
FT                   /product="mCG116118, isoform CRA_c"
FT                   /note="gene_id=mCG116118.1 transcript_id=mCT168941.0
FT                   protein_id=mCP91820.0 isoform=CRA_c"
FT                   /protein_id="EDL00793.1"
FT                   /translation="RLRPTLPTPDTSAARLRPGSCPCSGVTMGSKMASATRVVQVVKPH
FT                   APLIKFPNRRDKPKLSAWGSRVTVVAAACHQTEGLALQ"
FT   CDS             complement(join(13534252..13534269,13536093..13536280,
FT                   13541609..>13541735))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116118"
FT                   /product="mCG116118, isoform CRA_d"
FT                   /note="gene_id=mCG116118.1 transcript_id=mCT168942.0
FT                   protein_id=mCP91825.0 isoform=CRA_d"
FT                   /protein_id="EDL00794.1"
FT                   /translation="ITQAPPHAAHSRYFCSSSAPRKLPLLGGHDGQQDGFRHQGRAASE
FT                   ALGSAALPSHSSAISQHSKGSTSPDLLMHQGPPDTAEIIKSLPQKYRRKPMSQEEMEFI
FT                   QRGGPE"
FT   CDS             complement(join(13534252..13534269,13536093..13536274,
FT                   13538247..13538310,13541609..>13541734))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116118"
FT                   /product="mCG116118, isoform CRA_e"
FT                   /note="gene_id=mCG116118.1 transcript_id=mCT175477.0
FT                   protein_id=mCP98396.0 isoform=CRA_e"
FT                   /protein_id="EDL00795.1"
FT                   /translation="SHRLRPTLPTPDTSAARLRPGSCPCSGVTMGSKMASATRVVQVVK
FT                   PHAPLIKFPNRRDKPKLSEALGSAALPSHSSAISQHSKGSTSPDLLMHQGPPDTAEIIK
FT                   SLPQKYRRKPMSQEEMEFIQRGGPE"
FT   CDS             complement(join(13534252..13534269,13536093..13536280,
FT                   13538247..13538310,13541609..13541647))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116118"
FT                   /product="mCG116118, isoform CRA_a"
FT                   /note="gene_id=mCG116118.1 transcript_id=mCT117235.0
FT                   protein_id=mCP51901.1 isoform=CRA_a"
FT                   /protein_id="EDL00791.1"
FT                   /translation="MGSKMASATRVVQVVKPHAPLIKFPNRRDKPKLSASEALGSAALP
FT                   SHSSAISQHSKGSTSPDLLMHQGPPDTAEIIKSLPQKYRRKPMSQEEMEFIQRGGPE"
FT   assembly_gap    13534963..13534982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(<13538240..13538310,13540477..13540716,
FT                   13540868..>13541171))
FT                   /locus_tag="mCG_116118"
FT                   /product="mCG116118, transcript variant mCT168940"
FT                   /note="gene_id=mCG116118.1 transcript_id=mCT168940.0
FT                   created on 08-NOV-2002"
FT   CDS             complement(join(<13538240..13538310,13540477..>13540629))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116118"
FT                   /product="mCG116118, isoform CRA_b"
FT                   /note="gene_id=mCG116118.1 transcript_id=mCT168940.0
FT                   protein_id=mCP91817.0 isoform=CRA_b"
FT                   /protein_id="EDL00792.1"
FT                   /translation="VRFCKLRVADKVCYLSYITSYVNNAYITQSGVRKGADMVARSINP
FT                   STQEAEVVKPHAPLIKFPNRRDKPKLSGK"
FT   gene            complement(13556632..13572931)
FT                   /gene="Cenph"
FT                   /locus_tag="mCG_116115"
FT                   /note="gene_id=mCG116115.1"
FT   mRNA            complement(join(13556632..13557140,13558709..13558872,
FT                   13560475..13560526,13561094..13561157,13563750..13563806,
FT                   13568227..13568301,13568687..13568735,13569758..13569813,
FT                   13572719..13572931))
FT                   /gene="Cenph"
FT                   /locus_tag="mCG_116115"
FT                   /product="centromere protein H, transcript variant
FT                   mCT117232"
FT                   /note="gene_id=mCG116115.1 transcript_id=mCT117232.0
FT                   created on 08-NOV-2002"
FT   mRNA            complement(join(13556632..13557140,13558709..13558872,
FT                   13560475..13560526,13561094..13561157,13563750..13563806,
FT                   13568227..13568301,13569758..13569813,13572719..>13572857))
FT                   /gene="Cenph"
FT                   /locus_tag="mCG_116115"
FT                   /product="centromere protein H, transcript variant
FT                   mCT175476"
FT                   /note="gene_id=mCG116115.1 transcript_id=mCT175476.0
FT                   created on 08-NOV-2002"
FT   mRNA            complement(join(13556647..13557140,13558709..13558872,
FT                   13560475..13560526,13561094..13561157,13572718..>13572926))
FT                   /gene="Cenph"
FT                   /locus_tag="mCG_116115"
FT                   /product="centromere protein H, transcript variant
FT                   mCT168937"
FT                   /note="gene_id=mCG116115.1 transcript_id=mCT168937.0
FT                   created on 08-NOV-2002"
FT   mRNA            complement(join(13556647..13557140,13558709..13558872,
FT                   13560475..13560526,13561094..13561157,13563750..13563806,
FT                   13568227..13568301,13572718..>13572917))
FT                   /gene="Cenph"
FT                   /locus_tag="mCG_116115"
FT                   /product="centromere protein H, transcript variant
FT                   mCT168939"
FT                   /note="gene_id=mCG116115.1 transcript_id=mCT168939.0
FT                   created on 08-NOV-2002"
FT   CDS             complement(join(13557048..13557140,13558709..13558872,
FT                   13560475..13560526,13561094..13561157,13572718..>13572926))
FT                   /codon_start=1
FT                   /gene="Cenph"
FT                   /locus_tag="mCG_116115"
FT                   /product="centromere protein H, isoform CRA_b"
FT                   /note="gene_id=mCG116115.1 transcript_id=mCT168937.0
FT                   protein_id=mCP91819.0 isoform=CRA_b"
FT                   /protein_id="EDL00787.1"
FT                   /translation="SGRVGTSGNQFRGGKNCWVIFCGVQTCGPLQWRSSRGRGLRPGLR
FT                   PAKRSGVCRRPRRSVSRTVSACCSGVLTDDMKHILKLQKLIMKSQEESSELEKKLLDVR
FT                   KKRLQLKQASRSKLLEIQIEKNKQKEDVDKMENSEMIKTMKKKLQTEIKITTVVQHTFQ
FT                   GLILASKTNWAEDPALRETVLQLEKDLNTL"
FT   CDS             complement(join(13557048..13557140,13558709..13558872,
FT                   13560475..13560526,13561094..13561157,13563750..13563806,
FT                   13568227..13568301,13572718..>13572917))
FT                   /codon_start=1
FT                   /gene="Cenph"
FT                   /locus_tag="mCG_116115"
FT                   /product="centromere protein H, isoform CRA_c"
FT                   /note="gene_id=mCG116115.1 transcript_id=mCT168939.0
FT                   protein_id=mCP91816.0 isoform=CRA_c"
FT                   /protein_id="EDL00788.1"
FT                   /translation="VGTSGNQFRGGKNCWVIFCGVQTCGPLQWRSSRGRGLRPGLRPAK
FT                   RSGVCRRPRRSVSRTVSACCSGKIEELENEIEDVKSNIEMKSLALSRMKLSVALRDNME
FT                   NMGPENCVLTDDMKHILKLQKLIMKSQEESSELEKKLLDVRKKRLQLKQASRSKLLEIQ
FT                   IEKNKQKEDVDKMENSEMIKTMKKKLQTEIKITTVVQHTFQGLILASKTNWAEDPALRE
FT                   TVLQLEKDLNTL"
FT   CDS             complement(join(13557048..13557140,13558709..13558872,
FT                   13560475..13560526,13561094..13561157,13563750..13563806,
FT                   13568227..13568301,13568687..13568735,13569758..13569813,
FT                   13572719..13572834))
FT                   /codon_start=1
FT                   /gene="Cenph"
FT                   /locus_tag="mCG_116115"
FT                   /product="centromere protein H, isoform CRA_a"
FT                   /note="gene_id=mCG116115.1 transcript_id=mCT117232.0
FT                   protein_id=mCP51778.1 isoform=CRA_a"
FT                   /protein_id="EDL00786.1"
FT                   /translation="MEEQPRERSEAGAEACEEKRGLSQAAEERIEDRISLLLRLRAQTK
FT                   QQLLEYKSMIDTNEEKTPEQIMQEKQIEVKIEELENEIEDVKSNIEMKSLALSRMKLSV
FT                   ALRDNMENMGPENCVLTDDMKHILKLQKLIMKSQEESSELEKKLLDVRKKRLQLKQASR
FT                   SKLLEIQIEKNKQKEDVDKMENSEMIKTMKKKLQTEIKITTVVQHTFQGLILASKTNWA
FT                   EDPALRETVLQLEKDLNTL"
FT   CDS             complement(join(13557048..13557140,13558709..13558872,
FT                   13560475..13560526,13561094..13561157,13563750..13563806,
FT                   13568227..13568301,13569758..>13569774))
FT                   /codon_start=1
FT                   /gene="Cenph"
FT                   /locus_tag="mCG_116115"
FT                   /product="centromere protein H, isoform CRA_d"
FT                   /note="gene_id=mCG116115.1 transcript_id=mCT175476.0
FT                   protein_id=mCP98395.0 isoform=CRA_d"
FT                   /protein_id="EDL00789.1"
FT                   /translation="VHDRHNKIEELENEIEDVKSNIEMKSLALSRMKLSVALRDNMENM
FT                   GPENCVLTDDMKHILKLQKLIMKSQEESSELEKKLLDVRKKRLQLKQASRSKLLEIQIE
FT                   KNKQKEDVDKMENSEMIKTMKKKLQTEIKITTVVQHTFQGLILASKTNWAEDPALRETV
FT                   LQLEKDLNTL"
FT   assembly_gap    13559489..13559508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13564197..13564535
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   mRNA            complement(join(13568228..13568598,13568687..13568735,
FT                   13569758..13569813,13572719..>13572913))
FT                   /gene="Cenph"
FT                   /locus_tag="mCG_116115"
FT                   /product="centromere protein H, transcript variant
FT                   mCT168938"
FT                   /note="gene_id=mCG116115.1 transcript_id=mCT168938.0
FT                   created on 08-NOV-2002"
FT   CDS             complement(join(13568583..13568598,13568687..13568735,
FT                   13569758..13569813,13572719..>13572912))
FT                   /codon_start=1
FT                   /gene="Cenph"
FT                   /locus_tag="mCG_116115"
FT                   /product="centromere protein H, isoform CRA_e"
FT                   /note="gene_id=mCG116115.1 transcript_id=mCT168938.0
FT                   protein_id=mCP91824.0 isoform=CRA_e"
FT                   /protein_id="EDL00790.1"
FT                   /translation="NFRKPISWREELLGYFLWRSNLRAFAMEEQPRERSEAGAEACEEK
FT                   RGLSQAAEERIEDRISLLLRLRAQTKQQLLEYKSMIDTNEEKTPEQIMQEKQIEVILDK
FT                   "
FT   gene            complement(13575764..13583496)
FT                   /locus_tag="mCG_116121"
FT                   /note="gene_id=mCG116121.1"
FT   mRNA            complement(join(13575764..13576817,13577055..13577165,
FT                   13577809..13577949,13578191..13578427,13578658..13578816,
FT                   13580498..13580680,13582490..13582651,13582766..13582936,
FT                   13583415..13583496))
FT                   /locus_tag="mCG_116121"
FT                   /product="mCG116121"
FT                   /note="gene_id=mCG116121.1 transcript_id=mCT117238.0
FT                   created on 16-MAY-2002"
FT   CDS             complement(join(13576710..13576817,13577055..13577165,
FT                   13577809..13577949,13578191..13578427,13578658..13578816,
FT                   13580498..13580680,13582490..13582651,13582766..13582936,
FT                   13583415..13583435))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116121"
FT                   /product="mCG116121"
FT                   /note="gene_id=mCG116121.1 transcript_id=mCT117238.0
FT                   protein_id=mCP51917.1"
FT                   /db_xref="GOA:Q3TQW9"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="MGI:MGI:88302"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQW9"
FT                   /protein_id="EDL00785.1"
FT                   /translation="MALRVTRNTKINAENKAKVSMAGAKRVPVTVTAASKPGLRPRTAL
FT                   GDIGNKVSEELQARVPLKREAKTLGTGKGTVKALPKPVEKVPVCEPEVELAEPEPEPEL
FT                   EHVREEKLSPEPILVDNPSPSPMETSGCAPAEEYLCQAFSDVILAVSDVDADDGADPNL
FT                   CSEYVKDIYAYLRQLEEEQSVRPKYLQGREVTGNMRAILIDWLIQVQMKFRLLQETMYM
FT                   TVSIIDRFMQNSCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTNNTYTKHQIRQ
FT                   MEMKILRVLNFSLGRPLPLHFLRRASKVGEVDVEQHTLAKYLMELSMLDYDMVHFAPSQ
FT                   IAAGAFCLALKILDNGEWTPTLQHYLSYSEDSLLPVMQHLAKNVVMVNCGLTKHMTVKN
FT                   KYAASKHAKISTLAQLNCTLVQNLSKAVTKA"
FT   gene            complement(13599685..>13630375)
FT                   /gene="Slc30a5"
FT                   /locus_tag="mCG_116116"
FT                   /note="gene_id=mCG116116.2"
FT   mRNA            complement(join(13599685..13600497,13600898..13601026,
FT                   13603570..13603796,13606120..13606315,13608342..13608471,
FT                   13609679..13609836,13610329..13610537,13610714..13611002,
FT                   13611627..13611797,13614040..13614116,13615157..13615244,
FT                   13618150..13618237,13621948..13622033,13623484..13623550,
FT                   13625932..13626054,13630134..13630359))
FT                   /gene="Slc30a5"
FT                   /locus_tag="mCG_116116"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 5, transcript variant mCT117233"
FT                   /note="gene_id=mCG116116.2 transcript_id=mCT117233.1
FT                   created on 16-MAY-2002"
FT   mRNA            complement(join(13599883..13600497,13600898..13601026,
FT                   13603570..13603796,13606120..13606315,13608342..13608471,
FT                   13609679..13609836,13610329..13610537,13610714..13611002,
FT                   13614040..13614116,13615157..13615244,13618150..13618237,
FT                   13621948..13622033,13623484..13623550,13625932..13626054,
FT                   13630134..>13630375))
FT                   /gene="Slc30a5"
FT                   /locus_tag="mCG_116116"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 5, transcript variant mCT189362"
FT                   /note="gene_id=mCG116116.2 transcript_id=mCT189362.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(13600327..13600497,13600898..13601026,
FT                   13603570..13603796,13606120..13606315,13608342..13608471,
FT                   13609679..13609836,13610329..13610537,13610714..13611002,
FT                   13614040..13614116,13615157..13615244,13618150..13618237,
FT                   13621948..13622033,13623484..13623550,13625932..13626054,
FT                   13630134..>13630216))
FT                   /codon_start=1
FT                   /gene="Slc30a5"
FT                   /locus_tag="mCG_116116"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 5, isoform CRA_a"
FT                   /note="gene_id=mCG116116.2 transcript_id=mCT189362.0
FT                   protein_id=mCP110347.0 isoform=CRA_a"
FT                   /protein_id="EDL00783.1"
FT                   /translation="ACMEEKYGGDARPGPGGGLGPVDVPSARLTRYIVLLCLTKCLKAV
FT                   GLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKPITKHQWIKIFKHAVAGCI
FT                   ISLLWFFGLTLCGPLRTLLLFEHSDIVVISLLSVLFTSSGGGPAKTRGAAFFIIAVICL
FT                   LLFDNDDLMAKMAEHPEGHHDSALTHMLYTAIAFLGVADHKSKVESWFSLIMPFTTVIF
FT                   FVMILDFYMDSVCSVKMDVSKCARYGSFPIFISALLFGNFWTHPITDQLRAMNRAAHQE
FT                   STEHVLSGGVVVSAVFFILSANILSSPSKRGQKGTLIGYSPEGTPLYHFMGDAFQHSSQ
FT                   SVPRFIKDSLKQVLEESDSRQIFYFLCLNLLFTFVELFYGVLTNSLGLISDGFHMLFDC
FT                   SALVMGLFAALMSRWKATRIFSYGYGRIEILSGFINGLFLIVIAFFVFMESVARLIDPP
FT                   ELDTNMLTPVSVGGLIVNLIGICAFSHAHSHGHGASQGNCHSDHGHSHHAHGHGHDHGH
FT                   SHGFTGGGMNANMRGVFLHVLADTLGSIGVIVSTVLIEQFGWFIADPLCSLFIAVLIFL
FT                   SVIPLIKDACQVLLLRLPPDHEKELHIALEKIQKIEGLISYRDPHFWRHSASIVAGTIH
FT                   IQVTSEVLEQRIVQQVTGILKDAGVNNLTIQVEKEAYFQHMSGLSTGFHDVLAMTKQME
FT                   SLKYCKDGTYIM"
FT   CDS             complement(join(13600327..13600497,13600898..13601026,
FT                   13603570..13603796,13606120..13606315,13608342..13608471,
FT                   13609679..13609836,13610329..13610537,13610714..13611002,
FT                   13611627..13611797,13614040..13614116,13615157..13615244,
FT                   13618150..13618237,13621948..13622033,13623484..13623550,
FT                   13625932..13626054,13630134..13630210))
FT                   /codon_start=1
FT                   /gene="Slc30a5"
FT                   /locus_tag="mCG_116116"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 5, isoform CRA_b"
FT                   /note="gene_id=mCG116116.2 transcript_id=mCT117233.1
FT                   protein_id=mCP51889.1 isoform=CRA_b"
FT                   /protein_id="EDL00784.1"
FT                   /translation="MEEKYGGDARPGPGGGLGPVDVPSARLTRYIVLLCLTKCLKAVGL
FT                   FESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKPITKHQWIKIFKHAVAGCIIS
FT                   LLWFFGLTLCGPLRTLLLFEHSDIVVISLLSVLFTSSGGGPAKTRGAAFFIIAVICLLL
FT                   FDNDDLMAKMAEHPEGHHDSALTHMLYTAIAFLGVADHKGGVLLLVLALCCKVGFHTAS
FT                   RKLSIDVGGAKRLQALSQLVSVFLLCPWVIVLSVTTESKVESWFSLIMPFTTVIFFVMI
FT                   LDFYMDSVCSVKMDVSKCARYGSFPIFISALLFGNFWTHPITDQLRAMNRAAHQESTEH
FT                   VLSGGVVVSAVFFILSANILSSPSKRGQKGTLIGYSPEGTPLYHFMGDAFQHSSQSVPR
FT                   FIKDSLKQVLEESDSRQIFYFLCLNLLFTFVELFYGVLTNSLGLISDGFHMLFDCSALV
FT                   MGLFAALMSRWKATRIFSYGYGRIEILSGFINGLFLIVIAFFVFMESVARLIDPPELDT
FT                   NMLTPVSVGGLIVNLIGICAFSHAHSHGHGASQGNCHSDHGHSHHAHGHGHDHGHSHGF
FT                   TGGGMNANMRGVFLHVLADTLGSIGVIVSTVLIEQFGWFIADPLCSLFIAVLIFLSVIP
FT                   LIKDACQVLLLRLPPDHEKELHIALEKIQKIEGLISYRDPHFWRHSASIVAGTIHIQVT
FT                   SEVLEQRIVQQVTGILKDAGVNNLTIQVEKEAYFQHMSGLSTGFHDVLAMTKQMESLKY
FT                   CKDGTYIM"
FT   gene            <13630317..13631420
FT                   /locus_tag="mCG_116127"
FT                   /note="gene_id=mCG116127.1"
FT   mRNA            13630317..13631420
FT                   /locus_tag="mCG_116127"
FT                   /product="mCG116127, transcript variant mCT117244"
FT                   /note="gene_id=mCG116127.1 transcript_id=mCT117244.1
FT                   created on 16-MAY-2002"
FT   mRNA            join(<13630317..13630630,13631232..13631419)
FT                   /locus_tag="mCG_116127"
FT                   /product="mCG116127, transcript variant mCT168945"
FT                   /note="gene_id=mCG116127.1 transcript_id=mCT168945.0
FT                   created on 16-MAY-2002"
FT   CDS             join(<13630386..13630630,13631232..13631265)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116127"
FT                   /product="mCG116127, isoform CRA_a"
FT                   /note="gene_id=mCG116127.1 transcript_id=mCT168945.0
FT                   protein_id=mCP91821.0 isoform=CRA_a"
FT                   /protein_id="EDL00781.1"
FT                   /translation="AAGCSGSAVPRRPYGQERYRATSSAPAALTPGGVTNPAPARWWTR
FT                   GFASLRLLPPLGRLRSTRPLLASSREAPKRSLQRHLRYLGLYWSESQ"
FT   CDS             13630822..13630947
FT                   /codon_start=1
FT                   /locus_tag="mCG_116127"
FT                   /product="mCG116127, isoform CRA_b"
FT                   /note="gene_id=mCG116127.1 transcript_id=mCT117244.1
FT                   protein_id=mCP51770.1 isoform=CRA_b"
FT                   /protein_id="EDL00782.1"
FT                   /translation="MMNFRREPHIGVANSSALTVFFCFFFFFFSNEKAKSFLKCL"
FT   assembly_gap    13635262..13635413
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    13652492..13652511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13653582..13653601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13677018..13677058
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    13686966..13686985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13693220..13693371
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            complement(13705847..13706710)
FT                   /pseudo
FT                   /locus_tag="mCG_116120"
FT                   /note="gene_id=mCG116120.1"
FT   mRNA            complement(13705847..13706710)
FT                   /pseudo
FT                   /locus_tag="mCG_116120"
FT                   /note="gene_id=mCG116120.1 transcript_id=mCT117237.1
FT                   created on 15-MAY-2002"
FT   assembly_gap    13717456..13718209
FT                   /estimated_length=754
FT                   /gap_type="unknown"
FT   assembly_gap    13720669..13720731
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    13733933..13734023
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   gene            complement(13735988..>13737012)
FT                   /locus_tag="mCG_116119"
FT                   /note="gene_id=mCG116119.1"
FT   mRNA            complement(13735988..>13737012)
FT                   /locus_tag="mCG_116119"
FT                   /product="mCG116119"
FT                   /note="gene_id=mCG116119.1 transcript_id=mCT117236.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(13736498..>13736923)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116119"
FT                   /product="mCG116119"
FT                   /note="gene_id=mCG116119.1 transcript_id=mCT117236.1
FT                   protein_id=mCP51905.0"
FT                   /protein_id="EDL00780.1"
FT                   /translation="GGVHTMARTKQTARKSTGGKAPRKQLATKAARKSVPSTGGVKKPH
FT                   RYRPGTVALREIRRYQKSTELLIRKLPFQGLVREIAQDFKTDLRFQSAAIGALQEASEA
FT                   YLVGLFEDTNLCAIHAKRVTIMPKDIQLARRICGERA"
FT   assembly_gap    13738023..13738131
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    13762453..13762472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13763986..13764589
FT                   /estimated_length=604
FT                   /gap_type="unknown"
FT   assembly_gap    13766642..13766661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13775082..13775101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13776180..13776199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13799338..13799442
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            complement(13802247..>13803526)
FT                   /locus_tag="mCG_116123"
FT                   /note="gene_id=mCG116123.1"
FT   mRNA            complement(13802247..>13803526)
FT                   /locus_tag="mCG_116123"
FT                   /product="mCG116123"
FT                   /note="gene_id=mCG116123.1 transcript_id=mCT117240.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(13803034..>13803525)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116123"
FT                   /product="mCG116123"
FT                   /note="gene_id=mCG116123.1 transcript_id=mCT117240.1
FT                   protein_id=mCP51931.1"
FT                   /protein_id="EDL00779.1"
FT                   /translation="ASVIPETKVPSDQDFPHIWQRRYCAIKDPFIDLNYMVYMVQYDST
FT                   HDKVNSTVKAKNRKLVINRKAITIFQEQDPANIKWDDTAAMYAVEYTGVFTTMEKAGTY
FT                   LKGETKEVITFVPSADAPMFVMGVNHEKYDNSLKIVSNVSCTTNCLAPQPRSSMTTLAW
FT                   "
FT   gene            complement(13827604..13828850)
FT                   /locus_tag="mCG_116117"
FT                   /note="gene_id=mCG116117.1"
FT   mRNA            complement(13827604..13828850)
FT                   /locus_tag="mCG_116117"
FT                   /product="mCG116117"
FT                   /note="gene_id=mCG116117.1 transcript_id=mCT117234.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(13828014..13828748)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116117"
FT                   /product="mCG116117"
FT                   /note="gene_id=mCG116117.1 transcript_id=mCT117234.1
FT                   protein_id=mCP51898.1"
FT                   /protein_id="EDL00778.1"
FT                   /translation="MGKGDPKKLRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKC
FT                   SERWKTMSAKEKGKFEDMAIADKARYEREMKTYIPPKRETKKKFKDPNAPKRPPSAFFL
FT                   FCSGYRPKIKGEHPGLSIGDVAKKRGEMWNNTAADDKQPMRRRLLRRSMRRILLPTELK
FT                   ENLMQRKRGWSRLKRARKRRKRKMMRRMKRMRKRRKKRKMKMKKKMMMMNKLVLELFFF
FT                   LIYKAFNPPVHNSLLLKKKIEM"
FT   assembly_gap    13862402..13862421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13864109..13865139
FT                   /estimated_length=1031
FT                   /gap_type="unknown"
FT   assembly_gap    13882202..13882308
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    13884880..13884969
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    13887264..13887520
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    13889669..13890279
FT                   /estimated_length=611
FT                   /gap_type="unknown"
FT   assembly_gap    13924722..13924813
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    13942706..13942725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13957847..13957900
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    13959881..13959955
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    13963251..13963270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13981255..13981274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14002352..14002371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14015470..14015489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <14021647..14037145
FT                   /locus_tag="mCG_144514"
FT                   /note="gene_id=mCG144514.0"
FT   mRNA            join(<14021647..14021886,14033093..14033222,
FT                   14033808..14033956,14035226..14037145)
FT                   /locus_tag="mCG_144514"
FT                   /product="mCG144514"
FT                   /note="gene_id=mCG144514.0 transcript_id=mCT183938.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    14034841..14034942
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   CDS             <14035280..14035675
FT                   /codon_start=1
FT                   /locus_tag="mCG_144514"
FT                   /product="mCG144514"
FT                   /note="gene_id=mCG144514.0 transcript_id=mCT183938.0
FT                   protein_id=mCP105294.0"
FT                   /protein_id="EDL00777.1"
FT                   /translation="EEWEGHFCFTGGFGLSPCFSRALLWSRLLLAVTEISQRTTSRRKD
FT                   LFGFTVSEHSVRGCLTPCVWDEHQGMVRVLGAQGKVVDLVNREQRVRQEWGRDGAWDRA
FT                   RENATMLQMAYFLHLSPTSLSFHNITK"
FT   gene            <14043913..14082996
FT                   /locus_tag="mCG_144919"
FT                   /note="gene_id=mCG144919.0"
FT   mRNA            join(<14043913..14043970,14050751..14050977,
FT                   14059585..14059672,14060330..14060429,14068439..14068515,
FT                   14082260..14082996)
FT                   /locus_tag="mCG_144919"
FT                   /product="mCG144919"
FT                   /note="gene_id=mCG144919.0 transcript_id=mCT184343.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<14050896..14050977,14059585..14059672,
FT                   14060330..14060381)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144919"
FT                   /product="mCG144919"
FT                   /note="gene_id=mCG144919.0 transcript_id=mCT184343.0
FT                   protein_id=mCP105299.0"
FT                   /protein_id="EDL00776.1"
FT                   /translation="SQWRKGSSEWTPVLIICGVLQKRSWDLGFEVCERPTRQQEKRHNR
FT                   ILLHTFTDILQSPADSTCLFIISRRVST"
FT   assembly_gap    14081634..14081653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14103661..14103768
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    14107697..14107756
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    14116885..14116978
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    14122018..14122037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14124160..14124447
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    14126596..14126615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14133712..14134122
FT                   /estimated_length=411
FT                   /gap_type="unknown"
FT   assembly_gap    14170763..14170782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14172205..14173173
FT                   /estimated_length=969
FT                   /gap_type="unknown"
FT   assembly_gap    14175871..14176029
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    14180323..14180893
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   gene            complement(14182723..>14188268)
FT                   /locus_tag="mCG_145869"
FT                   /note="gene_id=mCG145869.0"
FT   mRNA            complement(join(14182723..14182970,14183099..14183168,
FT                   14188181..>14188268))
FT                   /locus_tag="mCG_145869"
FT                   /product="mCG145869"
FT                   /note="gene_id=mCG145869.0 transcript_id=mCT185977.0
FT                   created on 03-JUL-2003"
FT   CDS             complement(join(14182963..14182970,14183099..14183168,
FT                   14188181..>14188210))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145869"
FT                   /product="mCG145869"
FT                   /note="gene_id=mCG145869.0 transcript_id=mCT185977.0
FT                   protein_id=mCP107343.0"
FT                   /protein_id="EDL00775.1"
FT                   /translation="DGAYSTQQSQIMTLLPQVPKCYDYRHEPPHLTTDT"
FT   assembly_gap    14185452..14185471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14186314..14186416
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   gene            <14188356..14255516
FT                   /gene="4932411K12Rik"
FT                   /locus_tag="mCG_144513"
FT                   /note="gene_id=mCG144513.0"
FT   mRNA            join(<14188356..14188638,14189397..14189551,
FT                   14224035..14224147,14232451..14232507,14233709..14233797,
FT                   14252584..14252771,14253245..14255516)
FT                   /gene="4932411K12Rik"
FT                   /locus_tag="mCG_144513"
FT                   /product="RIKEN cDNA 4932411K12"
FT                   /note="gene_id=mCG144513.0 transcript_id=mCT183937.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<14188365..14188638,14189397..14189446)
FT                   /codon_start=1
FT                   /gene="4932411K12Rik"
FT                   /locus_tag="mCG_144513"
FT                   /product="RIKEN cDNA 4932411K12"
FT                   /note="gene_id=mCG144513.0 transcript_id=mCT183937.0
FT                   protein_id=mCP105293.0"
FT                   /protein_id="EDL00774.1"
FT                   /translation="GGSWVPGTSSWQRAMPASPPADLGFLELDLSSASNQMSSGNVFAA
FT                   AHGSSRVNGIPRHSSTALQVETEEEREVSLAVLNPFSSSNQCQESTAPHRKHETVVLGH
FT                   DRR"
FT   assembly_gap    14191442..14191523
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    14195796..14195815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14236333..14236352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14286610..14286907
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    14310434..14310453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14326269..14326445
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   gene            <14337590..14340424
FT                   /locus_tag="mCG_1047170"
FT                   /note="gene_id=mCG1047170.1"
FT   mRNA            join(<14337590..14337719,14340323..14340424)
FT                   /locus_tag="mCG_1047170"
FT                   /product="mCG1047170"
FT                   /note="gene_id=mCG1047170.1 transcript_id=mCT164874.1
FT                   created on 15-MAY-2002"
FT   CDS             join(<14337627..14337719,14340323..14340409)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047170"
FT                   /product="mCG1047170"
FT                   /note="gene_id=mCG1047170.1 transcript_id=mCT164874.1
FT                   protein_id=mCP51742.1"
FT                   /protein_id="EDL00773.1"
FT                   /translation="RGEAEVLCGRRLWLSDLQKISRTVASAKNRELEVQKLCFLVFSPT
FT                   EGLQRRLASKCTCL"
FT   assembly_gap    14340425..14341017
FT                   /estimated_length=593
FT                   /gap_type="unknown"
FT   assembly_gap    14365275..14365294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14367927..14368125
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    14369955..14369979
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    14388052..14388071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14393482..14393951
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    14423107..14423126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14431173..14431681
FT                   /estimated_length=509
FT                   /gap_type="unknown"
FT   assembly_gap    14432391..14433415
FT                   /estimated_length=1025
FT                   /gap_type="unknown"
FT   assembly_gap    14438004..14438026
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    14452003..14452077
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    14463931..14463950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14473857..14561763)
FT                   /gene="Pik3r1"
FT                   /locus_tag="mCG_115224"
FT                   /note="gene_id=mCG115224.1"
FT   mRNA            complement(join(14473857..14478359,14479498..14479668,
FT                   14480263..14480331,14480421..14480597,14480791..14480933,
FT                   14481923..14482048,14482269..14482449,14482689..14482787,
FT                   14483775..14483877,14494739..14494818,14495003..14495204,
FT                   14496001..14496132,14502212..14502286,14502942..14503034,
FT                   14550643..14551356,14561569..14561763))
FT                   /gene="Pik3r1"
FT                   /locus_tag="mCG_115224"
FT                   /product="phosphatidylinositol 3-kinase, regulatory
FT                   subunit, polypeptide 1 (p85 alpha)"
FT                   /note="gene_id=mCG115224.1 transcript_id=mCT116324.0
FT                   created on 15-MAY-2002"
FT   CDS             complement(join(14478170..14478359,14479498..14479668,
FT                   14480263..14480331,14480421..14480597,14480791..14480933,
FT                   14481923..14482048,14482269..14482449,14482689..14482787,
FT                   14483775..14483877,14494739..14494818,14495003..14495204,
FT                   14496001..14496132,14502212..14502286,14502942..14503034,
FT                   14550643..14550976))
FT                   /codon_start=1
FT                   /gene="Pik3r1"
FT                   /locus_tag="mCG_115224"
FT                   /product="phosphatidylinositol 3-kinase, regulatory
FT                   subunit, polypeptide 1 (p85 alpha)"
FT                   /note="gene_id=mCG115224.1 transcript_id=mCT116324.0
FT                   protein_id=mCP51809.1"
FT                   /db_xref="GOA:P26450"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001720"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR032498"
FT                   /db_xref="InterPro:IPR035020"
FT                   /db_xref="InterPro:IPR035022"
FT                   /db_xref="InterPro:IPR035591"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036860"
FT                   /db_xref="MGI:MGI:97583"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26450"
FT                   /protein_id="EDL00772.1"
FT                   /translation="MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDG
FT                   QEARPEDIGWLNGYNETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKT
FT                   EADTEQQALPLPDLAEQFAPPDVAPPLLIKLLEAIEKKGLECSTLYRTQSSSNPAELRQ
FT                   LLDCDAASVDLEMIDVHVLADAFKRYLADLPNPVIPVAVYNEMMSLAQELQSPEDCIQL
FT                   LKKLIRLPNIPHQCWLTLQYLLKHFFKLSQASSKNLLNARVLSEIFSPVLFRFPAASSD
FT                   NTEHLIKAIEILISTEWNERQPAPALPPKPPKPTTVANNSMNNNMSLQDAEWYWGDISR
FT                   EEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFN
FT                   SVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQE
FT                   KSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGN
FT                   EKEIQRIMHNHDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKT
FT                   RDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAE
FT                   NLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKEL
FT                   VLHYQHTSLVQHNDSLNVTLAYPVYAQQRR"
FT   assembly_gap    14514387..14514420
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    14524849..14524951
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    14535726..14535745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14554024..14554043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14558111..14558130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14562497..14562534
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    14594920..14595650
FT                   /estimated_length=731
FT                   /gap_type="unknown"
FT   assembly_gap    14614810..14614953
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   gene            complement(14635501..14635977)
FT                   /locus_tag="mCG_1047116"
FT                   /note="gene_id=mCG1047116.1"
FT   mRNA            complement(14635501..14635977)
FT                   /locus_tag="mCG_1047116"
FT                   /product="mCG1047116"
FT                   /note="gene_id=mCG1047116.1 transcript_id=mCT164820.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(14635797..14635976)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047116"
FT                   /product="mCG1047116"
FT                   /note="gene_id=mCG1047116.1 transcript_id=mCT164820.1
FT                   protein_id=mCP51711.1"
FT                   /protein_id="EDL00771.1"
FT                   /translation="MWHAGLDPSISIVYRGKDRPAMLRSCVLSAHRCAFPLASKKGMFQ
FT                   VQLAHDVSRISKHY"
FT   gene            <14649208..>14650127
FT                   /locus_tag="mCG_1047168"
FT                   /note="gene_id=mCG1047168.1"
FT   mRNA            join(<14649208..14649499,14649816..>14650127)
FT                   /locus_tag="mCG_1047168"
FT                   /product="mCG1047168"
FT                   /note="gene_id=mCG1047168.1 transcript_id=mCT164872.0
FT                   created on 05-NOV-2002"
FT   CDS             <14649834..14650127
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047168"
FT                   /product="mCG1047168"
FT                   /note="gene_id=mCG1047168.1 transcript_id=mCT164872.0
FT                   protein_id=mCP51729.0"
FT                   /protein_id="EDL00770.1"
FT                   /translation="DLVSKAPLVFEALASGSLGFLRLQAELLVLILTSGGFLFIMREAG
FT                   VAFIFSIRCSQLPCGKPTSGLPTWTASYRTTVTCIQIFVAFVVCLFLYLYLL"
FT   assembly_gap    14695004..14695286
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    14745598..14745750
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    14768525..14768929
FT                   /estimated_length=405
FT                   /gap_type="unknown"
FT   assembly_gap    14777720..14777906
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    14785124..14785143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14814439..14814576
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    14845343..14845545
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    14849314..14849333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14897897..14897955
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    14900743..14900955
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    14903674..14903693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14956528..14956559
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    14961392..14961472
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    14985285..14985304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15023128..15023277
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    15058607..15060892
FT                   /estimated_length=2286
FT                   /gap_type="unknown"
FT   assembly_gap    15075323..15075342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15082260..15082279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15101157..15101649
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   assembly_gap    15122277..15122296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15144785..15144804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15148464..15149333
FT                   /estimated_length=870
FT                   /gap_type="unknown"
FT   assembly_gap    15157534..15157553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15173205..15173224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15178944..15179744
FT                   /estimated_length=801
FT                   /gap_type="unknown"
FT   assembly_gap    15181890..15184435
FT                   /estimated_length=2546
FT                   /gap_type="unknown"
FT   assembly_gap    15185174..15185336
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    15217184..15217203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15220058..15220077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15221179..15221198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15230043..15230062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15234142..15234161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15265256..15265275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15282876..15282895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15284442..15284461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15288156..15288175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15290023..15290621
FT                   /estimated_length=599
FT                   /gap_type="unknown"
FT   assembly_gap    15298450..15298469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15340549..15340780
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    15347551..15347570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15360881..15361024
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    15369268..15369287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15375793..15376297
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    15388951..15388970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15390972..15391170
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    15396697..15396716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15398339..15398358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15409587..15409870
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    15418199..15418301
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    15427434..15427453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15440628..15440692
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            <15455805..15456724
FT                   /locus_tag="mCG_1047164"
FT                   /note="gene_id=mCG1047164.1"
FT   mRNA            join(<15455805..15456405,15456498..15456724)
FT                   /locus_tag="mCG_1047164"
FT                   /product="mCG1047164"
FT                   /note="gene_id=mCG1047164.1 transcript_id=mCT164868.0
FT                   created on 15-MAY-2002"
FT   CDS             <15455806..15456045
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047164"
FT                   /product="mCG1047164"
FT                   /note="gene_id=mCG1047164.1 transcript_id=mCT164868.0
FT                   protein_id=mCP51703.0"
FT                   /protein_id="EDL00769.1"
FT                   /translation="IGKEVTTFASVKHVSTEIVEQMGKKSLSLPPGVIPPPSPFLRQRT
FT                   LCLFVFLKDSVIYTDVKIKQGNKAYKDFLIMQIC"
FT   assembly_gap    15456420..15456479
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    15458332..15458773
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   gene            15471650..15517919
FT                   /gene="Cd180"
FT                   /locus_tag="mCG_115540"
FT                   /note="gene_id=mCG115540.1"
FT   mRNA            join(15471650..15471860,15480770..15480936,
FT                   15517461..15517919)
FT                   /gene="Cd180"
FT                   /locus_tag="mCG_115540"
FT                   /product="CD180 antigen, transcript variant mCT168934"
FT                   /note="gene_id=mCG115540.1 transcript_id=mCT168934.0
FT                   created on 15-MAY-2002"
FT   mRNA            join(15471659..15471860,15480770..15480936,
FT                   15482773..15484870,15485089..15485189)
FT                   /gene="Cd180"
FT                   /locus_tag="mCG_115540"
FT                   /product="CD180 antigen, transcript variant mCT116645"
FT                   /note="gene_id=mCG115540.1 transcript_id=mCT116645.0
FT                   created on 15-MAY-2002"
FT   mRNA            join(15471682..15471860,15517461..15517792)
FT                   /gene="Cd180"
FT                   /locus_tag="mCG_115540"
FT                   /product="CD180 antigen, transcript variant mCT168935"
FT                   /note="gene_id=mCG115540.1 transcript_id=mCT168935.0
FT                   created on 15-MAY-2002"
FT   CDS             join(15471771..15471860,15517461..15517517)
FT                   /codon_start=1
FT                   /gene="Cd180"
FT                   /locus_tag="mCG_115540"
FT                   /product="CD180 antigen, isoform CRA_b"
FT                   /note="gene_id=mCG115540.1 transcript_id=mCT168935.0
FT                   protein_id=mCP91823.0 isoform=CRA_b"
FT                   /protein_id="EDL00767.1"
FT                   /translation="MAPDISCFFLVALFLASCRATTSSDQKCIESCLGEKIYLPDGKSG
FT                   VER"
FT   CDS             join(15471771..15471860,15480770..15480936,
FT                   15517461..15517470)
FT                   /codon_start=1
FT                   /gene="Cd180"
FT                   /locus_tag="mCG_115540"
FT                   /product="CD180 antigen, isoform CRA_a"
FT                   /note="gene_id=mCG115540.1 transcript_id=mCT168934.0
FT                   protein_id=mCP91822.0 isoform=CRA_a"
FT                   /protein_id="EDL00766.1"
FT                   /translation="MAPDISCFFLVALFLASCRATTSSDQKCIEKEVNKTYNCENLGLN
FT                   EIPGTLPNSTECLEFSFNVLPTIQNTTFSRLINLTFLDLTRAV"
FT   CDS             join(15471771..15471860,15480770..15480936,
FT                   15482773..15484501)
FT                   /codon_start=1
FT                   /gene="Cd180"
FT                   /locus_tag="mCG_115540"
FT                   /product="CD180 antigen, isoform CRA_c"
FT                   /note="gene_id=mCG115540.1 transcript_id=mCT116645.0
FT                   protein_id=mCP51696.1 isoform=CRA_c"
FT                   /protein_id="EDL00768.1"
FT                   /translation="MAPDISCFFLVALFLASCRATTSSDQKCIEKEVNKTYNCENLGLN
FT                   EIPGTLPNSTECLEFSFNVLPTIQNTTFSRLINLTFLDLTRCQIYWIHEDTFQSQHRLD
FT                   TLVLTANPLIFMAETALSGPKALKHLFFIQTGISSIDFIPLHNQKTLESLYLGSNHISS
FT                   IKLPKGFPTEKLKVLDFQNNAIHYLSKEDMSSLQQATNLSLNLNGNDIAGIEPGAFDSA
FT                   VFQSLNFGGTQNLLVIFKGLKNSTIQSLWLGTFEDMDDEDISPAVFEGLCEMSVESINL
FT                   QKHYFFNISSNTFHCFSGLQELDLTATHLSELPSGLVGLSTLKKLVLSANKFENLCQIS
FT                   ASNFPSLTHLSIKGNTKRLELGTGCLENLENLRELDLSHDDIETSDCCNLQLRNLSHLQ
FT                   SLNLSYNEPLSLKTEAFKECPQLELLDLAFTRLKVKDAQSPFQNLHLLKVLNLSHSLLD
FT                   ISSEQLFDGLPALQHLNLQGNHFPKGNIQKTNSLQTLGRLEILVLSFCDLSSIDQHAFT
FT                   SLKMMNHVDLSHNRLTSSSIEALSHLKGIYLNLASNHISIILPSLLPILSQQRTINLRQ
FT                   NPLDCTCSNIYFLEWYKENMQKLEDTEDTLCENPPLLRGVRLSDVTLSCSMAAVGIFFL
FT                   IVFLLVFAILLIFAVKYFLRWKYQHI"
FT   assembly_gap    15484871..15485088
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    15490671..15490883
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   gene            complement(15511610..15677375)
FT                   /locus_tag="mCG_115541"
FT                   /note="gene_id=mCG115541.1"
FT   mRNA            complement(join(15511610..15517192,15517489..15517670,
FT                   15520235..15520371,15528803..15528925,15529670..15529899,
FT                   15532345..15532545,15536789..15537024,15537310..15537437,
FT                   15539247..15539359,15539582..15539704,15546230..15546331,
FT                   15548128..15548293,15549082..15549214,15550814..15550952,
FT                   15552545..15552753,15559606..15559691,15561791..15561858,
FT                   15565763..15565895,15567409..15567510,15572415..15572624,
FT                   15574532..15574607,15576492..15576649,15583082..15583160,
FT                   15588924..15588993,15625392..15625480,15677283..15677375))
FT                   /locus_tag="mCG_115541"
FT                   /product="mCG115541"
FT                   /note="gene_id=mCG115541.1 transcript_id=mCT116646.1
FT                   created on 14-MAY-2002"
FT   CDS             complement(join(15513291..15517192,15517489..15517670,
FT                   15520235..15520371,15528803..15528925,15529670..15529899,
FT                   15532345..15532545,15536789..15537024,15537310..15537437,
FT                   15539247..15539359,15539582..15539704,15546230..15546331,
FT                   15548128..15548293,15549082..15549214,15550814..15550952,
FT                   15552545..15552753,15559606..15559691,15561791..15561858,
FT                   15565763..15565895,15567409..15567510,15572415..15572624,
FT                   15574532..15574607,15576492..15576649,15583082..15583160,
FT                   15588924..15588993,15625392..15625480,15677283..15677374))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115541"
FT                   /product="mCG115541"
FT                   /note="gene_id=mCG115541.1 transcript_id=mCT116646.1
FT                   protein_id=mCP51699.1"
FT                   /protein_id="EDL00765.1"
FT                   /translation="MDMSDPNFWTVLSNFTLPHLRSGNRLRRTQSCRTSNRKSLIGNGQ
FT                   SPALPRPHSPLSAHAGNSPQDSPRNFSPSASAHFSFARRTDGRRWSLASLPSSGYGTNT
FT                   PSSTVSSSCSSQEKLHQLPYQPTPDELHFLSKHFCTTESIATENRCRNTPMRPRSRSLS
FT                   PGRSPACCDHEIIMMNHVYKERFPKATAQMEERLKEIITSYSPDHVLPLADGVLSFTHH
FT                   QIIELARDCLDKSHQGLITSRYFFELQHKLDKLLQEAHDRSESGELAFIKQLVRKILIV
FT                   IARPARLLECLEFDPEEFYYLLEAAEGHAKEGQGIKTDIPRYIISQLGLNKDPLEEMAQ
FT                   LGNYDSRTAETPEMDESVSSSNTSLRLRRKPRESDFETIKLISNGAYGAVYFVRHKESR
FT                   QRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVSMYCSFETRRHLCMVMEYVEG
FT                   GDCATLMKNMGPLPVDMARMYFAETVLALEYLHNYGIVHRDLKPDNLLVTSMGHIKLTD
FT                   FGLSKVGLMSMTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMG
FT                   IILYEFLVGCVPFFGDTPEELFGQVISDEINWPEKDEAPPPDAQELITLLLRQNPLERL
FT                   GTGGAYEVKQHRFFRSLDWNSLLRQKAEFIPQLESEDDTSYFDTRSEKYHHMETEEEDD
FT                   TNDEDFTVEIRQFSSCSHRFSKVFSSIDRITQNSGEDKDDSEDKTKSTTLPSTETLSWS
FT                   SEYSEMQQLSTSNSSDTESNRCKLSSGLLPKLAISTDGEQDEAVPCSGDPREEPEKPVP
FT                   PSEECTQEEPEVTTPASTISSSTLSVGSFSEHLDQINGRSECVDSTDNSSKPSSEPTSH
FT                   VARQRLESTEKKKISGKVTKSLSASALSLMIPGDMFAVSPLGSPMSPHSLSSDPSSSRD
FT                   SSPSRDSSAASASPHQPIVIHSSGKNYGFTIRAIRVYVGDSDIYTVHHIVWNVEEGSPA
FT                   YQAGLKAGDLITHINGEPVHGLVHTEVIELLLKSGNKVSITTTPFENTSIKTGPARRNS
FT                   YKGRMVRRSKKSKKKESLERRRSLFKKLAKQPSPLLHTSRSFSCLNRSLSSGESLPGSP
FT                   THSLSPRSPTPSYRSTPDFPSGTNSSQSSSPSSSAPNSPAGSGHIRPSTLHGLAPKLSG
FT                   QRYRSGRRKSAGSIPLSPLARTPSPTPQPTSPQRSPSPLLGHSLGNAKITQAFPSKMHS
FT                   PPTIVRHIVRPKSAEPPRSPLLKRVQSEEKLSPSYGSDKKLLCSRKHSLEVTQEEVQRE
FT                   QCQREVTLQSLEENVCDAPSLSRARPVEQGCLKRPVSRKVGRQESVDDLDRDKLKAKVV
FT                   VKKPEEKHESHQKPHSLGGDSESYALFRLEEREKKVYSKGLERSGHFENTSAELPSVGS
FT                   LLKDTLHKQASVRASEGVTSDGAACSLTPGEHSQSLGDFKRASASGILHDSVCPISDRP
FT                   APGKVEYSEKASQAKELLRSEKLDSKLANIDYLRKKMSLDDKDDSHCAILKPKITSSAH
FT                   ECLPGNPIRPMAGQQETPPASENRAFINSTHTPQMSAVSFVPLKALAGRVENGGEKAGL
FT                   AAPESPVRKSPSEYKLEGRSVSCLKPIEGTLDIALLSGPHASKTELLSPEPAQSPSPGI
FT                   NVGPCVPLALPGSSGKKGDSTSLREPSSANLKVNKSYLLEPRFLPPSRALQDSLAASGP
FT                   EPKSKPERKLIHPSARSPATVTESNLQQKEGGPATHQDRSTDTRNLPGPGQTLHNVDLP
FT                   RLCTRAPLPPEGTPTKEKPCLKEPSAKVKSEWSAVRDDGHRDPCAKLCPAETGKASDSS
FT                   KPLPSGGRTQPDFYKQTQTSEKAWAHAKTNHKDSQDEVKSLAREDSASLLYEKEIGRAR
FT                   KGPEPKPEVPATRCPPQPPGIEGEKREKLSAAPSLQKQAPKEPDRKEQTSQRPGGSGPQ
FT                   QPPPTKELSNSASWQHGSSPSHTLKKEPGTKAAAAEPSTSLHDTPRSATATTTAIATAT
FT                   TTTTTSAGHSDCSSHKARPGPDPSPSKSKHQDRSLSSQKLSAGSAKGKEPVTQPLGGSI
FT                   REGKGGSKGPVDTFSAVLTTQGKASDVLVQGEGRVSIIVHTEECPLDAKLKNTNGGCPP
FT                   EMQAKHPPRQGHLSEAADQKPLIAGEKQSPSPKHPKPSTVKDYPSLCRQTDRSPSHQAT
FT                   TGDRKAEGKKCTDALYVAAPEGYKPEASPSLHHGETGLRGSERPPMGMGKGFSEPKGKG
FT                   PGPQKSLAETGKPSGMKRSPSATVQSSLRSAAPPEKSLSYSASFPEAQPGVREVPAANS
FT                   SPSSAKATGGTSEFPAPSSRDHRKLQSGGDGRSQMIKSDSLPSFRLSTSALESHFQDPQ
FT                   VPIASGHRGRALSVTAATGEPKGRELAQPPPVRKQNACREATRAPPAPSTDRSLPLSSE
FT                   KDFVVRQRRGKETLRSSPHKKAS"
FT   assembly_gap    15539799..15539865
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    15541457..15541602
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    15588895..15588914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15597321..15597340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15603507..15603784
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    15617303..15617322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15623907..15624108
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    15636904..15637093
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    15670986..15672047
FT                   /estimated_length=1062
FT                   /gap_type="unknown"
FT   assembly_gap    15692480..15692698
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    15712237..15712256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15735526..15736211
FT                   /estimated_length=686
FT                   /gap_type="unknown"
FT   assembly_gap    15737497..15740900
FT                   /estimated_length=3404
FT                   /gap_type="unknown"
FT   assembly_gap    15746065..15746084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15747198..15747217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15749274..15755683
FT                   /estimated_length=6410
FT                   /gap_type="unknown"
FT   assembly_gap    15766030..15767168
FT                   /estimated_length=1139
FT                   /gap_type="unknown"
FT   assembly_gap    15767922..15768491
FT                   /estimated_length=570
FT                   /gap_type="unknown"
FT   assembly_gap    15785967..15785986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15799945..15799964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<15826738..15950347)
FT                   /locus_tag="mCG_115538"
FT                   /note="gene_id=mCG115538.1"
FT   mRNA            complement(join(<15826738..15826812,15918531..15918655,
FT                   15950193..15950347))
FT                   /locus_tag="mCG_115538"
FT                   /product="mCG115538, transcript variant mCT116648"
FT                   /note="gene_id=mCG115538.1 transcript_id=mCT116648.0
FT                   created on 14-MAY-2002"
FT   CDS             complement(join(<15826738..15826812,15918531..15918655,
FT                   15950193..15950319))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115538"
FT                   /product="mCG115538, isoform CRA_b"
FT                   /note="gene_id=mCG115538.1 transcript_id=mCT116648.0
FT                   protein_id=mCP51721.1 isoform=CRA_b"
FT                   /protein_id="EDL00764.1"
FT                   /translation="MPFRKCSNPDVACGLGKSLKYKRQLSEDGKQLRRGSLGGALTGRY
FT                   LLPNPVAGQAWPASAETSNLVRMRSQALGQSAPSLTASLEGQPPKSHFNSARHRQRLVD
FT                   PAASK"
FT   assembly_gap    15827647..15827666
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15830173..15830192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15842089..15842108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15843953..15844155
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    15850031..15850346
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    15873705..15880119
FT                   /estimated_length=6415
FT                   /gap_type="unknown"
FT   assembly_gap    15883406..15883425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15884846..15884865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15932923..15932942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(15938588..15939517)
FT                   /locus_tag="mCG_115538"
FT                   /product="mCG115538, transcript variant mCT116647"
FT                   /note="gene_id=mCG115538.1 transcript_id=mCT116647.1
FT                   created on 14-MAY-2002"
FT   CDS             complement(15938929..15939408)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115538"
FT                   /product="mCG115538, isoform CRA_a"
FT                   /note="gene_id=mCG115538.1 transcript_id=mCT116647.1
FT                   protein_id=mCP51714.1 isoform=CRA_a"
FT                   /protein_id="EDL00763.1"
FT                   /translation="MVEPHQHEGIFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDR
FT                   IEYQTWNPFHSKLAAAVLGGVDQIHIKWGAKVLYLGTASGTTISHVSDIVGWDGLVYAV
FT                   EFSHHSGLTSSTWPRRGPTLFLELKMLDTHTNTTCLSQWWMSSLPTWPSQTKPGL"
FT   assembly_gap    15959677..15959799
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    15968081..15968100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15980016..15980308
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    15982918..15983075
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    16005956..16005975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16016954..16016973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16034520..16034655
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    16045783..16046064
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    16055437..16056027
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    16095358..16095491
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    16096940..16097002
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    16100103..16100324
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    16100933..16101025
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    16132503..16132547
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    16135479..16141011
FT                   /estimated_length=5533
FT                   /gap_type="unknown"
FT   assembly_gap    16143011..16143030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16144213..16144232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16154031..16154923
FT                   /estimated_length=893
FT                   /gap_type="unknown"
FT   assembly_gap    16156528..16163760
FT                   /estimated_length=7233
FT                   /gap_type="unknown"
FT   assembly_gap    16165499..16169867
FT                   /estimated_length=4369
FT                   /gap_type="unknown"
FT   gene            16173983..16174545
FT                   /locus_tag="mCG_115539"
FT                   /note="gene_id=mCG115539.1"
FT   mRNA            16173983..16174545
FT                   /locus_tag="mCG_115539"
FT                   /product="mCG115539"
FT                   /note="gene_id=mCG115539.1 transcript_id=mCT116644.0
FT                   created on 14-MAY-2002"
FT   CDS             16174018..16174500
FT                   /codon_start=1
FT                   /locus_tag="mCG_115539"
FT                   /product="mCG115539"
FT                   /note="gene_id=mCG115539.1 transcript_id=mCT116644.0
FT                   protein_id=mCP51694.1"
FT                   /protein_id="EDL00762.1"
FT                   /translation="MTNTKGKRRGTRYMFSRPFRKHGLVPLATYMRIYKKGDIVDIKGM
FT                   GTVQKEMPHKYYHSKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVWIEHIKHSKSRDS
FT                   FLKWVKENNQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPELLESIPYKFMA"
FT   assembly_gap    16178529..16178548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16179680..16179699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16188307..16188417
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    16213265..16213284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16214317..16214336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16223565..16223584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16259831..16259850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16278861..16279139
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    16286475..16286494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16289830..16289849
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16294389..16295558
FT                   /estimated_length=1170
FT                   /gap_type="unknown"
FT   assembly_gap    16319093..16319401
FT                   /estimated_length=309
FT                   /gap_type="unknown"
XX
CO   join(complement(AAHY01108483.1:1..4064),gap(506),
CO   complement(AAHY01108484.1:1..4538),gap(20),
CO   complement(AAHY01108485.1:1..3841),gap(20),
CO   complement(AAHY01108486.1:1..4359),gap(20),
CO   complement(AAHY01108487.1:1..5782),gap(20),
CO   complement(AAHY01108488.1:1..2727),gap(20),
CO   complement(AAHY01108489.1:1..2015),gap(20),
CO   complement(AAHY01108490.1:1..1431),gap(28),
CO   complement(AAHY01108491.1:1..12419),gap(252),
CO   complement(AAHY01108492.1:1..6166),gap(20),
CO   complement(AAHY01108493.1:1..28483),gap(20),
CO   complement(AAHY01108494.1:1..2440),gap(365),
CO   complement(AAHY01108495.1:1..8235),gap(116),
CO   complement(AAHY01108496.1:1..19551),gap(20),
CO   complement(AAHY01108497.1:1..3268),gap(20),
CO   complement(AAHY01108498.1:1..25910),gap(20),
CO   complement(AAHY01108499.1:1..21438),gap(2710),
CO   complement(AAHY01108500.1:1..2469),gap(1187),
CO   complement(AAHY01108501.1:1..32818),gap(20),
CO   complement(AAHY01108502.1:1..8414),gap(697),
CO   complement(AAHY01108503.1:1..30684),gap(20),
CO   complement(AAHY01108504.1:1..1232),gap(20),
CO   complement(AAHY01108505.1:1..8970),gap(243),
CO   complement(AAHY01108506.1:1..25493),gap(249),
CO   complement(AAHY01108507.1:1..18142),gap(20),
CO   complement(AAHY01108508.1:1..9134),gap(2715),
CO   complement(AAHY01108509.1:1..6816),gap(1104),
CO   complement(AAHY01108510.1:1..11190),gap(1160),
CO   complement(AAHY01108511.1:1..22436),gap(145),
CO   complement(AAHY01108512.1:1..8001),gap(20),
CO   complement(AAHY01108513.1:1..10629),gap(20),
CO   complement(AAHY01108514.1:1..43202),gap(806),
CO   complement(AAHY01108515.1:1..1972),gap(69),
CO   complement(AAHY01108516.1:1..31206),gap(201),
CO   complement(AAHY01108517.1:1..27115),gap(512),
CO   complement(AAHY01108518.1:1..1164),gap(20),AAHY01108519.1:1..1050,gap(20),
CO   AAHY01108520.1:1..5001,gap(168),AAHY01108521.1:1..51634,gap(20),
CO   AAHY01108522.1:1..19838,gap(149),AAHY01108523.1:1..11041,gap(1571),
CO   complement(AAHY01108524.1:1..51923),gap(20),AAHY01108525.1:1..9907,
CO   gap(291),complement(AAHY01108526.1:1..52942),gap(192),
CO   complement(AAHY01108527.1:1..1548),gap(1830),AAHY01108528.1:1..1594,
CO   gap(20),AAHY01108529.1:1..1141,gap(6672),
CO   complement(AAHY01108530.1:1..37562),gap(256),AAHY01108531.1:1..3721,
CO   gap(20),AAHY01108532.1:1..10893,gap(20),AAHY01108533.1:1..84934,gap(20),
CO   complement(AAHY01108534.1:1..4598),gap(20),
CO   complement(AAHY01108535.1:1..76377),gap(20),
CO   complement(AAHY01108536.1:1..27352),gap(20),AAHY01108537.1:1..14825,
CO   gap(49),AAHY01108538.1:1..11039,gap(41),AAHY01108539.1:1..6728,gap(234),
CO   AAHY01108540.1:1..17315,gap(20),complement(AAHY01108541.1:1..20924),
CO   gap(20),AAHY01108542.1:1..14191,gap(88),AAHY01108543.1:1..15967,gap(20),
CO   complement(AAHY01108544.1:1..37210),gap(20),
CO   complement(AAHY01108545.1:1..95714),gap(23),
CO   complement(AAHY01108546.1:1..76394),gap(240),AAHY01108547.1:1..5058,
CO   gap(20),complement(AAHY01108548.1:1..14216),gap(20),
CO   complement(AAHY01108549.1:1..15586),gap(984),AAHY01108550.1:1..801,
CO   gap(893),complement(AAHY01108551.1:1..33564),gap(20),
CO   AAHY01108552.1:1..17009,gap(474),complement(AAHY01108553.1:1..35150),
CO   gap(20),AAHY01108554.1:1..23199,gap(198),
CO   complement(AAHY01108555.1:1..1874),gap(35),AAHY01108556.1:1..1796,gap(20),
CO   AAHY01108557.1:1..30177,gap(20),AAHY01108558.1:1..25920,gap(152),
CO   AAHY01108559.1:1..5346,gap(20),complement(AAHY01108560.1:1..59658),gap(20),
CO   complement(AAHY01108561.1:1..2642),gap(20),AAHY01108562.1:1..16828,gap(20),
CO   complement(AAHY01108563.1:1..37015),gap(20),
CO   complement(AAHY01108564.1:1..5013),gap(20),AAHY01108565.1:1..46650,gap(20),
CO   complement(AAHY01108566.1:1..12141),gap(20),
CO   complement(AAHY01108567.1:1..1146),gap(20),AAHY01108568.1:1..2389,gap(20),
CO   complement(AAHY01108569.1:1..1202),gap(20),
CO   complement(AAHY01108570.1:1..1055),gap(20),
CO   complement(AAHY01108571.1:1..1764),gap(20),
CO   complement(AAHY01108572.1:1..1124),gap(453),AAHY01108573.1:1..12021,
CO   gap(243),complement(AAHY01108574.1:1..25081),gap(72),
CO   complement(AAHY01108575.1:1..5727),gap(31),AAHY01108576.1:1..15275,gap(20),
CO   complement(AAHY01108577.1:1..50701),gap(20),AAHY01108578.1:1..9339,
CO   gap(530),complement(AAHY01108579.1:1..8157),gap(1571),
CO   AAHY01108580.1:1..1734,gap(658),complement(AAHY01108581.1:1..1179),
CO   gap(246),AAHY01108582.1:1..2276,gap(20),complement(AAHY01108583.1:1..4619),
CO   gap(20),AAHY01108584.1:1..1258,gap(20),AAHY01108585.1:1..9631,gap(20),
CO   complement(AAHY01108586.1:1..147485),gap(20),
CO   complement(AAHY01108587.1:1..15798),gap(285),
CO   complement(AAHY01108588.1:1..12071),gap(73),
CO   complement(AAHY01108589.1:1..24894),gap(20),
CO   complement(AAHY01108590.1:1..20996),gap(20),
CO   complement(AAHY01108591.1:1..62121),gap(20),
CO   complement(AAHY01108592.1:1..25836),gap(20),AAHY01108593.1:1..2288,gap(20),
CO   complement(AAHY01108594.1:1..4860),gap(29),
CO   complement(AAHY01108595.1:1..12372),gap(586),
CO   complement(AAHY01108596.1:1..20615),gap(219),
CO   complement(AAHY01108597.1:1..16889),gap(20),
CO   complement(AAHY01108598.1:1..55017),gap(20),
CO   complement(AAHY01108599.1:1..5491),gap(1297),AAHY01108600.1:1..5091,
CO   gap(2613),complement(AAHY01108601.1:1..28700),gap(547),
CO   complement(AAHY01108602.1:1..45162),gap(20),AAHY01108603.1:1..9268,
CO   gap(234),AAHY01108604.1:1..10279,gap(39),
CO   complement(AAHY01108605.1:1..5846),gap(20),
CO   complement(AAHY01108606.1:1..1117),gap(625),
CO   complement(AAHY01108607.1:1..18487),gap(27),
CO   complement(AAHY01108608.1:1..9890),gap(20),
CO   complement(AAHY01108609.1:1..14422),gap(207),
CO   complement(AAHY01108610.1:1..23442),gap(395),
CO   complement(AAHY01108611.1:1..5449),gap(26),
CO   complement(AAHY01108612.1:1..3784),gap(197),
CO   complement(AAHY01108613.1:1..134254),gap(749),AAHY01108614.1:1..18272,
CO   gap(73),complement(AAHY01108615.1:1..64047),gap(20),
CO   complement(AAHY01108616.1:1..5855),gap(2170),
CO   complement(AAHY01108617.1:1..16128),gap(20),AAHY01108618.1:1..20880,
CO   gap(20),complement(AAHY01108619.1:1..45519),gap(20),AAHY01108620.1:1..8832,
CO   gap(138),complement(AAHY01108621.1:1..18686),gap(209),
CO   complement(AAHY01108622.1:1..16395),gap(370),AAHY01108623.1:1..28925,
CO   gap(20),complement(AAHY01108624.1:1..38621),gap(4236),
CO   AAHY01108625.1:1..5217,gap(20),complement(AAHY01108626.1:1..23124),
CO   gap(104),complement(AAHY01108627.1:1..53094),gap(830),
CO   AAHY01108628.1:1..32252,gap(24),complement(AAHY01108629.1:1..19092),
CO   gap(20),AAHY01108630.1:1..10613,gap(2281),AAHY01108631.1:1..975,gap(41),
CO   complement(AAHY01108632.1:1..21392),gap(324),
CO   complement(AAHY01108633.1:1..72193),gap(2622),AAHY01108634.1:1..1198,
CO   gap(20),complement(AAHY01108635.1:1..1488),gap(20),
CO   complement(AAHY01108636.1:1..1802),gap(20),AAHY01108637.1:1..4580,gap(42),
CO   AAHY01108638.1:1..2354,gap(20),AAHY01108639.1:1..1026,gap(20),
CO   complement(AAHY01108640.1:1..3430),gap(311),AAHY01108641.1:1..1062,gap(20),
CO   complement(AAHY01108642.1:1..25514),gap(536),
CO   complement(AAHY01108643.1:1..33662),gap(20),AAHY01108644.1:1..47932,
CO   gap(20),complement(AAHY01108645.1:1..1113),gap(20),AAHY01108646.1:1..1337,
CO   gap(20),AAHY01108647.1:1..1140,gap(459),AAHY01108648.1:1..1014,gap(2031),
CO   complement(AAHY01108649.1:1..2318),gap(20),
CO   complement(AAHY01108650.1:1..6200),gap(317),
CO   complement(AAHY01108651.1:1..11791),gap(20),AAHY01108652.1:1..8906,
CO   gap(268),AAHY01108653.1:1..8553,gap(153),
CO   complement(AAHY01108654.1:1..5399),gap(460),
CO   complement(AAHY01108655.1:1..1716),gap(20),AAHY01108656.1:1..1244,gap(20),
CO   AAHY01108657.1:1..17409,gap(148),complement(AAHY01108658.1:1..3922),
CO   gap(20),complement(AAHY01108659.1:1..29377),gap(722),
CO   complement(AAHY01108660.1:1..17246),gap(87),AAHY01108661.1:1..23226,
CO   gap(20),AAHY01108662.1:1..14644,gap(20),AAHY01108663.1:1..34253,gap(20),
CO   AAHY01108664.1:1..3617,gap(20),AAHY01108665.1:1..1177,gap(20),
CO   AAHY01108666.1:1..1203,gap(20),complement(AAHY01108667.1:1..2650),gap(20),
CO   complement(AAHY01108668.1:1..2125),gap(415),
CO   complement(AAHY01108669.1:1..1538),gap(20),
CO   complement(AAHY01108670.1:1..3207),gap(20),
CO   complement(AAHY01108671.1:1..1458),gap(190),
CO   complement(AAHY01108672.1:1..1473),gap(529),
CO   complement(AAHY01108673.1:1..1672),gap(20),
CO   complement(AAHY01108674.1:1..2615),gap(20),AAHY01108675.1:1..5789,gap(20),
CO   complement(AAHY01108676.1:1..13874),gap(224),AAHY01108677.1:1..2729,
CO   gap(20),complement(AAHY01108678.1:1..27923),gap(20),
CO   complement(AAHY01108679.1:1..21485),gap(1336),AAHY01108680.1:1..12170,
CO   gap(216),complement(AAHY01108681.1:1..14311),gap(815),
CO   complement(AAHY01108682.1:1..39406),gap(346),
CO   complement(AAHY01108683.1:1..4997),gap(20),
CO   complement(AAHY01108684.1:1..7764),gap(20),
CO   complement(AAHY01108685.1:1..1056),gap(20),
CO   complement(AAHY01108686.1:1..1693),gap(20),AAHY01108687.1:1..5272,gap(20),
CO   AAHY01108688.1:1..2224,gap(20),AAHY01108689.1:1..1673,gap(628),
CO   AAHY01108690.1:1..1796,gap(859),complement(AAHY01108691.1:1..6698),
CO   gap(246),complement(AAHY01108692.1:1..15755),gap(20),
CO   complement(AAHY01108693.1:1..1885),gap(20),
CO   complement(AAHY01108694.1:1..2156),gap(20),
CO   complement(AAHY01108695.1:1..4055),gap(20),
CO   complement(AAHY01108696.1:1..61557),gap(695),
CO   complement(AAHY01108697.1:1..5806),gap(70),
CO   complement(AAHY01108698.1:1..9750),gap(90),
CO   complement(AAHY01108699.1:1..1562),gap(20),
CO   complement(AAHY01108700.1:1..7875),gap(20),
CO   complement(AAHY01108701.1:1..23691),gap(20),AAHY01108702.1:1..1252,gap(20),
CO   AAHY01108703.1:1..1885,gap(20),complement(AAHY01108704.1:1..1572),gap(20),
CO   complement(AAHY01108705.1:1..1059),gap(364),
CO   complement(AAHY01108706.1:1..2893),gap(602),AAHY01108707.1:1..1599,gap(20),
CO   complement(AAHY01108708.1:1..14523),gap(37),
CO   complement(AAHY01108709.1:1..25213),gap(20),AAHY01108710.1:1..1235,gap(20),
CO   complement(AAHY01108711.1:1..53277),gap(20),
CO   complement(AAHY01108712.1:1..3914),gap(20),AAHY01108713.1:1..18182,
CO   gap(111),AAHY01108714.1:1..21482,gap(20),
CO   complement(AAHY01108715.1:1..13727),gap(151),
CO   complement(AAHY01108716.1:1..35510),gap(144),AAHY01108717.1:1..32202,
CO   gap(20),complement(AAHY01108718.1:1..24148),gap(20),
CO   complement(AAHY01108719.1:1..1947),gap(213),
CO   complement(AAHY01108720.1:1..58551),gap(83),
CO   complement(AAHY01108721.1:1..13980),gap(39),
CO   complement(AAHY01108722.1:1..8324),gap(1290),AAHY01108723.1:1..12606,
CO   gap(20),AAHY01108724.1:1..2376,gap(20),AAHY01108725.1:1..21261,gap(20),
CO   AAHY01108726.1:1..17129,gap(321),AAHY01108727.1:1..10827,gap(167),
CO   AAHY01108728.1:1..4292,gap(209),complement(AAHY01108729.1:1..1228),
CO   gap(491),complement(AAHY01108730.1:1..1372),gap(1895),
CO   AAHY01108731.1:1..7299,gap(20),complement(AAHY01108732.1:1..22467),gap(68),
CO   AAHY01108733.1:1..2190,gap(20),complement(AAHY01108734.1:1..11627),gap(20),
CO   complement(AAHY01108735.1:1..16159),gap(20),
CO   complement(AAHY01108736.1:1..2293),gap(20),
CO   complement(AAHY01108737.1:1..2274),gap(20),
CO   complement(AAHY01108738.1:1..5119),gap(266),
CO   complement(AAHY01108739.1:1..1202),gap(20),AAHY01108740.1:1..12264,gap(20),
CO   AAHY01108741.1:1..13232,gap(73),AAHY01108742.1:1..2776,gap(20),
CO   AAHY01108743.1:1..1140,gap(20),AAHY01108744.1:1..23500,gap(143),
CO   AAHY01108745.1:1..2542,gap(257),AAHY01108746.1:1..1812,gap(1006),
CO   AAHY01108747.1:1..16084,gap(20),complement(AAHY01108748.1:1..16419),
CO   gap(289),complement(AAHY01108749.1:1..13956),gap(32),
CO   complement(AAHY01108750.1:1..1124),gap(114),
CO   complement(AAHY01108751.1:1..4643),gap(20),
CO   complement(AAHY01108752.1:1..18622),gap(20),AAHY01108753.1:1..3908,
CO   gap(599),AAHY01108754.1:1..3383,gap(20),AAHY01108755.1:1..2341,gap(20),
CO   AAHY01108756.1:1..1558,gap(20),complement(AAHY01108757.1:1..12509),
CO   gap(489),complement(AAHY01108758.1:1..53564),gap(20),
CO   complement(AAHY01108759.1:1..6268),gap(565),
CO   complement(AAHY01108760.1:1..9247),gap(116),
CO   complement(AAHY01108761.1:1..6508),gap(253),
CO   complement(AAHY01108762.1:1..22474),gap(20),
CO   complement(AAHY01108763.1:1..9344),gap(35),
CO   complement(AAHY01108764.1:1..19034),gap(20),AAHY01108765.1:1..5008,gap(20),
CO   complement(AAHY01108766.1:1..1839),gap(20),AAHY01108767.1:1..22798,gap(20),
CO   complement(AAHY01108768.1:1..1876),gap(20),
CO   complement(AAHY01108769.1:1..4616),gap(20),
CO   complement(AAHY01108770.1:1..2685),gap(20),AAHY01108771.1:1..1322,gap(20),
CO   complement(AAHY01108772.1:1..1437),gap(20),
CO   complement(AAHY01108773.1:1..1342),gap(20),
CO   complement(AAHY01108774.1:1..55464),gap(20),
CO   complement(AAHY01108775.1:1..8370),gap(306),
CO   complement(AAHY01108776.1:1..12390),gap(739),
CO   complement(AAHY01108777.1:1..92924),gap(1126),AAHY01108778.1:1..45775,
CO   gap(1480),complement(AAHY01108779.1:1..1081),gap(51),
CO   complement(AAHY01108780.1:1..20018),gap(49),
CO   complement(AAHY01108781.1:1..17076),gap(20),AAHY01108782.1:1..5662,
CO   gap(176),complement(AAHY01108783.1:1..2242),gap(348),
CO   complement(AAHY01108784.1:1..48336),gap(159),
CO   complement(AAHY01108785.1:1..13855),gap(110),
CO   complement(AAHY01108786.1:1..48321),gap(65),
CO   complement(AAHY01108787.1:1..28435),gap(89),
CO   complement(AAHY01108788.1:1..38773),gap(282),
CO   complement(AAHY01108789.1:1..980),gap(2647),
CO   complement(AAHY01108790.1:1..9990),gap(20),AAHY01108791.1:1..1629,gap(29),
CO   AAHY01108792.1:1..4745,gap(20),AAHY01108793.1:1..1149,gap(277),
CO   complement(AAHY01108794.1:1..20139),gap(49),
CO   complement(AAHY01108795.1:1..15332),gap(12401),
CO   complement(AAHY01108796.1:1..7220),gap(91),
CO   complement(AAHY01108797.1:1..2524),gap(20),
CO   complement(AAHY01108798.1:1..51486),gap(20),
CO   complement(AAHY01108799.1:1..18478),gap(20),
CO   complement(AAHY01108800.1:1..23732),gap(229),
CO   complement(AAHY01108801.1:1..20871),gap(4029),AAHY01108802.1:1..56372,
CO   gap(20),AAHY01108803.1:1..5510,gap(20),AAHY01108804.1:1..1031,gap(20),
CO   AAHY01108805.1:1..1387,gap(20),complement(AAHY01108806.1:1..3462),gap(71),
CO   complement(AAHY01108807.1:1..12920),gap(182),
CO   complement(AAHY01108808.1:1..26963),gap(23),
CO   complement(AAHY01108809.1:1..40185),gap(532),
CO   complement(AAHY01108810.1:1..1306),gap(20),
CO   complement(AAHY01108811.1:1..1076),gap(20),
CO   complement(AAHY01108812.1:1..1054),gap(20),AAHY01108813.1:1..1060,gap(20),
CO   complement(AAHY01108814.1:1..1205),gap(20),
CO   complement(AAHY01108815.1:1..3991),gap(20),
CO   complement(AAHY01108816.1:1..10799),gap(20),AAHY01108817.1:1..6633,
CO   gap(4792),complement(AAHY01108818.1:1..1231),gap(20),
CO   AAHY01108819.1:1..2024,gap(20),complement(AAHY01108820.1:1..12180),gap(20),
CO   complement(AAHY01108821.1:1..1511),gap(113),
CO   complement(AAHY01108822.1:1..21235),gap(155),
CO   complement(AAHY01108823.1:1..3050),gap(20),
CO   complement(AAHY01108824.1:1..15922),gap(20),AAHY01108825.1:1..1068,gap(20),
CO   AAHY01108826.1:1..3112,gap(1768),complement(AAHY01108827.1:1..1328),
CO   gap(20),complement(AAHY01108828.1:1..10191),gap(20),
CO   complement(AAHY01108829.1:1..145477),gap(20),
CO   complement(AAHY01108830.1:1..2752),gap(67),AAHY01108831.1:1..1108,gap(40),
CO   complement(AAHY01108832.1:1..6676),gap(918),AAHY01108833.1:1..4663,gap(20),
CO   AAHY01108834.1:1..16467,gap(4022),complement(AAHY01108835.1:1..32886),
CO   gap(2300),complement(AAHY01108836.1:1..3411),gap(252),
CO   complement(AAHY01108837.1:1..1853),gap(20),AAHY01108838.1:1..2620,gap(20),
CO   complement(AAHY01108839.1:1..5286),gap(5930),
CO   complement(AAHY01108840.1:1..1054),gap(20),
CO   complement(AAHY01108841.1:1..6072),gap(484),
CO   complement(AAHY01108842.1:1..37979),gap(255),
CO   complement(AAHY01108843.1:1..23801),gap(20),AAHY01108844.1:1..10335,
CO   gap(20),complement(AAHY01108845.1:1..1082),gap(20),
CO   complement(AAHY01108846.1:1..5963),gap(20),
CO   complement(AAHY01108847.1:1..3568),gap(20),
CO   complement(AAHY01108848.1:1..1245),gap(20),
CO   complement(AAHY01108849.1:1..1639),gap(20),
CO   complement(AAHY01108850.1:1..8937),gap(135),
CO   complement(AAHY01108851.1:1..10509),gap(20),AAHY01108852.1:1..1841,
CO   gap(821),complement(AAHY01108853.1:1..26183),gap(166),
CO   complement(AAHY01108854.1:1..14173),gap(20),
CO   complement(AAHY01108855.1:1..12914),gap(331),
CO   complement(AAHY01108856.1:1..2478),gap(656),
CO   complement(AAHY01108857.1:1..9088),gap(20),
CO   complement(AAHY01108858.1:1..17866),gap(77),
CO   complement(AAHY01108859.1:1..5061),gap(70),
CO   complement(AAHY01108860.1:1..24392),gap(3886),
CO   complement(AAHY01108861.1:1..11298),gap(20),
CO   complement(AAHY01108862.1:1..11095),gap(54),
CO   complement(AAHY01108863.1:1..19498),gap(844),
CO   complement(AAHY01108864.1:1..5716),gap(89),
CO   complement(AAHY01108865.1:1..28475),gap(20),
CO   complement(AAHY01108866.1:1..26681),gap(20),
CO   complement(AAHY01108867.1:1..3462),gap(43),
CO   complement(AAHY01108868.1:1..9562),gap(438),AAHY01108869.1:1..2089,
CO   gap(157),complement(AAHY01108870.1:1..5001),gap(20),AAHY01108871.1:1..8502,
CO   gap(20),complement(AAHY01108872.1:1..2077),gap(116),
CO   complement(AAHY01108873.1:1..8903),gap(20),AAHY01108874.1:1..1414,gap(20),
CO   complement(AAHY01108875.1:1..14582),gap(2156),
CO   complement(AAHY01108876.1:1..20699),gap(424),
CO   complement(AAHY01108877.1:1..35963),gap(874),
CO   complement(AAHY01108878.1:1..16688),gap(20),
CO   complement(AAHY01108879.1:1..34831),gap(20),
CO   complement(AAHY01108880.1:1..47247),gap(467),
CO   complement(AAHY01108881.1:1..1044),gap(20),
CO   complement(AAHY01108882.1:1..63852),gap(20),
CO   complement(AAHY01108883.1:1..7476),gap(1303),
CO   complement(AAHY01108884.1:1..2453),gap(20),AAHY01108885.1:1..3529,gap(20),
CO   complement(AAHY01108886.1:1..1190),gap(20),
CO   complement(AAHY01108887.1:1..11494),gap(20),AAHY01108888.1:1..1381,gap(20),
CO   complement(AAHY01108889.1:1..4375),gap(1711),
CO   complement(AAHY01108890.1:1..43293),gap(20),
CO   complement(AAHY01108891.1:1..28834),gap(129),
CO   complement(AAHY01108892.1:1..999),gap(552),
CO   complement(AAHY01108893.1:1..11155),gap(20),
CO   complement(AAHY01108894.1:1..53886),gap(35),
CO   complement(AAHY01108895.1:1..665),gap(524),
CO   complement(AAHY01108896.1:1..1355),gap(97),
CO   complement(AAHY01108897.1:1..33221),gap(20),
CO   complement(AAHY01108898.1:1..1320),gap(20),AAHY01108899.1:1..9773,gap(733),
CO   complement(AAHY01108900.1:1..19845),gap(20),AAHY01108901.1:1..1771,gap(20),
CO   complement(AAHY01108902.1:1..14397),gap(20),
CO   complement(AAHY01108903.1:1..13206),gap(870),
CO   complement(AAHY01108904.1:1..1544),gap(457),
CO   complement(AAHY01108905.1:1..10349),gap(768),
CO   complement(AAHY01108906.1:1..10591),gap(3442),
CO   complement(AAHY01108907.1:1..11958),gap(707),
CO   complement(AAHY01108908.1:1..8822),gap(20),AAHY01108909.1:1..2649,gap(163),
CO   complement(AAHY01108910.1:1..12510),gap(20),
CO   complement(AAHY01108911.1:1..1167),gap(20),AAHY01108912.1:1..1235,
CO   gap(1067),complement(AAHY01108913.1:1..14858),gap(396),
CO   complement(AAHY01108914.1:1..2386),gap(533),
CO   complement(AAHY01108915.1:1..15573),gap(20),
CO   complement(AAHY01108916.1:1..1171),gap(20),AAHY01108917.1:1..1329,
CO   gap(8255),complement(AAHY01108918.1:1..1055),gap(20),
CO   AAHY01108919.1:1..8563,gap(20),AAHY01108920.1:1..1233,gap(20),
CO   complement(AAHY01108921.1:1..10770),gap(53),
CO   complement(AAHY01108922.1:1..10451),gap(20),
CO   complement(AAHY01108923.1:1..14485),gap(90),
CO   complement(AAHY01108924.1:1..4935),gap(491),
CO   complement(AAHY01108925.1:1..2798),gap(589),
CO   complement(AAHY01108926.1:1..17209),gap(20),
CO   complement(AAHY01108927.1:1..51399),gap(20),
CO   complement(AAHY01108928.1:1..15622),gap(1233),
CO   complement(AAHY01108929.1:1..7125),gap(176),
CO   complement(AAHY01108930.1:1..11858),gap(93),
CO   complement(AAHY01108931.1:1..21931),gap(113),
CO   complement(AAHY01108932.1:1..17011),gap(20),
CO   complement(AAHY01108933.1:1..14409),gap(20),AAHY01108934.1:1..2378,
CO   gap(215),AAHY01108935.1:1..4488,gap(529),
CO   complement(AAHY01108936.1:1..9187),gap(23),AAHY01108937.1:1..20181,gap(20),
CO   complement(AAHY01108938.1:1..11317),gap(141),
CO   complement(AAHY01108939.1:1..20336),gap(86),
CO   complement(AAHY01108940.1:1..28025),gap(20),AAHY01108941.1:1..9078,gap(20),
CO   complement(AAHY01108942.1:1..5585),gap(20),AAHY01108943.1:1..4943,gap(85),
CO   complement(AAHY01108944.1:1..10629),gap(20),
CO   complement(AAHY01108945.1:1..6287),gap(238),
CO   complement(AAHY01108946.1:1..13118),gap(339),
CO   complement(AAHY01108947.1:1..13578),gap(107),
CO   complement(AAHY01108948.1:1..31760),gap(20),
CO   complement(AAHY01108949.1:1..4388),gap(20),
CO   complement(AAHY01108950.1:1..4850),gap(31),
CO   complement(AAHY01108951.1:1..2257),gap(5408),
CO   complement(AAHY01108952.1:1..23554),gap(97),
CO   complement(AAHY01108953.1:1..3222),gap(132),
CO   complement(AAHY01108954.1:1..36728),gap(127),AAHY01108955.1:1..3498,
CO   gap(20),complement(AAHY01108956.1:1..1276),gap(20),
CO   complement(AAHY01108957.1:1..62960),gap(213),AAHY01108958.1:1..6004,
CO   gap(350),complement(AAHY01108959.1:1..9680),gap(264),
CO   complement(AAHY01108960.1:1..37636),gap(984),AAHY01108961.1:1..4056,
CO   gap(69),AAHY01108962.1:1..7374,gap(20),complement(AAHY01108963.1:1..13678),
CO   gap(20),complement(AAHY01108964.1:1..51177),gap(20),
CO   complement(AAHY01108965.1:1..5775),gap(20),
CO   complement(AAHY01108966.1:1..39066),gap(20),
CO   complement(AAHY01108967.1:1..4693),gap(20),
CO   complement(AAHY01108968.1:1..26515),gap(20),
CO   complement(AAHY01108969.1:1..3301),gap(865),
CO   complement(AAHY01108970.1:1..47123),gap(203),AAHY01108971.1:1..6326,
CO   gap(38),AAHY01108972.1:1..10765,gap(20),AAHY01108973.1:1..6900,gap(348),
CO   complement(AAHY01108974.1:1..2474),gap(20),AAHY01108975.1:1..6129,gap(217),
CO   complement(AAHY01108976.1:1..4499),gap(3601),
CO   complement(AAHY01108977.1:1..18314),gap(20),AAHY01108978.1:1..31210,
CO   gap(20),AAHY01108979.1:1..21143,gap(20),complement(AAHY01108980.1:1..4166),
CO   gap(20),complement(AAHY01108981.1:1..1361),gap(20),
CO   complement(AAHY01108982.1:1..27351),gap(20),
CO   complement(AAHY01108983.1:1..24276),gap(1391),
CO   complement(AAHY01108984.1:1..496),gap(92),AAHY01108985.1:1..18496,gap(129),
CO   AAHY01108986.1:1..32787,gap(1112),AAHY01108987.1:1..18812,gap(71),
CO   AAHY01108988.1:1..14049,gap(1029),AAHY01108989.1:1..921,gap(652),
CO   AAHY01108990.1:1..21671,gap(20),AAHY01108991.1:1..2000,gap(62),
CO   AAHY01108992.1:1..26837,gap(215),complement(AAHY01108993.1:1..42111),
CO   gap(101),complement(AAHY01108994.1:1..85958),gap(26),
CO   AAHY01108995.1:1..4932,gap(335),AAHY01108996.1:1..7917,gap(20),
CO   complement(AAHY01108997.1:1..15046),gap(788),
CO   complement(AAHY01108998.1:1..53115),gap(20),
CO   complement(AAHY01108999.1:1..4208),gap(156),AAHY01109000.1:1..5989,
CO   gap(207),AAHY01109001.1:1..14707,gap(51),
CO   complement(AAHY01109002.1:1..27589),gap(26),AAHY01109003.1:1..21384,
CO   gap(124),AAHY01109004.1:1..2185,gap(191),
CO   complement(AAHY01109005.1:1..9246),gap(99),
CO   complement(AAHY01109006.1:1..3060),gap(20),
CO   complement(AAHY01109007.1:1..13437),gap(20),
CO   complement(AAHY01109008.1:1..6751),gap(582),
CO   complement(AAHY01109009.1:1..3694),gap(27),
CO   complement(AAHY01109010.1:1..59515),gap(398),
CO   complement(AAHY01109011.1:1..19972),gap(20),AAHY01109012.1:1..3915,gap(50),
CO   AAHY01109013.1:1..3586,gap(295),AAHY01109014.1:1..7101,gap(161),
CO   AAHY01109015.1:1..13320,gap(54),complement(AAHY01109016.1:1..12694),
CO   gap(528),AAHY01109017.1:1..11754,gap(1636),
CO   complement(AAHY01109018.1:1..1133),gap(1013),AAHY01109019.1:1..7019,
CO   gap(20),AAHY01109020.1:1..6287,gap(220),
CO   complement(AAHY01109021.1:1..11819),gap(1167),
CO   complement(AAHY01109022.1:1..14353),gap(20),
CO   complement(AAHY01109023.1:1..6483),gap(20),AAHY01109024.1:1..7186,gap(20),
CO   AAHY01109025.1:1..14237,gap(20),complement(AAHY01109026.1:1..18425),
CO   gap(119),AAHY01109027.1:1..10020,gap(20),AAHY01109028.1:1..1231,gap(13016),
CO   complement(AAHY01109029.1:1..1713),gap(296),
CO   complement(AAHY01109030.1:1..13401),gap(1078),
CO   complement(AAHY01109031.1:1..5463),gap(20),AAHY01109032.1:1..12062,gap(20),
CO   AAHY01109033.1:1..5196,gap(181),AAHY01109034.1:1..7900,gap(20),
CO   complement(AAHY01109035.1:1..30826),gap(20),
CO   complement(AAHY01109036.1:1..1231),gap(20),
CO   complement(AAHY01109037.1:1..34736),gap(461),
CO   complement(AAHY01109038.1:1..25253),gap(103),AAHY01109039.1:1..896,
CO   gap(328),complement(AAHY01109040.1:1..6559),gap(74),
CO   complement(AAHY01109041.1:1..52480),gap(129),
CO   complement(AAHY01109042.1:1..18869),gap(930),
CO   complement(AAHY01109043.1:1..13339),gap(1222),
CO   complement(AAHY01109044.1:1..7757),gap(20),AAHY01109045.1:1..1120,gap(751),
CO   AAHY01109046.1:1..2307,gap(20),AAHY01109047.1:1..1470,gap(57),
CO   complement(AAHY01109048.1:1..3089),gap(284),
CO   complement(AAHY01109049.1:1..14737),gap(20),
CO   complement(AAHY01109050.1:1..6973),gap(916),
CO   complement(AAHY01109051.1:1..4147),gap(376),AAHY01109052.1:1..5644,
CO   gap(5172),complement(AAHY01109053.1:1..2821),gap(1726),
CO   complement(AAHY01109054.1:1..2158),gap(1903),
CO   complement(AAHY01109055.1:1..2957),gap(732),
CO   complement(AAHY01109056.1:1..613),gap(20),
CO   complement(AAHY01109057.1:1..2935),gap(20),
CO   complement(AAHY01109058.1:1..1695),gap(20),
CO   complement(AAHY01109059.1:1..12153),gap(20),
CO   complement(AAHY01109060.1:1..1092),gap(1679),AAHY01109061.1:1..6565,
CO   gap(949),AAHY01109062.1:1..2535,gap(821),
CO   complement(AAHY01109063.1:1..13967),gap(20),
CO   complement(AAHY01109064.1:1..19113),gap(20),
CO   complement(AAHY01109065.1:1..5798),gap(168),
CO   complement(AAHY01109066.1:1..63537),gap(20),
CO   complement(AAHY01109067.1:1..20506),gap(20),
CO   complement(AAHY01109068.1:1..37841),gap(596),
CO   complement(AAHY01109069.1:1..3019),gap(20),
CO   complement(AAHY01109070.1:1..10040),gap(224),
CO   complement(AAHY01109071.1:1..7055),gap(20),
CO   complement(AAHY01109072.1:1..1436),gap(20),
CO   complement(AAHY01109073.1:1..1772),gap(20),
CO   complement(AAHY01109074.1:1..7139),gap(20),
CO   complement(AAHY01109075.1:1..32241),gap(20),
CO   complement(AAHY01109076.1:1..7481),gap(148),
CO   complement(AAHY01109077.1:1..9736),gap(3859),
CO   complement(AAHY01109078.1:1..3430),gap(417),
CO   complement(AAHY01109079.1:1..9113),gap(1661),
CO   complement(AAHY01109080.1:1..1524),gap(600),
CO   complement(AAHY01109081.1:1..24111),gap(468),
CO   complement(AAHY01109082.1:1..7652),gap(20),AAHY01109083.1:1..1281,gap(20),
CO   complement(AAHY01109084.1:1..1463),gap(311),
CO   complement(AAHY01109085.1:1..12151),gap(154),
CO   complement(AAHY01109086.1:1..7990),gap(20),
CO   complement(AAHY01109087.1:1..2128),gap(20),
CO   complement(AAHY01109088.1:1..1302),gap(20),
CO   complement(AAHY01109089.1:1..1250),gap(20),AAHY01109090.1:1..1138,gap(122),
CO   complement(AAHY01109091.1:1..4171),gap(20),
CO   complement(AAHY01109092.1:1..2869),gap(20),
CO   complement(AAHY01109093.1:1..2231),gap(1498),
CO   complement(AAHY01109094.1:1..2970),gap(20),
CO   complement(AAHY01109095.1:1..9919),gap(20),
CO   complement(AAHY01109096.1:1..4011),gap(20),
CO   complement(AAHY01109097.1:1..1208),gap(20),
CO   complement(AAHY01109098.1:1..1031),gap(20),
CO   complement(AAHY01109099.1:1..1236),gap(20),
CO   complement(AAHY01109100.1:1..3830),gap(532),
CO   complement(AAHY01109101.1:1..37230),gap(20),
CO   complement(AAHY01109102.1:1..2880),gap(20),
CO   complement(AAHY01109103.1:1..3221),gap(196),
CO   complement(AAHY01109104.1:1..10742),gap(20),
CO   complement(AAHY01109105.1:1..35311),gap(20),AAHY01109106.1:1..1444,
CO   gap(1974),complement(AAHY01109107.1:1..3631),gap(20),
CO   complement(AAHY01109108.1:1..1275),gap(20),AAHY01109109.1:1..1093,gap(20),
CO   complement(AAHY01109110.1:1..7197),gap(20),
CO   complement(AAHY01109111.1:1..1628),gap(20),
CO   complement(AAHY01109112.1:1..1218),gap(20),
CO   complement(AAHY01109113.1:1..19445),gap(20),
CO   complement(AAHY01109114.1:1..1950),gap(20),
CO   complement(AAHY01109115.1:1..3392),gap(20),
CO   complement(AAHY01109116.1:1..5008),gap(20),
CO   complement(AAHY01109117.1:1..30026),gap(46),
CO   complement(AAHY01109118.1:1..24222),gap(20),AAHY01109119.1:1..1658,gap(20),
CO   AAHY01109120.1:1..1127,gap(20),complement(AAHY01109121.1:1..6802),gap(20),
CO   complement(AAHY01109122.1:1..15710),gap(607),
CO   complement(AAHY01109123.1:1..2848),gap(20),
CO   complement(AAHY01109124.1:1..60583),gap(281),
CO   complement(AAHY01109125.1:1..53340),gap(20),
CO   complement(AAHY01109126.1:1..111906),gap(20),
CO   complement(AAHY01109127.1:1..1433),gap(279),
CO   complement(AAHY01109128.1:1..7128),gap(446),
CO   complement(AAHY01109129.1:1..37015),gap(150),
CO   complement(AAHY01109130.1:1..44176),gap(132),
CO   complement(AAHY01109131.1:1..53698),gap(1832),AAHY01109132.1:1..739,
CO   gap(4174),complement(AAHY01109133.1:1..13151),gap(20),
CO   complement(AAHY01109134.1:1..109508),gap(20),AAHY01109135.1:1..1301,
CO   gap(250),complement(AAHY01109136.1:1..1405),gap(20),
CO   AAHY01109137.1:1..17351,gap(20),complement(AAHY01109138.1:1..3375),gap(20),
CO   complement(AAHY01109139.1:1..12374),gap(398),
CO   complement(AAHY01109140.1:1..730),gap(567),
CO   complement(AAHY01109141.1:1..4342),gap(135),
CO   complement(AAHY01109142.1:1..8293),gap(173),
CO   complement(AAHY01109143.1:1..10256),gap(20),
CO   complement(AAHY01109144.1:1..8566),gap(20),
CO   complement(AAHY01109145.1:1..4674),gap(916),
CO   complement(AAHY01109146.1:1..3423),gap(925),
CO   complement(AAHY01109147.1:1..6660),gap(28),
CO   complement(AAHY01109148.1:1..8678),gap(683),
CO   complement(AAHY01109149.1:1..13828),gap(251),
CO   complement(AAHY01109150.1:1..11724),gap(602),
CO   complement(AAHY01109151.1:1..3614),gap(20),
CO   complement(AAHY01109152.1:1..1157),gap(20),
CO   complement(AAHY01109153.1:1..26676),gap(441),
CO   complement(AAHY01109154.1:1..17728),gap(372),
CO   complement(AAHY01109155.1:1..16987),gap(430),
CO   complement(AAHY01109156.1:1..2614),gap(20),
CO   complement(AAHY01109157.1:1..23393),gap(20),
CO   complement(AAHY01109158.1:1..22289),gap(20),
CO   complement(AAHY01109159.1:1..9903),gap(20),
CO   complement(AAHY01109160.1:1..4953),gap(96),
CO   complement(AAHY01109161.1:1..2966),gap(20),
CO   complement(AAHY01109162.1:1..8057),gap(20),
CO   complement(AAHY01109163.1:1..9137),gap(20),
CO   complement(AAHY01109164.1:1..11231),gap(87),
CO   complement(AAHY01109165.1:1..17461),gap(282),
CO   complement(AAHY01109166.1:1..11716),gap(140),AAHY01109167.1:1..967,
CO   gap(658),complement(AAHY01109168.1:1..944),gap(211),
CO   complement(AAHY01109169.1:1..2032),gap(208),
CO   complement(AAHY01109170.1:1..4605),gap(22),
CO   complement(AAHY01109171.1:1..10945),gap(343),
CO   complement(AAHY01109172.1:1..4820),gap(20),
CO   complement(AAHY01109173.1:1..1183),gap(355),AAHY01109174.1:1..1050,gap(82),
CO   complement(AAHY01109175.1:1..2094),gap(20),
CO   complement(AAHY01109176.1:1..9618),gap(20),
CO   complement(AAHY01109177.1:1..10079),gap(20),
CO   complement(AAHY01109178.1:1..4458),gap(532),AAHY01109179.1:1..10270,
CO   gap(20),complement(AAHY01109180.1:1..13924),gap(95),
CO   complement(AAHY01109181.1:1..69557),gap(20),
CO   complement(AAHY01109182.1:1..17819),gap(20),
CO   complement(AAHY01109183.1:1..34813),gap(4151),
CO   complement(AAHY01109184.1:1..3698),gap(20),
CO   complement(AAHY01109185.1:1..8063),gap(395),
CO   complement(AAHY01109186.1:1..15332),gap(20),
CO   complement(AAHY01109187.1:1..12899),gap(20),AAHY01109188.1:1..8075,
CO   gap(176),AAHY01109189.1:1..18001,gap(212),
CO   complement(AAHY01109190.1:1..11717),gap(261),
CO   complement(AAHY01109191.1:1..4727),gap(246),
CO   complement(AAHY01109192.1:1..28805),gap(20),
CO   complement(AAHY01109193.1:1..12962),gap(20),
CO   complement(AAHY01109194.1:1..4845),gap(20),AAHY01109195.1:1..15942,gap(20),
CO   AAHY01109196.1:1..9623,gap(20),AAHY01109197.1:1..26317,gap(130),
CO   complement(AAHY01109198.1:1..7338),gap(85),AAHY01109199.1:1..27989,
CO   gap(121),complement(AAHY01109200.1:1..6645),gap(335),
CO   AAHY01109201.1:1..11958,gap(133),complement(AAHY01109202.1:1..48392),
CO   gap(949),complement(AAHY01109203.1:1..866),gap(452),AAHY01109204.1:1..2740,
CO   gap(802),complement(AAHY01109205.1:1..648),gap(367),
CO   complement(AAHY01109206.1:1..11765),gap(20),AAHY01109207.1:1..2451,gap(20),
CO   complement(AAHY01109208.1:1..49107),gap(123),AAHY01109209.1:1..9832,
CO   gap(158),AAHY01109210.1:1..7898,gap(1903),
CO   complement(AAHY01109211.1:1..1657),gap(20),AAHY01109212.1:1..1004,gap(20),
CO   complement(AAHY01109213.1:1..10530),gap(20),AAHY01109214.1:1..21805,
CO   gap(47),complement(AAHY01109215.1:1..8530),gap(20),
CO   complement(AAHY01109216.1:1..1080),gap(133),
CO   complement(AAHY01109217.1:1..1406),gap(513),
CO   complement(AAHY01109218.1:1..10766),gap(20),
CO   complement(AAHY01109219.1:1..2887),gap(32),AAHY01109220.1:1..56339,
CO   gap(194),complement(AAHY01109221.1:1..6143),gap(579),
CO   AAHY01109222.1:1..8687,gap(48),AAHY01109223.1:1..1311,gap(20),
CO   complement(AAHY01109224.1:1..13496),gap(35),
CO   complement(AAHY01109225.1:1..13673),gap(20),
CO   complement(AAHY01109226.1:1..9741),gap(32),
CO   complement(AAHY01109227.1:1..37718),gap(286),
CO   complement(AAHY01109228.1:1..39565),gap(72),
CO   complement(AAHY01109229.1:1..39500),gap(34),AAHY01109230.1:1..26234,
CO   gap(447),AAHY01109231.1:1..5725,gap(25),AAHY01109232.1:1..2905,gap(20),
CO   AAHY01109233.1:1..9883,gap(101),complement(AAHY01109234.1:1..894),gap(150),
CO   AAHY01109235.1:1..4705,gap(105),complement(AAHY01109236.1:1..11754),
CO   gap(139),AAHY01109237.1:1..3936,gap(105),
CO   complement(AAHY01109238.1:1..69762),gap(20),
CO   complement(AAHY01109239.1:1..8866),gap(20),AAHY01109240.1:1..1257,gap(20),
CO   complement(AAHY01109241.1:1..1960),gap(294),AAHY01109242.1:1..1214,
CO   gap(277),complement(AAHY01109243.1:1..2735),gap(20),
CO   complement(AAHY01109244.1:1..4254),gap(20),
CO   complement(AAHY01109245.1:1..1112),gap(422),AAHY01109246.1:1..1958,
CO   gap(1166),complement(AAHY01109247.1:1..8592),gap(132),
CO   AAHY01109248.1:1..5827,gap(20),AAHY01109249.1:1..5379,gap(20),
CO   complement(AAHY01109250.1:1..9896),gap(310),
CO   complement(AAHY01109251.1:1..10794),gap(87),AAHY01109252.1:1..1327,gap(20),
CO   complement(AAHY01109253.1:1..9844),gap(20),
CO   complement(AAHY01109254.1:1..2754),gap(628),
CO   complement(AAHY01109255.1:1..4061),gap(20),AAHY01109256.1:1..5862,gap(20),
CO   AAHY01109257.1:1..4787,gap(57),complement(AAHY01109258.1:1..5052),gap(20),
CO   complement(AAHY01109259.1:1..34161),gap(1298),
CO   complement(AAHY01109260.1:1..1971),gap(92),
CO   complement(AAHY01109261.1:1..5308),gap(294),
CO   complement(AAHY01109262.1:1..3305),gap(475),
CO   complement(AAHY01109263.1:1..1646),gap(1314),
CO   complement(AAHY01109264.1:1..49323),gap(132),AAHY01109265.1:1..4481,
CO   gap(20),complement(AAHY01109266.1:1..15259),gap(20),
CO   complement(AAHY01109267.1:1..8093),gap(85),
CO   complement(AAHY01109268.1:1..4328),gap(123),AAHY01109269.1:1..2992,gap(87),
CO   complement(AAHY01109270.1:1..58619),gap(20),AAHY01109271.1:1..1510,gap(83),
CO   AAHY01109272.1:1..20405,gap(20),AAHY01109273.1:1..3655,gap(162),
CO   complement(AAHY01109274.1:1..41444),gap(418),
CO   complement(AAHY01109275.1:1..1586),gap(20),AAHY01109276.1:1..1929,
CO   gap(14480),complement(AAHY01109277.1:1..1269),gap(20),
CO   complement(AAHY01109278.1:1..15908),gap(155),
CO   complement(AAHY01109279.1:1..3382),gap(531),
CO   complement(AAHY01109280.1:1..8055),gap(27),
CO   complement(AAHY01109281.1:1..4744),gap(255),
CO   complement(AAHY01109282.1:1..9801),gap(200),
CO   complement(AAHY01109283.1:1..9233),gap(123),AAHY01109284.1:1..3020,
CO   gap(196),complement(AAHY01109285.1:1..508),gap(635),
CO   complement(AAHY01109286.1:1..7958),gap(108),AAHY01109287.1:1..1088,
CO   gap(191),complement(AAHY01109288.1:1..24750),gap(167),
CO   complement(AAHY01109289.1:1..11873),gap(835),
CO   complement(AAHY01109290.1:1..2384),gap(20),AAHY01109291.1:1..2248,gap(623),
CO   AAHY01109292.1:1..11438,gap(20),complement(AAHY01109293.1:1..29429),
CO   gap(20),complement(AAHY01109294.1:1..5216),gap(20),
CO   complement(AAHY01109295.1:1..8489),gap(145),
CO   complement(AAHY01109296.1:1..44215),gap(20),
CO   complement(AAHY01109297.1:1..8254),gap(195),
CO   complement(AAHY01109298.1:1..22791),gap(306),
CO   complement(AAHY01109299.1:1..3758),gap(20),AAHY01109300.1:1..4084,gap(20),
CO   complement(AAHY01109301.1:1..5473),gap(260),
CO   complement(AAHY01109302.1:1..19860),gap(20),AAHY01109303.1:1..28044,
CO   gap(688),AAHY01109304.1:1..15412,gap(20),AAHY01109305.1:1..5680,gap(428),
CO   AAHY01109306.1:1..6767,gap(152),complement(AAHY01109307.1:1..7053),gap(20),
CO   AAHY01109308.1:1..16647,gap(855),complement(AAHY01109309.1:1..4466),
CO   gap(20),AAHY01109310.1:1..11495,gap(327),AAHY01109311.1:1..3011,gap(20),
CO   complement(AAHY01109312.1:1..10489),gap(20),
CO   complement(AAHY01109313.1:1..24375),gap(160),
CO   complement(AAHY01109314.1:1..17322),gap(2071),AAHY01109315.1:1..1946,
CO   gap(208),complement(AAHY01109316.1:1..16201),gap(1217),
CO   complement(AAHY01109317.1:1..10328),gap(20),
CO   complement(AAHY01109318.1:1..1822),gap(20),
CO   complement(AAHY01109319.1:1..2395),gap(20),
CO   complement(AAHY01109320.1:1..6652),gap(3440),
CO   complement(AAHY01109321.1:1..1549),gap(20),
CO   complement(AAHY01109322.1:1..1293),gap(20),
CO   complement(AAHY01109323.1:1..1244),gap(20),
CO   complement(AAHY01109324.1:1..3368),gap(20),AAHY01109325.1:1..27838,gap(20),
CO   complement(AAHY01109326.1:1..6093),gap(20),
CO   complement(AAHY01109327.1:1..6455),gap(66),
CO   complement(AAHY01109328.1:1..24100),gap(20),AAHY01109329.1:1..27304,
CO   gap(20),complement(AAHY01109330.1:1..11937),gap(46),AAHY01109331.1:1..3811,
CO   gap(20),complement(AAHY01109332.1:1..5157),gap(20),
CO   complement(AAHY01109333.1:1..22855),gap(66),
CO   complement(AAHY01109334.1:1..40367),gap(20),
CO   complement(AAHY01109335.1:1..53223),gap(74),
CO   complement(AAHY01109336.1:1..11696),gap(20),
CO   complement(AAHY01109337.1:1..1706),gap(20),
CO   complement(AAHY01109338.1:1..20570),gap(20),
CO   complement(AAHY01109339.1:1..51485),gap(63),AAHY01109340.1:1..22794,
CO   gap(330),AAHY01109341.1:1..5098,gap(20),AAHY01109342.1:1..12467,gap(125),
CO   complement(AAHY01109343.1:1..38421),gap(240),
CO   complement(AAHY01109344.1:1..5523),gap(295),
CO   complement(AAHY01109345.1:1..1756),gap(20),
CO   complement(AAHY01109346.1:1..1926),gap(3477),AAHY01109347.1:1..7520,
CO   gap(20),complement(AAHY01109348.1:1..1304),gap(20),
CO   complement(AAHY01109349.1:1..13130),gap(20),AAHY01109350.1:1..20070,
CO   gap(20),complement(AAHY01109351.1:1..9846),gap(20),
CO   complement(AAHY01109352.1:1..9832),gap(459),
CO   complement(AAHY01109353.1:1..949),gap(20),AAHY01109354.1:1..20281,gap(20),
CO   complement(AAHY01109355.1:1..1571),gap(20),AAHY01109356.1:1..1850,gap(144),
CO   complement(AAHY01109357.1:1..23363),gap(815),
CO   complement(AAHY01109358.1:1..4152),gap(20),
CO   complement(AAHY01109359.1:1..1185),gap(20),AAHY01109360.1:1..1125,gap(623),
CO   complement(AAHY01109361.1:1..3263),gap(20),AAHY01109362.1:1..3138,gap(88),
CO   complement(AAHY01109363.1:1..13817),gap(20),
CO   complement(AAHY01109364.1:1..10269),gap(63),
CO   complement(AAHY01109365.1:1..14495),gap(20),
CO   complement(AAHY01109366.1:1..4193),gap(20),
CO   complement(AAHY01109367.1:1..42043),gap(20),AAHY01109368.1:1..5011,gap(20),
CO   AAHY01109369.1:1..12478,gap(998),complement(AAHY01109370.1:1..2162),
CO   gap(710),complement(AAHY01109371.1:1..27939),gap(20),
CO   complement(AAHY01109372.1:1..4860),gap(695),
CO   complement(AAHY01109373.1:1..7056),gap(365),
CO   complement(AAHY01109374.1:1..13050),gap(168),
CO   complement(AAHY01109375.1:1..31022),gap(20),
CO   complement(AAHY01109376.1:1..2677),gap(312),
CO   complement(AAHY01109377.1:1..511),gap(1592),AAHY01109378.1:1..10581,
CO   gap(20),complement(AAHY01109379.1:1..5975),gap(20),
CO   complement(AAHY01109380.1:1..7102),gap(20),AAHY01109381.1:1..1187,gap(20),
CO   AAHY01109382.1:1..2127,gap(219),complement(AAHY01109383.1:1..1921),
CO   gap(905),complement(AAHY01109384.1:1..2232),gap(20),
CO   complement(AAHY01109385.1:1..12746),gap(68),
CO   complement(AAHY01109386.1:1..17915),gap(20),
CO   complement(AAHY01109387.1:1..38874),gap(432),
CO   complement(AAHY01109388.1:1..9460),gap(378),
CO   complement(AAHY01109389.1:1..31161),gap(20),
CO   complement(AAHY01109390.1:1..28489),gap(20),
CO   complement(AAHY01109391.1:1..5229),gap(273),
CO   complement(AAHY01109392.1:1..72362),gap(482),AAHY01109393.1:1..926,
CO   gap(1862),complement(AAHY01109394.1:1..826),gap(1142),
CO   complement(AAHY01109395.1:1..84153),gap(20),
CO   complement(AAHY01109396.1:1..1319),gap(20),
CO   complement(AAHY01109397.1:1..29073),gap(4006),
CO   complement(AAHY01109398.1:1..4543),gap(8106),
CO   complement(AAHY01109399.1:1..11104),gap(20),AAHY01109400.1:1..296,gap(20),
CO   complement(AAHY01109401.1:1..29454),gap(20),
CO   complement(AAHY01109402.1:1..8395),gap(20),
CO   complement(AAHY01109403.1:1..1790),gap(20),
CO   complement(AAHY01109404.1:1..608),gap(20),
CO   complement(AAHY01109405.1:1..5124),gap(20),
CO   complement(AAHY01109406.1:1..10330),gap(20),
CO   complement(AAHY01109407.1:1..19396),gap(20),
CO   complement(AAHY01109408.1:1..10385),gap(1198),AAHY01109409.1:1..6726,
CO   gap(3668),complement(AAHY01109410.1:1..109548),gap(73),
CO   AAHY01109411.1:1..16345,gap(1318),AAHY01109412.1:1..16642,gap(68),
CO   complement(AAHY01109413.1:1..14807),gap(4395),
CO   complement(AAHY01109414.1:1..10115),gap(45),AAHY01109415.1:1..10190,
CO   gap(113),AAHY01109416.1:1..35355,gap(153),AAHY01109417.1:1..11874,gap(118),
CO   AAHY01109418.1:1..1825,gap(20),AAHY01109419.1:1..7733,gap(145),
CO   complement(AAHY01109420.1:1..8300),gap(1410),
CO   complement(AAHY01109421.1:1..50159),gap(20),
CO   complement(AAHY01109422.1:1..10210),gap(36),AAHY01109423.1:1..7681,
CO   gap(209),complement(AAHY01109424.1:1..11360),gap(20),
CO   complement(AAHY01109425.1:1..24506),gap(20),
CO   complement(AAHY01109426.1:1..4688),gap(339),
CO   complement(AAHY01109427.1:1..70726),gap(152),
CO   complement(AAHY01109428.1:1..17078),gap(20),AAHY01109429.1:1..1070,gap(20),
CO   AAHY01109430.1:1..23416,gap(41),complement(AAHY01109431.1:1..9907),gap(20),
CO   AAHY01109432.1:1..6234,gap(152),complement(AAHY01109433.1:1..24084),
CO   gap(754),complement(AAHY01109434.1:1..2459),gap(63),
CO   complement(AAHY01109435.1:1..13201),gap(91),AAHY01109436.1:1..3999,
CO   gap(109),complement(AAHY01109437.1:1..24321),gap(20),
CO   complement(AAHY01109438.1:1..1513),gap(604),
CO   complement(AAHY01109439.1:1..2052),gap(20),
CO   complement(AAHY01109440.1:1..8420),gap(20),
CO   complement(AAHY01109441.1:1..1078),gap(20),AAHY01109442.1:1..23138,
CO   gap(105),complement(AAHY01109443.1:1..62959),gap(20),
CO   AAHY01109444.1:1..1687,gap(1031),complement(AAHY01109445.1:1..17062),
CO   gap(107),complement(AAHY01109446.1:1..2571),gap(90),
CO   complement(AAHY01109447.1:1..2294),gap(257),AAHY01109448.1:1..2148,
CO   gap(611),AAHY01109449.1:1..34442,gap(92),
CO   complement(AAHY01109450.1:1..17892),gap(20),AAHY01109451.1:1..15121,
CO   gap(54),complement(AAHY01109452.1:1..1980),gap(75),
CO   complement(AAHY01109453.1:1..3295),gap(20),
CO   complement(AAHY01109454.1:1..17984),gap(20),AAHY01109455.1:1..21077,
CO   gap(20),AAHY01109456.1:1..13098,gap(20),
CO   complement(AAHY01109457.1:1..19351),gap(102),AAHY01109458.1:1..46691,
CO   gap(20),AAHY01109459.1:1..22007,gap(108),AAHY01109460.1:1..3928,gap(60),
CO   complement(AAHY01109461.1:1..9128),gap(94),
CO   complement(AAHY01109462.1:1..5039),gap(20),
CO   complement(AAHY01109463.1:1..2122),gap(288),AAHY01109464.1:1..2148,gap(20),
CO   complement(AAHY01109465.1:1..7096),gap(411),
CO   complement(AAHY01109466.1:1..36640),gap(20),AAHY01109467.1:1..1422,
CO   gap(969),AAHY01109468.1:1..2697,gap(159),AAHY01109469.1:1..4293,gap(571),
CO   complement(AAHY01109470.1:1..4558),gap(20),
CO   complement(AAHY01109471.1:1..842),gap(103),AAHY01109472.1:1..5025,gap(82),
CO   complement(AAHY01109473.1:1..4272),gap(20),
CO   complement(AAHY01109474.1:1..40517),gap(20),
CO   complement(AAHY01109475.1:1..50257),gap(298),
CO   complement(AAHY01109476.1:1..23526),gap(20),
CO   complement(AAHY01109477.1:1..15815),gap(177),
CO   complement(AAHY01109478.1:1..13979),gap(593),
CO   complement(AAHY01109479.1:1..24257),gap(20),AAHY01109480.1:1..2632,
CO   gap(199),complement(AAHY01109481.1:1..1829),gap(25),
CO   complement(AAHY01109482.1:1..18072),gap(20),
CO   complement(AAHY01109483.1:1..5410),gap(470),
CO   complement(AAHY01109484.1:1..29155),gap(20),AAHY01109485.1:1..8046,
CO   gap(509),AAHY01109486.1:1..709,gap(1025),AAHY01109487.1:1..4588,gap(23),
CO   complement(AAHY01109488.1:1..13976),gap(75),
CO   complement(AAHY01109489.1:1..11853),gap(20),
CO   complement(AAHY01109490.1:1..50436),gap(34),
CO   complement(AAHY01109491.1:1..10428),gap(103),
CO   complement(AAHY01109492.1:1..10774),gap(20),
CO   complement(AAHY01109493.1:1..18278),gap(20),AAHY01109494.1:1..4067,gap(20),
CO   complement(AAHY01109495.1:1..4366),gap(38),
CO   complement(AAHY01109496.1:1..32385),gap(731),
CO   complement(AAHY01109497.1:1..19159),gap(144),AAHY01109498.1:1..80050,
CO   gap(283),complement(AAHY01109499.1:1..50311),gap(153),
CO   complement(AAHY01109500.1:1..22774),gap(405),
CO   complement(AAHY01109501.1:1..8790),gap(187),
CO   complement(AAHY01109502.1:1..7217),gap(20),AAHY01109503.1:1..29295,
CO   gap(138),complement(AAHY01109504.1:1..30766),gap(203),
CO   complement(AAHY01109505.1:1..3768),gap(20),
CO   complement(AAHY01109506.1:1..48563),gap(59),AAHY01109507.1:1..2787,
CO   gap(213),AAHY01109508.1:1..2718,gap(20),
CO   complement(AAHY01109509.1:1..52834),gap(32),AAHY01109510.1:1..4832,gap(81),
CO   complement(AAHY01109511.1:1..23812),gap(20),
CO   complement(AAHY01109512.1:1..37823),gap(150),
CO   complement(AAHY01109513.1:1..35329),gap(2286),AAHY01109514.1:1..14430,
CO   gap(20),complement(AAHY01109515.1:1..6917),gap(20),
CO   complement(AAHY01109516.1:1..18877),gap(493),
CO   complement(AAHY01109517.1:1..20627),gap(20),AAHY01109518.1:1..22488,
CO   gap(20),AAHY01109519.1:1..3659,gap(870),complement(AAHY01109520.1:1..8200),
CO   gap(20),complement(AAHY01109521.1:1..15651),gap(20),
CO   complement(AAHY01109522.1:1..5719),gap(801),
CO   complement(AAHY01109523.1:1..2145),gap(2546),AAHY01109524.1:1..738,
CO   gap(163),complement(AAHY01109525.1:1..31847),gap(20),
CO   complement(AAHY01109526.1:1..2854),gap(20),AAHY01109527.1:1..1101,gap(20),
CO   complement(AAHY01109528.1:1..8844),gap(20),AAHY01109529.1:1..4079,gap(20),
CO   AAHY01109530.1:1..31094,gap(20),AAHY01109531.1:1..17600,gap(20),
CO   AAHY01109532.1:1..1546,gap(20),complement(AAHY01109533.1:1..3694),gap(20),
CO   complement(AAHY01109534.1:1..1847),gap(599),
CO   complement(AAHY01109535.1:1..7828),gap(20),
CO   complement(AAHY01109536.1:1..42079),gap(232),
CO   complement(AAHY01109537.1:1..6770),gap(20),
CO   complement(AAHY01109538.1:1..13310),gap(144),
CO   complement(AAHY01109539.1:1..8243),gap(20),
CO   complement(AAHY01109540.1:1..6505),gap(505),
CO   complement(AAHY01109541.1:1..12653),gap(20),
CO   complement(AAHY01109542.1:1..2001),gap(199),
CO   complement(AAHY01109543.1:1..5526),gap(20),
CO   complement(AAHY01109544.1:1..1622),gap(20),AAHY01109545.1:1..11228,
CO   gap(284),AAHY01109546.1:1..8328,gap(103),AAHY01109547.1:1..9132,gap(20),
CO   AAHY01109548.1:1..13174,gap(65),AAHY01109549.1:1..15727,gap(60),
CO   complement(AAHY01109550.1:1..1852),gap(442),AAHY01109551.1:1..26097,
CO   gap(218),complement(AAHY01109552.1:1..5582),gap(213),
CO   complement(AAHY01109553.1:1..48915),gap(67),AAHY01109554.1:1..1591,
CO   gap(146),AAHY01109555.1:1..47292,gap(20),
CO   complement(AAHY01109556.1:1..8406),gap(20),AAHY01109557.1:1..6166,gap(278),
CO   complement(AAHY01109558.1:1..13518),gap(20),AAHY01109559.1:1..6584,
CO   gap(202),complement(AAHY01109560.1:1..12795),gap(190),
CO   complement(AAHY01109561.1:1..33892),gap(1062),
CO   complement(AAHY01109562.1:1..20432),gap(219),
CO   complement(AAHY01109563.1:1..19538),gap(20),
CO   complement(AAHY01109564.1:1..23269),gap(686),
CO   complement(AAHY01109565.1:1..1285),gap(3404),
CO   complement(AAHY01109566.1:1..5164),gap(20),AAHY01109567.1:1..1113,gap(20),
CO   complement(AAHY01109568.1:1..2056),gap(6410),
CO   complement(AAHY01109569.1:1..10346),gap(1139),
CO   complement(AAHY01109570.1:1..753),gap(570),
CO   complement(AAHY01109571.1:1..17475),gap(20),
CO   complement(AAHY01109572.1:1..13958),gap(20),
CO   complement(AAHY01109573.1:1..27682),gap(20),
CO   complement(AAHY01109574.1:1..2506),gap(20),
CO   complement(AAHY01109575.1:1..11896),gap(20),
CO   complement(AAHY01109576.1:1..1844),gap(203),
CO   complement(AAHY01109577.1:1..5875),gap(316),
CO   complement(AAHY01109578.1:1..23358),gap(6415),
CO   complement(AAHY01109579.1:1..3286),gap(20),
CO   complement(AAHY01109580.1:1..1420),gap(20),
CO   complement(AAHY01109581.1:1..48057),gap(20),
CO   complement(AAHY01109582.1:1..26734),gap(123),AAHY01109583.1:1..8281,
CO   gap(20),AAHY01109584.1:1..11915,gap(293),
CO   complement(AAHY01109585.1:1..2609),gap(158),AAHY01109586.1:1..22880,
CO   gap(20),complement(AAHY01109587.1:1..10978),gap(20),
CO   AAHY01109588.1:1..17546,gap(136),complement(AAHY01109589.1:1..11127),
CO   gap(282),complement(AAHY01109590.1:1..9372),gap(591),
CO   complement(AAHY01109591.1:1..39330),gap(134),AAHY01109592.1:1..1448,
CO   gap(63),complement(AAHY01109593.1:1..3100),gap(222),AAHY01109594.1:1..608,
CO   gap(93),AAHY01109595.1:1..31477,gap(45),complement(AAHY01109596.1:1..2931),
CO   gap(5533),complement(AAHY01109597.1:1..1999),gap(20),
CO   complement(AAHY01109598.1:1..1182),gap(20),
CO   complement(AAHY01109599.1:1..9798),gap(893),AAHY01109600.1:1..1604,
CO   gap(7233),complement(AAHY01109601.1:1..1738),gap(4369),
CO   complement(AAHY01109602.1:1..8661),gap(20),
CO   complement(AAHY01109603.1:1..1131),gap(20),AAHY01109604.1:1..8607,gap(111),
CO   complement(AAHY01109605.1:1..24847),gap(20),
CO   complement(AAHY01109606.1:1..1032),gap(20),AAHY01109607.1:1..9228,gap(20),
CO   AAHY01109608.1:1..36246,gap(20),complement(AAHY01109609.1:1..19010),
CO   gap(279),complement(AAHY01109610.1:1..7335),gap(20),
CO   complement(AAHY01109611.1:1..3335),gap(20),
CO   complement(AAHY01109612.1:1..4539),gap(1170),
CO   complement(AAHY01109613.1:1..23534),gap(309),
CO   complement(AAHY01109614.1:1..10882))
//