Dbfetch

ID   CH466565; SV 2; linear; genomic DNA; CON; MUS; 17151680 BP.
XX
AC   CH466565;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
XX
DE   Mus musculus 232000009739531 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-17151680
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-17151680
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-17151680
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; d6541bbeee48c0133f01f3a367ee2631.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000212.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000003032; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007613; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015242; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015243; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015247; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028307; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028310; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028312; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028314; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028318; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028327; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028328; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028329; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028330; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028334; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028344; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028345; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028348; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028381; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028417; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028463; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028464; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028469; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028470; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028478; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028479; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035637; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035649; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035696; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036052; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038544; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038668; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039634; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039653; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041333; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044801; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046450; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049648; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051593; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052117; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061455; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066196; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070979; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070980; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070999; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071000; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078689; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000089717; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000089945; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090053; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000110970; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000111611; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028210; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028217; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028218; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028223; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028225; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028226; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028227; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028230; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028231; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028232; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028233; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028236; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028237; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028239; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028251; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028253; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028254; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028259; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028267; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028271; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028274; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028277; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028281; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028283; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028284; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028288; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028290; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028291; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028292; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028293; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028294; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028296; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028297; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028298; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028302; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028306; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028307; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028309; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028317; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028320; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028325; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028334; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028339; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028342; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028166; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028173; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028174; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028179; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028181; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028182; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028183; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028184; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028187; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028188; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028189; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028190; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028193; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028194; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028196; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028210; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028212; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028213; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028218; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028226; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028230; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028234; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028237; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028241; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028243; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028244; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028248; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028250; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028252; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028253; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028254; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028255; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028257; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028258; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028259; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028263; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028267; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028268; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028270; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028281; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028286; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028295; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028300; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028303; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028118; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028125; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028126; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028131; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028133; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028134; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028135; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028136; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028139; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028140; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028141; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028142; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028145; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028146; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028148; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028160; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028162; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028163; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028168; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028176; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028180; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028183; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028186; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028190; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028192; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028193; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028197; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028199; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028201; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028202; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028203; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028204; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028206; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028207; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028208; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028212; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028216; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028217; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028219; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028227; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028230; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028235; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028244; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028249; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028186; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028193; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028194; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028199; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028201; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028202; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028203; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028204; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028207; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028208; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028209; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028210; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028213; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028214; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028216; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028230; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028232; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028233; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028238; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028246; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028250; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028253; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028256; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028260; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028262; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028263; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028267; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028269; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028271; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028272; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028273; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028274; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028276; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028277; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028278; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028282; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028286; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028287; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028289; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028297; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028298; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028300; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028305; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028314; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028319; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028322; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028323; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027908; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027915; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027916; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027921; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027923; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027924; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027925; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027926; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027929; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027930; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027931; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027932; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027935; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027936; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027938; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027951; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027953; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027954; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027959; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027967; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027971; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027974; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027977; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027981; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027983; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027984; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027988; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027990; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027992; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027993; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027994; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027995; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027997; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027998; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027999; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028003; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028007; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028008; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028010; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028018; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028021; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028026; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028035; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028040; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028611; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028627; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028634; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028635; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028640; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028642; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028643; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028644; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028645; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028648; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028649; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028650; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028651; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028654; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028655; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028657; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028671; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028673; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028674; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028679; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028687; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028691; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028694; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028697; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028701; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028703; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028704; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028708; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028711; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028712; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028713; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028714; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028715; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028717; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028718; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028719; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028723; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028727; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028728; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028730; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028738; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028741; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028746; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028755; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028760; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028763; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027332; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027348; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027349; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027355; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027356; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027361; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027363; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027365; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027368; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027369; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027370; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027371; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027374; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027375; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027377; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027390; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027392; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027393; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027398; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027406; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027410; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027416; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027420; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027422; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027423; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027427; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027429; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027430; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027431; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027432; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027433; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027435; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027436; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027437; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027441; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027445; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027446; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027448; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027456; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027459; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027464; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027473; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027478; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027874; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027881; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027882; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027887; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027889; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027890; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027891; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027892; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027895; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027896; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027897; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027898; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027901; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027902; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027904; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027917; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027919; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027920; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027925; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027933; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027937; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027940; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027943; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027947; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027949; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027950; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027954; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027956; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027957; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027958; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027959; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027960; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027962; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027963; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027964; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027968; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027972; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027973; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027975; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027983; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027986; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027991; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028000; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028005; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028023; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028030; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028031; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028036; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028038; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028039; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028040; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028041; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028044; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028045; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028046; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028047; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028050; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028051; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028053; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028067; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028069; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028070; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028075; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028083; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028087; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028090; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028093; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028097; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028099; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028100; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028104; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028106; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028107; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028108; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028109; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028110; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028112; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028113; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028114; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028118; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028122; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028123; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028125; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028133; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028136; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028141; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028155; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028160; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027990; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027997; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027998; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028003; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028005; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028006; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028007; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028008; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028011; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028012; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028013; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028014; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028017; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028018; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028020; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028034; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028036; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028037; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028042; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028050; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028054; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028057; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028060; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028064; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028066; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028067; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028071; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028073; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028074; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028075; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028076; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028077; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028079; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028080; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028081; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028085; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028089; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028090; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028092; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028100; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028103; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028108; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028117; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028122; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028122; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028129; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028130; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028135; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028137; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028138; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028139; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028140; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028143; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028144; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028145; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028146; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028149; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028150; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028152; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028166; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028168; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028169; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028174; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028182; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028186; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028189; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028192; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028196; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028198; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028199; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028203; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028205; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028206; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028207; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028208; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028209; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028211; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028212; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028213; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028217; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028221; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028222; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028224; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028235; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028240; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028249; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028254; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028014; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028021; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028022; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028027; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028029; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028030; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028031; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028032; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028035; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028036; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028037; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028038; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028041; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028042; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028044; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028058; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028060; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028061; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028066; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028074; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028078; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028081; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028084; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028088; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028090; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028091; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028095; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028097; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028098; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028099; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028100; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028101; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028103; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028104; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028105; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028109; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028113; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028114; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028116; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028127; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028132; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028141; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028146; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028149; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028663; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028670; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028671; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028676; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028678; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028679; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028680; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028681; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028684; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028685; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028686; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028687; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028690; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028691; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028693; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028706; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028708; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028709; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028714; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028722; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028726; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028729; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028732; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028736; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028738; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028739; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028743; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028746; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028748; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028749; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028750; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028751; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028753; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028754; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028755; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028759; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028763; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028764; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028766; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028774; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028775; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028777; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028782; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028791; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028796; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028799; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027058; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027074; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027081; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027082; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027087; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027089; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027092; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027093; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027094; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027095; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027098; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027100; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027102; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027115; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027117; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027118; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027123; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027131; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027135; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027138; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027141; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027145; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027148; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027152; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027154; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027155; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027156; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027157; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027158; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027160; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027161; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027162; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027166; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027170; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027171; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027173; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027181; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027184; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027189; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027198; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027203; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027428; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027435; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027436; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027441; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027443; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027446; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027447; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027448; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027449; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027452; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027453; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027455; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027468; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027470; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027471; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027476; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027484; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027488; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027491; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027494; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027498; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027500; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027501; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027505; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027507; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027508; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027509; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027510; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027511; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027513; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027514; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027515; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027519; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027524; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027526; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027534; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027537; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027542; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027551; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027556; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000007757; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015386; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015391; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029987; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030010; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030014; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030018; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030029; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030030; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030033; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030074; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030124; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030183; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030192; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037872; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043056; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045793; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051520; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051600; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053931; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055018; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055401; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058232; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075973; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084646; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095085; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095107; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095108; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098066; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102934; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102936; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107517; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107520; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107526; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107574; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107575; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107619; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107667; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107670; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107696; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107773; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107782; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107783; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107836; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107846; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107860; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107862; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107870; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107914; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117280; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133157; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142556; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164866; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188045; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213989; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214281; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215274; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215406; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215442; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217544; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065364; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065407; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065417; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065436; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065439; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065440; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065441; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065448; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065449; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065455; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065469; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065506; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065515; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065525; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065578; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065591; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065592; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065607; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065644; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065659; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065673; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065686; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065696; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065699; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065701; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065719; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065725; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065731; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065733; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065734; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065736; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065740; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065744; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065747; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065765; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065778; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065782; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065784; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065824; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065835; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065852; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065883; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065906; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065914; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0065412; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065454; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065464; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065483; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065486; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065487; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065488; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065489; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065496; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065497; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065503; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065517; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065554; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065563; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065571; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065633; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065646; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065647; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065663; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065699; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065714; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065729; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065744; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065752; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065755; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065757; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065775; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065780; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065786; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065788; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065789; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065791; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065795; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065799; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065802; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065819; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065832; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065835; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065837; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065888; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065905; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065936; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065960; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0065968; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0065309; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065351; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065361; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065380; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065383; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065384; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065385; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065386; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065393; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065394; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065400; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065414; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065451; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065460; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065469; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065522; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065535; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065536; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065552; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065588; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065603; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065616; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065631; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065640; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065643; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065645; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065663; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065669; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065675; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065677; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065678; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065680; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065684; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065688; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065691; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065708; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065720; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065723; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065725; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065766; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065778; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065795; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065826; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0065850; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065342; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065384; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065394; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065413; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065416; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065417; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065418; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065419; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065426; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065427; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065433; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065447; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065484; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065493; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065502; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065562; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065575; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065576; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065592; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065628; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065643; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065657; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065670; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065678; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065681; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065683; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065701; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065705; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065711; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065713; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065714; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065716; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065720; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065724; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065727; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065744; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065757; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065760; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065762; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065802; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065804; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065814; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065831; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065862; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065886; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065894; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065895; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065017; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065060; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065070; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065089; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065092; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065093; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065094; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065095; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065102; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065103; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065109; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065123; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065160; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065169; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065177; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065233; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065246; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065247; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065263; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065298; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065313; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065327; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065340; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065349; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065352; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065354; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065372; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065376; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065382; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065384; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065385; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065387; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065391; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065395; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065398; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065428; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065431; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065433; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065473; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065485; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065502; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065533; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065557; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065679; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065808; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065851; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065861; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065880; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065883; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065884; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065885; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065886; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065893; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065894; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065900; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065914; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065950; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065959; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065969; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066032; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066045; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066046; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066061; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066098; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066110; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066124; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066139; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066149; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066152; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066154; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066172; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066179; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066184; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066186; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066187; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066189; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066193; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066197; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066200; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066218; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066231; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066234; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066236; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066276; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066289; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066306; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066337; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066362; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066370; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065196; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065328; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065335; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065371; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065381; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065400; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065403; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065405; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065412; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065413; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065419; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065434; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065470; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065480; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065491; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065546; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065561; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065562; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065582; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065617; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065632; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065656; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065664; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065667; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065670; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065689; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065694; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065699; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065701; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065702; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065704; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065708; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065712; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065715; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065734; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065751; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065754; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065756; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065800; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065815; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065834; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065865; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065891; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0064962; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065004; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065014; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065033; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065036; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065037; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065038; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065039; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065046; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065047; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065053; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065067; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065104; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065113; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065122; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065180; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065193; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065194; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065210; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065245; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065260; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065274; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065287; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065296; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065299; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065301; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065319; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065325; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065330; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065332; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065333; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065335; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065339; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065343; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065346; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065363; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065376; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065379; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065381; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065421; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065432; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065449; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065480; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0065505; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0065095; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065137; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065147; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065166; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065169; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065170; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065171; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065172; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065179; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065180; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065186; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065200; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065237; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065246; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065256; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065313; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065326; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065327; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065343; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065380; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065395; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065409; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065422; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065431; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065434; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065436; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065454; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065460; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065465; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065467; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065468; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065470; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065474; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065478; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065481; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065498; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065511; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065514; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065516; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065556; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065568; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065585; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065616; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065640; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0065650; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0065023; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065065; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065075; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065094; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065097; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065098; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065099; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065100; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065107; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065108; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065114; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065128; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065165; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065174; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065183; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065242; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065255; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065256; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065272; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065306; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065321; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065335; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065348; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065357; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065360; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065362; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065380; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065386; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065391; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065393; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065394; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065396; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065400; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065404; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065407; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065424; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065437; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065440; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065442; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065482; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065494; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065511; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065542; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0065566; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0065197; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065239; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065249; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065268; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065271; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065272; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065273; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065274; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065282; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065283; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065289; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065303; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065340; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065349; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065357; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065417; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065431; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065432; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065447; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065484; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065499; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065513; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065526; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065533; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065536; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065538; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065556; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065561; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065566; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065568; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065569; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065571; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065575; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065579; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065582; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065601; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065613; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065616; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065618; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065668; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065685; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065716; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0065740; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065000; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065043; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065053; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065072; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065075; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065076; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065077; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065078; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065085; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065086; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065092; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065106; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065143; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065152; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065161; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065223; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065236; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065237; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065253; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065289; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065304; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065317; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065330; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065339; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065342; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065344; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065362; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065367; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065372; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065374; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065375; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065377; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065381; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065385; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065388; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065406; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065419; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065422; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065424; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065475; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065492; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065523; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065547; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065555; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065986; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066028; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066038; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066057; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066060; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066061; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066062; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066063; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066070; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066071; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066077; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066091; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066128; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066137; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066145; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066203; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066217; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066219; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066234; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066270; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066285; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066298; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066313; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066322; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066325; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066327; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066345; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066352; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066359; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066361; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066362; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066364; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066368; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066372; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066375; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066393; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066406; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066409; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066411; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066451; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066453; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066463; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066480; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066511; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066535; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066543; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064732; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064865; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064911; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064921; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064943; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064946; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064953; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064954; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064960; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064975; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065013; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065025; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065036; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065092; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065107; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065108; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065128; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065163; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065179; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065198; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065211; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065218; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065225; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065244; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065250; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065255; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065257; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065258; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065260; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065264; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065268; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065271; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065291; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065306; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065309; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065311; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065352; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065366; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065386; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065416; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065443; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064223; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064266; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064276; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064295; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064298; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064305; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064306; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064312; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064326; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064363; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064372; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064381; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064438; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064451; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064453; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064468; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064504; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064519; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064533; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064547; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064554; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064557; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064559; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064577; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064582; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064587; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064589; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064590; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064592; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064596; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064600; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064603; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064620; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064636; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064638; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064678; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064689; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064706; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064737; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064761; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70979073.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..17151680
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(3542..6658)
FT                   /locus_tag="mCG_1041302"
FT                   /note="gene_id=mCG1041302.1"
FT   mRNA            complement(join(3542..4459,4652..6658))
FT                   /locus_tag="mCG_1041302"
FT                   /product="mCG1041302"
FT                   /note="gene_id=mCG1041302.1 transcript_id=mCT159006.1
FT                   created on 03-OCT-2002"
FT   CDS             complement(join(4094..4459,4652..6583))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041302"
FT                   /product="mCG1041302"
FT                   /note="gene_id=mCG1041302.1 transcript_id=mCT159006.1
FT                   protein_id=mCP53625.1"
FT                   /protein_id="EDL02512.1"
FT                   /translation="MSKPSTDAQPSGVLSGLFLPKTPCKSAFPSSPTSLNGKTPCEREG
FT                   AQITVPFLSLAECEALERHLLKKQLSKLQWGLPALLLQNQRRMPCEALSEAKTVKTSLA
FT                   RKPFLHPTRDIFPEHAGRLLEFHLQKQLIHLRWGLPQRIQRCMNMLLSSTDPQSLPCGS
FT                   SSLTNVSISQPGKPEADGPGDMFLLTAGKGTIPMPHLFAKTREMLKSHVDSKCEQIQEG
FT                   KVPAQVWKSWECKIPGSLATVAPFPWIPQGQCRKLQAESKSDPDLLHKVVPWKPKTLSQ
FT                   ETQTLSGTLFEHCKKPQSLPKETIKKLETTLHHKYLAFLSGLPALYCVALSRPASPAVT
FT                   SQPRLREKMPKAVKSPSRALTQITPLESCTQDDSGVSADTAEEFQPGAEADGRTEKVPA
FT                   ESQPPPCRPYPINTHILAKLNFHLKKKILAMQFGISEKEKREHKELGTADLESESIQEF
FT                   LRSLHTSESTLLQEQPVACPSLPAPNAKGVHPKKQPASAVQDVCQAQRPPPSKAVPHSS
FT                   AQQSSKASHSQRDKIQVCVDTEAGGKRFNLEKSKVVGDLGEGDAGLGFSLVGQKTRQDE
FT                   EQEKRLLHRPLQGSSQQGHTFHLEDACPHSPWESPELQFPDPPPEVFMETDSEQDMDSQ
FT                   SEESIVPEPMKFFFHSINPKIKSKAHTEPSTVSTPGKVAKTSKENVERGLPQAKSPTKK
FT                   TKPEDSRGPKAQFSSSEKSVMASLLTAPHILDSKLRPRSRQLGSVSVLGNSRHCPRHCP
FT                   RLAYASHHRNLP"
FT   assembly_gap    20893..22023
FT                   /estimated_length=1131
FT                   /gap_type="unknown"
FT   assembly_gap    29280..29544
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    36266..36285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    58020..68197
FT                   /estimated_length=10178
FT                   /gap_type="unknown"
FT   assembly_gap    70693..70712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    72110..74118
FT                   /estimated_length=2009
FT                   /gap_type="unknown"
FT   assembly_gap    75605..75624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    78259..78278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(78378..84574)
FT                   /gene="BC049635"
FT                   /locus_tag="mCG_59488"
FT                   /note="gene_id=mCG59488.2"
FT   mRNA            complement(join(78378..79120,81873..82459,84362..84574))
FT                   /gene="BC049635"
FT                   /locus_tag="mCG_59488"
FT                   /product="cDNA sequence BC049635, transcript variant
FT                   mCT174085"
FT                   /note="gene_id=mCG59488.2 transcript_id=mCT174085.0 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(78378..79120,81873..82459,83376..83439,
FT                   83834..83879,84362..84543))
FT                   /gene="BC049635"
FT                   /locus_tag="mCG_59488"
FT                   /product="cDNA sequence BC049635, transcript variant
FT                   mCT174086"
FT                   /note="gene_id=mCG59488.2 transcript_id=mCT174086.0 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(78378..79120,81873..82459,83834..84060))
FT                   /gene="BC049635"
FT                   /locus_tag="mCG_59488"
FT                   /product="cDNA sequence BC049635, transcript variant
FT                   mCT59671"
FT                   /note="gene_id=mCG59488.2 transcript_id=mCT59671.2 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(78882..79120,81873..82459,83376..83439,
FT                   83834..83879,84362..84505))
FT                   /codon_start=1
FT                   /gene="BC049635"
FT                   /locus_tag="mCG_59488"
FT                   /product="cDNA sequence BC049635, isoform CRA_b"
FT                   /note="gene_id=mCG59488.2 transcript_id=mCT174086.0
FT                   protein_id=mCP97005.0 isoform=CRA_b"
FT                   /protein_id="EDL02510.1"
FT                   /translation="MMVPSFILWDVGSSVYTYGSLFIIALIIWHVRRSHRGLRLGPIKS
FT                   CTKCFRRIKQKPSDRTLRVKKRTTKEETEKLQKLLSNMKRQGWLPQEGSVRRLLCSDPS
FT                   CPICNAMALEIQQLLGVENKKTSSSLLRHSRSFSCLEALSPPKVLNDQSSELSKVLNGQ
FT                   SSELSKVLNDQSSELSKVLNDQSSELSSQHSKDISLPPKFMQSQSTDQKLTLSAPLSTG
FT                   NTVLQCYHPAPQQQPEPQGSNAFQDVSGLSSSSMDEHGVPANQQKKRKKTKKLVSKNQA
FT                   PSEAEMENKMTFFSHWVNPEVKCDRPEESFAFYKSETGAKPKTGEPKKSSAKVRAEEPN
FT                   LEKHAKDLKAKPLHAKRNI"
FT   CDS             complement(join(78882..79120,81873..82383))
FT                   /codon_start=1
FT                   /gene="BC049635"
FT                   /locus_tag="mCG_59488"
FT                   /product="cDNA sequence BC049635, isoform CRA_c"
FT                   /note="gene_id=mCG59488.2 transcript_id=mCT59671.2
FT                   protein_id=mCP42281.2 isoform=CRA_c"
FT                   /protein_id="EDL02511.1"
FT                   /translation="MALEIQQLLGVENKKTSSSLLRHSRSFSCLEALSPPKVLNDQSSE
FT                   LSKVLNGQSSELSKVLNDQSSELSKVLNDQSSELSSQHSKDISLPPKFMQSQSTDQKLT
FT                   LSAPLSTGNTVLQCYHPAPQQQPEPQGSNAFQDVSGLSSSSMDEHGVPANQQKKRKKTK
FT                   KLVSKNQAPSEAEMENKMTFFSHWVNPEVKCDRPEESFAFYKSETGAKPKTGEPKKSSA
FT                   KVRAEEPNLEKHAKDLKAKPLHAKRNI"
FT   CDS             complement(join(82349..82459,84362..84505))
FT                   /codon_start=1
FT                   /gene="BC049635"
FT                   /locus_tag="mCG_59488"
FT                   /product="cDNA sequence BC049635, isoform CRA_a"
FT                   /note="gene_id=mCG59488.2 transcript_id=mCT174085.0
FT                   protein_id=mCP97004.0 isoform=CRA_a"
FT                   /protein_id="EDL02509.1"
FT                   /translation="MMVPSFILWDVGSSVYTYGSLFIIALIIWHVRRSHRGLRLGPIKS
FT                   CTKTGLAPSRRKCATTPVLRSILPHLQCHGSGNSAVAGG"
FT   assembly_gap    91943..92029
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   gene            complement(105272..>105666)
FT                   /locus_tag="mCG_64445"
FT                   /note="gene_id=mCG64445.1"
FT   mRNA            complement(105272..>105666)
FT                   /locus_tag="mCG_64445"
FT                   /product="mCG64445"
FT                   /note="gene_id=mCG64445.1 transcript_id=mCT64628.1 created
FT                   on 02-OCT-2002"
FT   CDS             complement(105379..105666)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64445"
FT                   /product="mCG64445"
FT                   /note="gene_id=mCG64445.1 transcript_id=mCT64628.1
FT                   protein_id=mCP42276.0"
FT                   /protein_id="EDL02508.1"
FT                   /translation="MFCISIVPCIYNEFCNHLLMLLLRSLVTWQHDYVLVSVIWKEPSC
FT                   CPAYHDRGIRNLIATLLLTVYFENPNNTNSSAVFRDLKHKGQLMNVTQAL"
FT   assembly_gap    127361..127570
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   gene            132672..150593
FT                   /gene="N28178"
FT                   /locus_tag="mCG_19289"
FT                   /note="gene_id=mCG19289.2"
FT   mRNA            join(132672..132804,143703..143754,143866..144084,
FT                   144720..144905,147928..148006,148260..148465,
FT                   148702..148862,149173..149268,149592..150593)
FT                   /gene="N28178"
FT                   /locus_tag="mCG_19289"
FT                   /product="expressed sequence N28178"
FT                   /note="gene_id=mCG19289.2 transcript_id=mCT18857.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(143707..143754,143866..144084,144720..144905,
FT                   147928..148006,148260..148465,148702..148862,
FT                   149173..149268,149592..149688)
FT                   /codon_start=1
FT                   /gene="N28178"
FT                   /locus_tag="mCG_19289"
FT                   /product="expressed sequence N28178"
FT                   /note="gene_id=mCG19289.2 transcript_id=mCT18857.2
FT                   protein_id=mCP22308.1"
FT                   /protein_id="EDL02507.1"
FT                   /translation="MGVLMSKRQTVEQVQKEVQEEKEAEASAPVVQEESSINRAAWERL
FT                   RDGRGVEPEEFDRTSRFTPPAFIRPTRKLDDDKPPDICLEPREPVVNDEMCDVCEVWTA
FT                   ESLFPCRVCTRVFHDGCLRRMGYLQGDSAVEVTEMAHTETGWSCYYCDNLNLLLTEEEM
FT                   YSLTETFQRCKVIPDCSLTLEDFVRYRHQAAKRGESSRALTDEQEEQAARQFAALDPEQ
FT                   RGHVEWSDFLSHESLLLLLQLRPQNSLLRLLTVKERERARATFLARGRGSTISEAECHH
FT                   ARHSWFCKRLTEAPSCSVSISHVGPIADSSPAASSSKSQEKALLPTEQESRYVDWPTFL
FT                   RENVIYILAARPNSGAIHLKPPG"
FT   gene            <160004..168865
FT                   /gene="Dnajb5"
FT                   /locus_tag="mCG_19260"
FT                   /note="gene_id=mCG19260.3"
FT   mRNA            join(<160004..160090,163227..163471,166609..167210,
FT                   167451..167727)
FT                   /gene="Dnajb5"
FT                   /locus_tag="mCG_19260"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 5,
FT                   transcript variant mCT189483"
FT                   /note="gene_id=mCG19260.3 transcript_id=mCT189483.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<160005..160090,163227..163471,166609..167210,
FT                   167451..167684)
FT                   /codon_start=1
FT                   /gene="Dnajb5"
FT                   /locus_tag="mCG_19260"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 5,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19260.3 transcript_id=mCT189483.0
FT                   protein_id=mCP110488.0 isoform=CRA_b"
FT                   /protein_id="EDL02504.1"
FT                   /translation="SRVEAAEPEPGEGAAADRRTAAAPAAPHRNKEPSTGPVAVMGKDY
FT                   YKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLY
FT                   DQYGEEGLKTGGGSSGGSGGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSG
FT                   FDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEI
FT                   YHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPAD
FT                   IVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGT
FT                   VKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS"
FT   mRNA            join(160061..160090,160885..161029,163227..163471,
FT                   166609..167210,167451..168865)
FT                   /gene="Dnajb5"
FT                   /locus_tag="mCG_19260"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 5,
FT                   transcript variant mCT18828"
FT                   /note="gene_id=mCG19260.3 transcript_id=mCT18828.2 created
FT                   on 17-JUL-2002"
FT   mRNA            join(<160437..163471,166609..167210,167451..168856)
FT                   /gene="Dnajb5"
FT                   /locus_tag="mCG_19260"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 5,
FT                   transcript variant mCT189485"
FT                   /note="gene_id=mCG19260.3 transcript_id=mCT189485.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<160497..160828,163227..163471,166609..167210,
FT                   167451..167812)
FT                   /gene="Dnajb5"
FT                   /locus_tag="mCG_19260"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 5,
FT                   transcript variant mCT189484"
FT                   /note="gene_id=mCG19260.3 transcript_id=mCT189484.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<160773..160828,163227..163471,166609..167210,
FT                   167451..167684)
FT                   /codon_start=1
FT                   /gene="Dnajb5"
FT                   /locus_tag="mCG_19260"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 5,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19260.3 transcript_id=mCT189484.0
FT                   protein_id=mCP110489.0 isoform=CRA_c"
FT                   /protein_id="EDL02505.1"
FT                   /translation="GGGFQSYSVPSRLRWSDQRNKEPSTGPVAVMGKDYYKILGIPSGA
FT                   NEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLYDQYGEEGLKT
FT                   GGGSSGGSGGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDE
FT                   DEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKI
FT                   TRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPH
FT                   AHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLP
FT                   FPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS"
FT   CDS             join(160962..161029,163227..163471,166609..167210,
FT                   167451..167684)
FT                   /codon_start=1
FT                   /gene="Dnajb5"
FT                   /locus_tag="mCG_19260"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 5,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19260.3 transcript_id=mCT18828.2
FT                   protein_id=mCP22306.2 isoform=CRA_a"
FT                   /db_xref="GOA:A2AG30"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:1930018"
FT                   /db_xref="UniProtKB/TrEMBL:A2AG30"
FT                   /protein_id="EDL02503.1"
FT                   /translation="MFKIQLEPLKLRAWTLNGFVKFRNKEPSTGPVAVMGKDYYKILGI
FT                   PSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLYDQYGEE
FT                   GLKTGGGSSGGSGGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDM
FT                   DVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTK
FT                   RMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLK
FT                   DKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRG
FT                   EGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS"
FT   CDS             join(<163189..163471,166609..167210,167451..167684)
FT                   /codon_start=1
FT                   /gene="Dnajb5"
FT                   /locus_tag="mCG_19260"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 5,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG19260.3 transcript_id=mCT189485.0
FT                   protein_id=mCP110490.0 isoform=CRA_d"
FT                   /protein_id="EDL02506.1"
FT                   /translation="RVGHQRLALGSFRNKEPSTGPVAVMGKDYYKILGIPSGANEDEIK
FT                   KAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLYDQYGEEGLKTGGGSSG
FT                   GSGGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFG
FT                   AFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLN
FT                   PDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRD
FT                   GTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPT
FT                   QRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS"
FT   gene            180402..>184677
FT                   /gene="1700022I11Rik"
FT                   /locus_tag="mCG_56575"
FT                   /note="gene_id=mCG56575.1"
FT   mRNA            join(180402..180666,181321..>184677)
FT                   /gene="1700022I11Rik"
FT                   /locus_tag="mCG_56575"
FT                   /product="RIKEN cDNA 1700022I11"
FT                   /note="gene_id=mCG56575.1 transcript_id=mCT56758.1 created
FT                   on 28-AUG-2002"
FT   CDS             join(180472..180666,181321..184677)
FT                   /codon_start=1
FT                   /gene="1700022I11Rik"
FT                   /locus_tag="mCG_56575"
FT                   /product="RIKEN cDNA 1700022I11"
FT                   /note="gene_id=mCG56575.1 transcript_id=mCT56758.1
FT                   protein_id=mCP42275.2"
FT                   /protein_id="EDL02502.1"
FT                   /translation="MGLLQGQLTHALACRHCSSITCLHSPGNLAILVLFMVWQIRRWWQ
FT                   LRGWQQLQPWCSGDKMTQGKGLQLLYHLAFFDCLWKQKSEEEEKEEKECLSLNPLKPYH
FT                   LSKDTPIGNGFSTAPPHPSCRSEGRPRATETQEQVLIQSPSPSRSFPTFQTLTNLPVRS
FT                   KRASGSSPQQTKLQLFSGLPSLYNESLKTIFLSSDGPSPLKLSICPSVFLNKVPFPPAY
FT                   NLLLPCYHSSTYYPTPEAHILEDLEEIAPGSQLVQSPPSPPIPLVSSNLKPLLKGYKRI
FT                   IPDTEVHTQWFTQNKEVPSVSENQGLYPQPELQKFRSSTFLYSSEVWRKRPGDLRLHQH
FT                   NPELPFAFLLYPFNPQEVLDRFEMPWRNMKQNEHPKASETAMPTASPLPISLTECQRVN
FT                   PTGDLSQVKTLCQTTVQKENLQIYELPISAPCQLTVPVTEGTGPPGTPPGYEAQWGILA
FT                   YKGIPQASDPLMPASCHPSGSLSKVKNVNPKERLSAPKDVRENLGYREHPHVSKSPVSA
FT                   PSPPLDTLSDYQRENPPEDGSGFKPQWECKETSGSPWASETPTLDFHVGFYEATPMCVP
FT                   LGSEAQLKGTPSTENLCVYADIVSSPSLPSVSLPDFAIMGPQRILLESKALWETKEQKK
FT                   HLWTSDSSCPHKTPLAPFIGPKRINTVDDVPRSEATGKNTDNTKKCSSSEPPFLNLNPS
FT                   PALVQQPLRVSPIENPLKSKAWCGHIQRKNNFLASELPAQSLSQHLLEPSPEGVLSDVE
FT                   PAGGFMKNKNHCVSASPVWECSPSPNSVLKFHISEPSGDQCNCTPKESVAEWTKDSWAN
FT                   ELPGSSFFSALSQEPHSETELVCRNVLEREASQGPNPPAVNPPQPTAWPIQPGLSEAKA
FT                   EAPSSQGEAVSEVSDHPVIHAWQWSRQLKLRLNKLQQSPTFKSPGSHHSFSSSPVLNLT
FT                   LESWGPSSCSQQMHPLSLHPCSSSSHPPKVQRAEALPVQAPHCLHSSSQPQAQASGRAE
FT                   QRSQKSKRLKRKAMVQIPSPGLGHVKADENCSGMGEPSDTGLLVSGKRQDKTLVLLSTQ
FT                   KRGSSRKSKAEKCGRTARLGSPTNTRENNPAQACRPAEASMPRFSRKFEHKAQSSPHSA
FT                   LAQQLLPNAAGPQDRPRTGLVAGETQNPCPFKCCPWIPTKQQLSSLSQEAPPTRGFQKL
FT                   IDKFLGVHRPLPTKSSP"
FT   gene            complement(190425..210919)
FT                   /gene="Vcp"
FT                   /locus_tag="mCG_19261"
FT                   /note="gene_id=mCG19261.2"
FT   mRNA            complement(join(190425..191095,191255..191409,
FT                   192992..193167,193298..193610,193825..194037,
FT                   194765..194887,194992..195156,195615..195727,
FT                   196393..196528,196607..196740,199124..199226,
FT                   201196..201327,203601..203731,204138..204280,
FT                   206350..206522,206686..206797,210616..210919))
FT                   /gene="Vcp"
FT                   /locus_tag="mCG_19261"
FT                   /product="valosin containing protein, transcript variant
FT                   mCT18829"
FT                   /note="gene_id=mCG19261.2 transcript_id=mCT18829.1 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(190425..191095,191255..191409,
FT                   192992..193147,193302..193610,193825..194037,
FT                   194765..194887,194992..195156,195615..195727,
FT                   196393..196528,196607..196740,199124..199226,
FT                   201196..201327,203601..203731,204138..204280,
FT                   206350..206522,206686..206797,210616..>210773))
FT                   /gene="Vcp"
FT                   /locus_tag="mCG_19261"
FT                   /product="valosin containing protein, transcript variant
FT                   mCT189486"
FT                   /note="gene_id=mCG19261.2 transcript_id=mCT189486.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(190990..191095,191255..191409,
FT                   192992..193147,193302..193610,193825..194037,
FT                   194765..194887,194992..195156,195615..195727,
FT                   196393..196528,196607..196740,199124..199226,
FT                   201196..201327,203601..203731,204138..204280,
FT                   206350..206522,206686..206797,210616..>210680))
FT                   /codon_start=1
FT                   /gene="Vcp"
FT                   /locus_tag="mCG_19261"
FT                   /product="valosin containing protein, isoform CRA_b"
FT                   /note="gene_id=mCG19261.2 transcript_id=mCT189486.0
FT                   protein_id=mCP110491.0 isoform=CRA_b"
FT                   /protein_id="EDL02501.1"
FT                   /translation="PLPSGRHSRRPGEARAMASGADSKGDDLSTAILKQKNRPNRLIVD
FT                   EAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVV
FT                   RNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIR
FT                   KGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDI
FT                   GGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAF
FT                   FFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRI
FT                   VSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQI
FT                   HTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVM
FT                   NSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPD
FT                   KFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR
FT                   EIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFI
FT                   IGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKM
FT                   TNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFE
FT                   EAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVY
FT                   TEDNDDDLYG"
FT   CDS             complement(join(190990..191095,191255..191409,
FT                   192992..193167,193298..193610,193825..194037,
FT                   194765..194887,194992..195156,195615..195727,
FT                   196393..196528,196607..196740,199124..199226,
FT                   201196..201327,203601..203731,204138..204280,
FT                   206350..206522,206686..206797,210616..210632))
FT                   /codon_start=1
FT                   /gene="Vcp"
FT                   /locus_tag="mCG_19261"
FT                   /product="valosin containing protein, isoform CRA_a"
FT                   /note="gene_id=mCG19261.2 transcript_id=mCT18829.1
FT                   protein_id=mCP22307.1 isoform=CRA_a"
FT                   /protein_id="EDL02500.1"
FT                   /translation="MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPK
FT                   MDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQP
FT                   CPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEF
FT                   KVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVEL
FT                   PLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGE
FT                   SESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAH
FT                   VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQV
FT                   ANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQ
FT                   SNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFY
FT                   GPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFF
FT                   DELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILR
FT                   PGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKAVLSCFLQDVDLEFLAKMTNGFSGAD
FT                   LTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARR
FT                   SVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDL
FT                   YG"
FT   gene            complement(212801..>220867)
FT                   /gene="Fancg"
FT                   /locus_tag="mCG_19291"
FT                   /note="gene_id=mCG19291.2"
FT   mRNA            complement(join(212801..213549,213684..213801,
FT                   214240..214389,215007..215053,215192..215481,
FT                   215659..215725,216902..217053,217190..217336,
FT                   217424..217843,219096..219298,219533..219664,
FT                   220086..220179,220381..220551,220635..>220867))
FT                   /gene="Fancg"
FT                   /locus_tag="mCG_19291"
FT                   /product="Fanconi anemia, complementation group G,
FT                   transcript variant mCT189515"
FT                   /note="gene_id=mCG19291.2 transcript_id=mCT189515.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(212801..213549,213684..213801,
FT                   214240..214389,215007..215053,215192..215456,
FT                   215655..215725,216902..217053,217190..217336,
FT                   217424..217554,217708..217843,219096..219298,
FT                   219533..219664,220086..220179,220381..220657))
FT                   /gene="Fancg"
FT                   /locus_tag="mCG_19291"
FT                   /product="Fanconi anemia, complementation group G,
FT                   transcript variant mCT18859"
FT                   /note="gene_id=mCG19291.2 transcript_id=mCT18859.2 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(213403..213549,213684..213801,
FT                   214240..214389,215007..215053,215192..215481,
FT                   215659..215725,216902..217053,217190..217336,
FT                   217424..217554,217708..217843,219096..219298,
FT                   219533..219664,220086..220179,220381..>220489))
FT                   /gene="Fancg"
FT                   /locus_tag="mCG_19291"
FT                   /product="Fanconi anemia, complementation group G,
FT                   transcript variant mCT189514"
FT                   /note="gene_id=mCG19291.2 transcript_id=mCT189514.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(213441..213549,213684..213801,
FT                   214240..214389,215007..215053,215192..215481,
FT                   215659..215725,216902..217053,217190..217336,
FT                   217424..217554,217708..217843,219096..219298,
FT                   219533..219664,220086..220179,220381..>220488))
FT                   /codon_start=1
FT                   /gene="Fancg"
FT                   /locus_tag="mCG_19291"
FT                   /product="Fanconi anemia, complementation group G, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19291.2 transcript_id=mCT189514.0
FT                   protein_id=mCP110498.0 isoform=CRA_b"
FT                   /protein_id="EDL02498.1"
FT                   /translation="TSATMSSQVIPALPKTFSSSLDLWREKNDQLVRQAKQLTRDSRPS
FT                   LRRQQSAQDTLEGLRELLLTLQGLPAAVPALPLELTVLCNCIILRASLVQAFTEDLTQD
FT                   LQRGLERVLEAQHHLEPKSQQGLKELWHSVLSASSLPPELLPALHCLASLQAVFWMSTD
FT                   HLEDLTLLLQTLNGSQTQSSEDLLLLLKSWSPPAEESPAPLILQDAESLRDVLLTAFAC
FT                   RQGFQELITGSLPHAQSNLHEAASGLCPPSVLVQVYTALGACLRKMGNPQRALLYLTEA
FT                   LKVGTTCALPLLEASRVYRQLGDRAAELESLELLVEALSATHSSETFKSLIEVELLLPQ
FT                   PDPASPLHCGTQSQAKHLLASRCLQTGRAEDAAEHYLDLLAMLLGGSETRFSPPTSSLG
FT                   PCIPELCLEAAAALIQAGRALDALTVCEELLNRTSSLLPKMSSLWENARKRAKELPCCP
FT                   VWVSATHLLQGQAWSQLKAQKEALSEFSQCLELLFRTLPEDKEQGSDCEQKCRSDVALK
FT                   QLRVAALISRGLEWVASGQDTKALSDFLLSVQICPGNRDGSFYLLQTLKRLDRKNEASA
FT                   FWREAHSQLPLEDAAGSLPLYLETCLSWIHPPNREAFLEEFGTSVLESCVL"
FT   CDS             complement(join(213441..213549,213684..213801,
FT                   214240..214389,215007..215053,215192..215456,
FT                   215655..215725,216902..217053,217190..217336,
FT                   217424..217554,217708..217843,219096..219298,
FT                   219533..219664,220086..220179,220381..220476))
FT                   /codon_start=1
FT                   /gene="Fancg"
FT                   /locus_tag="mCG_19291"
FT                   /product="Fanconi anemia, complementation group G, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19291.2 transcript_id=mCT18859.2
FT                   protein_id=mCP22311.2 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1926471"
FT                   /db_xref="UniProtKB/TrEMBL:A4QPC9"
FT                   /protein_id="EDL02497.1"
FT                   /translation="MSSQVIPALPKTFSSSLDLWREKNDQLVRQAKQLTRDSRPSLRRQ
FT                   QSAQDTLEGLRELLLTLQGLPAAVPALPLELTVLCNCIILRASLVQAFTEDLTQDLQRG
FT                   LERVLEAQHHLEPKSQQGLKELWHSVLSASSLPPELLPALHCLASLQAVFWMSTDHLED
FT                   LTLLLQTLNGSQTQSSEDLLLLLKSWSPPAEESPAPLILQDAESLRDVLLTAFACRQGF
FT                   QELITGSLPHAQSNLHEAASGLCPPSVLVQVYTALGACLRKMGNPQRALLYLTEALKVG
FT                   TTCALPLLEASRVYRQLGDRAAELESLELLVEALSATHSSETFKSLIEVELLLPQPDPA
FT                   SPLHCGTQSQAKHLLASRCLQTGRAEDAAEHYLDLLAMLLGGSETRVGPCIPELCLEAA
FT                   AALIQAGRALDALTVCEELLNRTSSLLPKMSSLWENARKRAKELPCCPVWVSATHLLQG
FT                   QAWSQLKAQKEALSEFSQCLELLFRTLPEDKEQGSDCEQKCRSDVALKQLRVAALISRG
FT                   LEWVASGQDTKALSDFLLSVQICPGNRDGSFYLLQTLKRLDRKNEASAFWREAHSQLPL
FT                   EDAAGSLPLYLETCLSWIHPPNREAFLEEFGTSVLESCVL"
FT   CDS             complement(join(213441..213549,213684..213801,
FT                   214240..214389,215007..215053,215192..215481,
FT                   215659..215725,216902..217053,217190..217336,
FT                   217424..>217591))
FT                   /codon_start=1
FT                   /gene="Fancg"
FT                   /locus_tag="mCG_19291"
FT                   /product="Fanconi anemia, complementation group G, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG19291.2 transcript_id=mCT189515.0
FT                   protein_id=mCP110499.0 isoform=CRA_c"
FT                   /protein_id="EDL02499.1"
FT                   /translation="IFFSKPVSWLSPGFQELITGSLPHAQSNLHEAASGLCPPSVLVQV
FT                   YTALGACLRKMGNPQRALLYLTEALKVGTTCALPLLEASRVYRQLGDRAAELESLELLV
FT                   EALSATHSSETFKSLIEVELLLPQPDPASPLHCGTQSQAKHLLASRCLQTGRAEDAAEH
FT                   YLDLLAMLLGGSETRFSPPTSSLGPCIPELCLEAAAALIQAGRALDALTVCEELLNRTS
FT                   SLLPKMSSLWENARKRAKELPCCPVWVSATHLLQGQAWSQLKAQKEALSEFSQCLELLF
FT                   RTLPEDKEQGSDCEQKCRSDVALKQLRVAALISRGLEWVASGQDTKALSDFLLSVQICP
FT                   GNRDGSFYLLQTLKRLDRKNEASAFWREAHSQLPLEDAAGSLPLYLETCLSWIHPPNRE
FT                   AFLEEFGTSVLESCVL"
FT   gene            complement(228010..236122)
FT                   /gene="Pigo"
FT                   /locus_tag="mCG_19263"
FT                   /note="gene_id=mCG19263.1"
FT   mRNA            complement(join(228010..228410,228520..228590,
FT                   229584..229807,230019..230225,230639..232166,
FT                   232383..232565,232981..233140,233736..233859,
FT                   234038..234181,234929..236122))
FT                   /gene="Pigo"
FT                   /locus_tag="mCG_19263"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class O, transcript variant mCT18831"
FT                   /note="gene_id=mCG19263.1 transcript_id=mCT18831.1 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(228010..228410,228520..228590,
FT                   229584..229807,230019..230153,230639..232166,
FT                   232383..232565,232981..233140,233736..233859,
FT                   234038..234181,234929..235440))
FT                   /gene="Pigo"
FT                   /locus_tag="mCG_19263"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class O, transcript variant mCT189492"
FT                   /note="gene_id=mCG19263.1 transcript_id=mCT189492.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(228281..228410,228520..228590,
FT                   229584..229807,230019..230225,230639..232166,
FT                   232383..232565,232981..233140,233736..233859,
FT                   234038..234181,234929..235463))
FT                   /codon_start=1
FT                   /gene="Pigo"
FT                   /locus_tag="mCG_19263"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class O, isoform CRA_a"
FT                   /note="gene_id=mCG19263.1 transcript_id=mCT18831.1
FT                   protein_id=mCP22310.1 isoform=CRA_a"
FT                   /protein_id="EDL02495.1"
FT                   /translation="MNILFSPRMRKVSVLLFLAWVCFLFYAGIALFTSGFLLTRLELTN
FT                   QSSCQELPGPGPLPWGSHGKPGACWMPSRFSRVVLVLIDALRFDFAQPQRSHVPGEPPV
FT                   SVPFLGKLGSLQRILESQPHHGRLYRSQVDPPTTTMQRLKALTTGSLPTFIDAGSNFAS
FT                   HAIVEDNVIQQLNSAGRRVVFMGDDTWRDLFPGAFSQAFFFSSFNVRDLHTVDNGILEH
FT                   LYPTLDGGSWDVLIAHFLGVDHCGHKHGPHHPEMAKKLSQMDQVIQGLIERLENDTLLV
FT                   VAGDHGMTMNGDHGGDSELEVSAALFLYSPTALFPSVPPEEPEVIPQVSLVPTLALLLG
FT                   LPIPFGNTGEVMAELFSGGSDSSHPHSSALAQVSALHINAQQVSRFLHTYSAATQDLQV
FT                   KELHRLQTLFSKASARYQHFLRDPQEAEAALSTLTAEFQQFLRGARALCIESWARFSLV
FT                   RMAGGAALLAAACLLCLLASQLAVAPGFLFRPLLLIPVGWGLTWTILYAGVSVTTGSKI
FT                   DLVVLGAVAAAGSLLPFLWKAWVSRGSKRPLAPLLPVPRPVLILLLIRLATFFSDSFVV
FT                   AEARATPFLLGSLVFFLVAQLHWEGQLLPPKPLTMSRLGSSAPTAPPRHSGAHALWLGI
FT                   GLLLFTRLAGLFHRCPEETPACRSSPWLSPLASMVGGRAKNLWYGACVGALVALLVVVR
FT                   LWLRRYGNLKSPEPPVLFVRWGMPLMVLGTAAYWALASGAEEAPPRLRALVAGASAVLP
FT                   RAVMGLAALGLVLLLWRPVTVLVKAGAATSRTRTILTPFSGPPTSQADLDYVVPQIYRH
FT                   MQEEFQGRLERTKAQGPITVAAYQLGSVYSAAMVTALLLLAFPLMLLHVERVSLVFLLL
FT                   FLQSFLLLHLLAAGTPVATPGPFTVLWQAVSAWVLLATQTFYSTGHQPVFSAIHWHAAF
FT                   VGFPDGHGSSTWLPALLVGANTFASHLLFAVGCPLLLLWPFLCERQGPKRRQPLPGSES
FT                   EARVRPEEEEELQEPLMEMRLRDAPNHFNAALLQLGLKYLFILGAQILACALAASILRR
FT                   HLMVWKVFAPKFIFEAVGFIVSSVGLLLGIALVMRVDVAVSSWFKKLVLAQQR"
FT   CDS             complement(join(228281..228410,228520..228590,
FT                   229584..229807,230019..230153,230639..232166,
FT                   232383..232565,232981..233140,233736..233859,
FT                   234038..234181,234929..235439))
FT                   /codon_start=1
FT                   /gene="Pigo"
FT                   /locus_tag="mCG_19263"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class O, isoform CRA_b"
FT                   /note="gene_id=mCG19263.1 transcript_id=mCT189492.0
FT                   protein_id=mCP110492.0 isoform=CRA_b"
FT                   /protein_id="EDL02496.1"
FT                   /translation="MRKVSVLLFLAWVCFLFYAGIALFTSGFLLTRLELTNQSSCQELP
FT                   GPGPLPWGSHGKPGACWMPSRFSRVVLVLIDALRFDFAQPQRSHVPGEPPVSVPFLGKL
FT                   GSLQRILESQPHHGRLYRSQVDPPTTTMQRLKALTTGSLPTFIDAGSNFASHAIVEDNV
FT                   IQQLNSAGRRVVFMGDDTWRDLFPGAFSQAFFFSSFNVRDLHTVDNGILEHLYPTLDGG
FT                   SWDVLIAHFLGVDHCGHKHGPHHPEMAKKLSQMDQVIQGLIERLENDTLLVVAGDHGMT
FT                   MNGDHGGDSELEVSAALFLYSPTALFPSVPPEEPEVIPQVSLVPTLALLLGLPIPFGNT
FT                   GEVMAELFSGGSDSSHPHSSALAQVSALHINAQQVSRFLHTYSAATQDLQVKELHRLQT
FT                   LFSKASARYQHFLRDPQEAEAALSTLTAEFQQFLRGARALCIESWARFSLVRMAGGAAL
FT                   LAAACLLCLLASQLAVAPGFLFRPLLLIPVGWGLTWTILYAGVSVTTGSKIDLVVLGAV
FT                   AAAGSLLPFLWKAWVSRGSKRPLAPLLPVPRPVLILLLIRLATFFSDSFVVAEARATPF
FT                   LLGSLVFFLVAQLHWEGQLLPPKPLTMSRLGSSAPTAPPRHSGAHALWLGIGLLLFTRL
FT                   AGLFHRCPEETPACRSSPWLSPLASMVGGRAKNLWYGACVGALVALLVVVRLWLRRYGN
FT                   LKSPEPPVLFVRWGMPLMVLGTAAYWALASGAEEAPPRLRALVAGASAVLPRAVMGLAA
FT                   LGLVLLLWRPVTVLVKAGAATSRTRTILTPFSGPPTSQADLDYVVPQIYRHMQEEFQGR
FT                   LERTKAQGPITVAAYQLGSVYSAAMVTALLLLAFPLMLLHVERVSLVFLLLFLQSFLLL
FT                   HLLAAGTPVATPGHQPVFSAIHWHAAFVGFPDGHGSSTWLPALLVGANTFASHLLFAVG
FT                   CPLLLLWPFLCERQGPKRRQPLPGSESEARVRPEEEEELQEPLMEMRLRDAPNHFNAAL
FT                   LQLGLKYLFILGAQILACALAASILRRHLMVWKVFAPKFIFEAVGFIVSSVGLLLGIAL
FT                   VMRVDVAVSSWFKKLVLAQQR"
FT   gene            complement(238060..241818)
FT                   /locus_tag="mCG_1040650"
FT                   /note="gene_id=mCG1040650.4"
FT   mRNA            complement(join(238060..238656,239301..239429,
FT                   239642..239721,239856..240000,240133..240267,
FT                   240412..240513,240603..240661,240799..240898,
FT                   241334..241471,241691..241818))
FT                   /locus_tag="mCG_1040650"
FT                   /product="mCG1040650"
FT                   /note="gene_id=mCG1040650.4 transcript_id=mCT125631.2
FT                   created on 24-MAR-2004"
FT   CDS             complement(join(238528..238656,239301..239429,
FT                   239642..239721,239856..240000,240133..240267,
FT                   240412..240513,240603..240661,240799..240898,
FT                   241334..241471,241691..241735))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1040650"
FT                   /product="mCG1040650"
FT                   /note="gene_id=mCG1040650.4 transcript_id=mCT125631.2
FT                   protein_id=mCP53361.2"
FT                   /protein_id="EDL02494.1"
FT                   /translation="MLARAARGTGALLLRGSVQASGRVPRRASSGLPRNTVILFVPQQE
FT                   AWVVERMGRFHRILEPGLNVLIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGV
FT                   LYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNANIVDAINQ
FT                   AADCWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKK
FT                   QAQILASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAGALTQHNGDAAASLTVAEQ
FT                   YVSAFSKLAKDSNTVLLPSNPSDVTSMVAQAMGVYGALTKAPVPGAQNSSQSRRDVQAT
FT                   DTSIEELGRVKLS"
FT   gene            complement(242778..>256643)
FT                   /gene="B230312A22Rik"
FT                   /locus_tag="mCG_140708"
FT                   /note="gene_id=mCG140708.2"
FT   mRNA            complement(join(242778..244057,244181..244356,
FT                   244454..244522,244745..244903,245028..245133,
FT                   246205..247173,247432..247575,256527..>256643))
FT                   /gene="B230312A22Rik"
FT                   /locus_tag="mCG_140708"
FT                   /product="RIKEN cDNA B230312A22, transcript variant
FT                   mCT189524"
FT                   /note="gene_id=mCG140708.2 transcript_id=mCT189524.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(242871..244057,244181..244356,
FT                   244454..244522,244745..244903,245028..245133,
FT                   245312..245370,246205..247173,247432..247575,
FT                   256527..256627))
FT                   /gene="B230312A22Rik"
FT                   /locus_tag="mCG_140708"
FT                   /product="RIKEN cDNA B230312A22, transcript variant
FT                   mCT170836"
FT                   /note="gene_id=mCG140708.2 transcript_id=mCT170836.1
FT                   created on 11-JUN-2003"
FT   mRNA            complement(join(242871..244057,244181..244356,
FT                   244454..244522,244745..244903,245028..245133,
FT                   245312..245370,246205..247173,247432..247575,
FT                   256071..256137))
FT                   /gene="B230312A22Rik"
FT                   /locus_tag="mCG_140708"
FT                   /product="RIKEN cDNA B230312A22, transcript variant
FT                   mCT170835"
FT                   /note="gene_id=mCG140708.2 transcript_id=mCT170835.1
FT                   created on 11-JUN-2003"
FT   mRNA            complement(join(242871..244057,244181..244356,
FT                   244454..244522,244745..244903,245028..245133,
FT                   245312..245370,246205..247173,247432..247575,
FT                   250178..250281,250637..250656))
FT                   /gene="B230312A22Rik"
FT                   /locus_tag="mCG_140708"
FT                   /product="RIKEN cDNA B230312A22, transcript variant
FT                   mCT170838"
FT                   /note="gene_id=mCG140708.2 transcript_id=mCT170838.1
FT                   created on 11-JUN-2003"
FT   mRNA            complement(join(242871..244057,244181..244356,
FT                   244454..244522,244745..244903,245028..245133,
FT                   245312..245370,246205..247173,247432..247575,
FT                   250329..250647))
FT                   /gene="B230312A22Rik"
FT                   /locus_tag="mCG_140708"
FT                   /product="RIKEN cDNA B230312A22, transcript variant
FT                   mCT161155"
FT                   /note="gene_id=mCG140708.2 transcript_id=mCT161155.3
FT                   created on 11-JUN-2003"
FT   mRNA            complement(join(242871..244057,244181..244356,
FT                   244454..244522,244745..244903,245028..245133,
FT                   245312..245370,246205..247173,247432..247575,
FT                   249596..249694))
FT                   /gene="B230312A22Rik"
FT                   /locus_tag="mCG_140708"
FT                   /product="RIKEN cDNA B230312A22, transcript variant
FT                   mCT170837"
FT                   /note="gene_id=mCG140708.2 transcript_id=mCT170837.1
FT                   created on 11-JUN-2003"
FT   CDS             complement(join(243904..244057,244181..244356,
FT                   244454..244522,244745..244903,245028..245133,
FT                   245312..245370,246205..247098))
FT                   /codon_start=1
FT                   /gene="B230312A22Rik"
FT                   /locus_tag="mCG_140708"
FT                   /product="RIKEN cDNA B230312A22, isoform CRA_a"
FT                   /note="gene_id=mCG140708.2 transcript_id=mCT161155.3
FT                   protein_id=mCP90148.3 isoform=CRA_a"
FT                   /protein_id="EDL02488.1"
FT                   /translation="MRHVQAELSPSSEPEAGPSQPPVRQGTLQGGLLMGYSPAGGATSP
FT                   GVYQVSIFSPSAGASEPPRALKRPAPPTEGPRELKRGPGLGAREGLPPEEPSTVGLLSP
FT                   EGLGLGLGVASQHFSHHGLCVVEHGGNTTSPWTSGTQSTPWLSSNASFNTLHTRDWAFP
FT                   DQGGQGCLGETPGPAPSGQLHTLDTDLHNLAQIGGKSPVARVGNGSNPWPRESHGTANG
FT                   HSPEHTPPGPGPPGPCPTKRRLLPAGETLDVSSEDEGPAPRRRRGTLGCPLAANSSDAK
FT                   ATPFWSHLLPGPKEPVLDPTDCSPMGRRLKGARRLKLSSLRTLRKGPGLLSPPSASPFP
FT                   TPAVSRTLLGNFEESLLRGRFAPSGHIEGFTAEIGASGSYCPQHVTLPVTVTFFDVSEQ
FT                   NAPAPFLGVVDLTPLGRKGYSVPKVGTIQVTLFNPNQTVVKMFLVTFDFSDMPAAHMTF
FT                   LRHRLFLVPVGEEGNASPTHRLLCYLLHLRFRSSRSGRLSLHGDIRLLFSRRSLELDTG
FT                   LPYELQAVTEAPHNPRYSPLP"
FT   CDS             complement(join(243904..244057,244181..244356,
FT                   244454..244522,244745..244903,245028..245133,
FT                   245312..245370,246205..247098))
FT                   /codon_start=1
FT                   /gene="B230312A22Rik"
FT                   /locus_tag="mCG_140708"
FT                   /product="RIKEN cDNA B230312A22, isoform CRA_a"
FT                   /note="gene_id=mCG140708.2 transcript_id=mCT170835.1
FT                   protein_id=mCP93753.1 isoform=CRA_a"
FT                   /protein_id="EDL02489.1"
FT                   /translation="MRHVQAELSPSSEPEAGPSQPPVRQGTLQGGLLMGYSPAGGATSP
FT                   GVYQVSIFSPSAGASEPPRALKRPAPPTEGPRELKRGPGLGAREGLPPEEPSTVGLLSP
FT                   EGLGLGLGVASQHFSHHGLCVVEHGGNTTSPWTSGTQSTPWLSSNASFNTLHTRDWAFP
FT                   DQGGQGCLGETPGPAPSGQLHTLDTDLHNLAQIGGKSPVARVGNGSNPWPRESHGTANG
FT                   HSPEHTPPGPGPPGPCPTKRRLLPAGETLDVSSEDEGPAPRRRRGTLGCPLAANSSDAK
FT                   ATPFWSHLLPGPKEPVLDPTDCSPMGRRLKGARRLKLSSLRTLRKGPGLLSPPSASPFP
FT                   TPAVSRTLLGNFEESLLRGRFAPSGHIEGFTAEIGASGSYCPQHVTLPVTVTFFDVSEQ
FT                   NAPAPFLGVVDLTPLGRKGYSVPKVGTIQVTLFNPNQTVVKMFLVTFDFSDMPAAHMTF
FT                   LRHRLFLVPVGEEGNASPTHRLLCYLLHLRFRSSRSGRLSLHGDIRLLFSRRSLELDTG
FT                   LPYELQAVTEAPHNPRYSPLP"
FT   CDS             complement(join(243904..244057,244181..244356,
FT                   244454..244522,244745..244903,245028..245133,
FT                   245312..245370,246205..247098))
FT                   /codon_start=1
FT                   /gene="B230312A22Rik"
FT                   /locus_tag="mCG_140708"
FT                   /product="RIKEN cDNA B230312A22, isoform CRA_a"
FT                   /note="gene_id=mCG140708.2 transcript_id=mCT170836.1
FT                   protein_id=mCP93754.1 isoform=CRA_a"
FT                   /protein_id="EDL02490.1"
FT                   /translation="MRHVQAELSPSSEPEAGPSQPPVRQGTLQGGLLMGYSPAGGATSP
FT                   GVYQVSIFSPSAGASEPPRALKRPAPPTEGPRELKRGPGLGAREGLPPEEPSTVGLLSP
FT                   EGLGLGLGVASQHFSHHGLCVVEHGGNTTSPWTSGTQSTPWLSSNASFNTLHTRDWAFP
FT                   DQGGQGCLGETPGPAPSGQLHTLDTDLHNLAQIGGKSPVARVGNGSNPWPRESHGTANG
FT                   HSPEHTPPGPGPPGPCPTKRRLLPAGETLDVSSEDEGPAPRRRRGTLGCPLAANSSDAK
FT                   ATPFWSHLLPGPKEPVLDPTDCSPMGRRLKGARRLKLSSLRTLRKGPGLLSPPSASPFP
FT                   TPAVSRTLLGNFEESLLRGRFAPSGHIEGFTAEIGASGSYCPQHVTLPVTVTFFDVSEQ
FT                   NAPAPFLGVVDLTPLGRKGYSVPKVGTIQVTLFNPNQTVVKMFLVTFDFSDMPAAHMTF
FT                   LRHRLFLVPVGEEGNASPTHRLLCYLLHLRFRSSRSGRLSLHGDIRLLFSRRSLELDTG
FT                   LPYELQAVTEAPHNPRYSPLP"
FT   CDS             complement(join(243904..244057,244181..244356,
FT                   244454..244522,244745..244903,245028..245133,
FT                   245312..245370,246205..247098))
FT                   /codon_start=1
FT                   /gene="B230312A22Rik"
FT                   /locus_tag="mCG_140708"
FT                   /product="RIKEN cDNA B230312A22, isoform CRA_a"
FT                   /note="gene_id=mCG140708.2 transcript_id=mCT170837.1
FT                   protein_id=mCP93755.1 isoform=CRA_a"
FT                   /protein_id="EDL02491.1"
FT                   /translation="MRHVQAELSPSSEPEAGPSQPPVRQGTLQGGLLMGYSPAGGATSP
FT                   GVYQVSIFSPSAGASEPPRALKRPAPPTEGPRELKRGPGLGAREGLPPEEPSTVGLLSP
FT                   EGLGLGLGVASQHFSHHGLCVVEHGGNTTSPWTSGTQSTPWLSSNASFNTLHTRDWAFP
FT                   DQGGQGCLGETPGPAPSGQLHTLDTDLHNLAQIGGKSPVARVGNGSNPWPRESHGTANG
FT                   HSPEHTPPGPGPPGPCPTKRRLLPAGETLDVSSEDEGPAPRRRRGTLGCPLAANSSDAK
FT                   ATPFWSHLLPGPKEPVLDPTDCSPMGRRLKGARRLKLSSLRTLRKGPGLLSPPSASPFP
FT                   TPAVSRTLLGNFEESLLRGRFAPSGHIEGFTAEIGASGSYCPQHVTLPVTVTFFDVSEQ
FT                   NAPAPFLGVVDLTPLGRKGYSVPKVGTIQVTLFNPNQTVVKMFLVTFDFSDMPAAHMTF
FT                   LRHRLFLVPVGEEGNASPTHRLLCYLLHLRFRSSRSGRLSLHGDIRLLFSRRSLELDTG
FT                   LPYELQAVTEAPHNPRYSPLP"
FT   CDS             complement(join(243904..244057,244181..244356,
FT                   244454..244522,244745..244903,245028..245133,
FT                   245312..245370,246205..247098))
FT                   /codon_start=1
FT                   /gene="B230312A22Rik"
FT                   /locus_tag="mCG_140708"
FT                   /product="RIKEN cDNA B230312A22, isoform CRA_a"
FT                   /note="gene_id=mCG140708.2 transcript_id=mCT170838.1
FT                   protein_id=mCP93752.1 isoform=CRA_a"
FT                   /protein_id="EDL02493.1"
FT                   /translation="MRHVQAELSPSSEPEAGPSQPPVRQGTLQGGLLMGYSPAGGATSP
FT                   GVYQVSIFSPSAGASEPPRALKRPAPPTEGPRELKRGPGLGAREGLPPEEPSTVGLLSP
FT                   EGLGLGLGVASQHFSHHGLCVVEHGGNTTSPWTSGTQSTPWLSSNASFNTLHTRDWAFP
FT                   DQGGQGCLGETPGPAPSGQLHTLDTDLHNLAQIGGKSPVARVGNGSNPWPRESHGTANG
FT                   HSPEHTPPGPGPPGPCPTKRRLLPAGETLDVSSEDEGPAPRRRRGTLGCPLAANSSDAK
FT                   ATPFWSHLLPGPKEPVLDPTDCSPMGRRLKGARRLKLSSLRTLRKGPGLLSPPSASPFP
FT                   TPAVSRTLLGNFEESLLRGRFAPSGHIEGFTAEIGASGSYCPQHVTLPVTVTFFDVSEQ
FT                   NAPAPFLGVVDLTPLGRKGYSVPKVGTIQVTLFNPNQTVVKMFLVTFDFSDMPAAHMTF
FT                   LRHRLFLVPVGEEGNASPTHRLLCYLLHLRFRSSRSGRLSLHGDIRLLFSRRSLELDTG
FT                   LPYELQAVTEAPHNPRYSPLP"
FT   CDS             complement(join(245029..245133,246205..>247113))
FT                   /codon_start=1
FT                   /gene="B230312A22Rik"
FT                   /locus_tag="mCG_140708"
FT                   /product="RIKEN cDNA B230312A22, isoform CRA_b"
FT                   /note="gene_id=mCG140708.2 transcript_id=mCT189524.0
FT                   protein_id=mCP110479.0 isoform=CRA_b"
FT                   /protein_id="EDL02492.1"
FT                   /translation="PKGGFMRHVQAELSPSSEPEAGPSQPPVRQGTLQGGLLMGYSPAG
FT                   GATSPGVYQVSIFSPSAGASEPPRALKRPAPPTEGPRELKRGPGLGAREGLPPEEPSTV
FT                   GLLSPEGLGLGLGVASQHFSHHGLCVVEHGGNTTSPWTSGTQSTPWLSSNASFNTLHTR
FT                   DWAFPDQGGQGCLGETPGPAPSGQLHTLDTDLHNLAQIGGKSPVARVGNGSNPWPRESH
FT                   GTANGHSPEHTPPGPGPPGPCPTKRRLLPAGETLDVSSEDEGPAPRRRRGTLGCPLAAN
FT                   SSDAKATPFWSHLLPGPKEPVLKLPSNSPEGARPAEPSQCLPLSHPCCQPDPAGQL"
FT   gene            256455..263549
FT                   /locus_tag="mCG_1041406"
FT                   /note="gene_id=mCG1041406.1"
FT   mRNA            join(256455..256700,261530..261670,263244..263350,
FT                   263453..263549)
FT                   /locus_tag="mCG_1041406"
FT                   /product="mCG1041406, transcript variant mCT174081"
FT                   /note="gene_id=mCG1041406.1 transcript_id=mCT174081.0
FT                   created on 02-OCT-2002"
FT   mRNA            join(256585..256666,261530..261670,263244..263350,
FT                   263453..263549)
FT                   /locus_tag="mCG_1041406"
FT                   /product="mCG1041406, transcript variant mCT159110"
FT                   /note="gene_id=mCG1041406.1 transcript_id=mCT159110.1
FT                   created on 02-OCT-2002"
FT   mRNA            join(256595..256700,261530..261670,263453..263537)
FT                   /locus_tag="mCG_1041406"
FT                   /product="mCG1041406, transcript variant mCT174082"
FT                   /note="gene_id=mCG1041406.1 transcript_id=mCT174082.0
FT                   created on 02-OCT-2002"
FT   CDS             join(261585..261670,263453..263516)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041406"
FT                   /product="mCG1041406, isoform CRA_b"
FT                   /note="gene_id=mCG1041406.1 transcript_id=mCT174082.0
FT                   protein_id=mCP97001.0 isoform=CRA_b"
FT                   /protein_id="EDL02487.1"
FT                   /translation="MADPLELELELELELELELELELELKLELLWTKQFPQASAMWPPC
FT                   HDGL"
FT   CDS             join(261585..261670,263244..263292)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041406"
FT                   /product="mCG1041406, isoform CRA_a"
FT                   /note="gene_id=mCG1041406.1 transcript_id=mCT159110.1
FT                   protein_id=mCP53637.1 isoform=CRA_a"
FT                   /protein_id="EDL02485.1"
FT                   /translation="MADPLELELELELELELELELELELKLELFELRPSGVAASRFTP"
FT   CDS             join(261585..261670,263244..263292)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041406"
FT                   /product="mCG1041406, isoform CRA_a"
FT                   /note="gene_id=mCG1041406.1 transcript_id=mCT174081.0
FT                   protein_id=mCP97000.0 isoform=CRA_a"
FT                   /protein_id="EDL02486.1"
FT                   /translation="MADPLELELELELELELELELELELKLELFELRPSGVAASRFTP"
FT   gene            269284..473672
FT                   /locus_tag="mCG_19267"
FT                   /note="gene_id=mCG19267.1"
FT   mRNA            join(269284..269603,299472..299501,302759..302858,
FT                   307415..307532,308563..308686,313500..313573,
FT                   326731..326788,373771..374005,388379..388693,
FT                   390820..390910,438921..438967,441333..441411,
FT                   443469..443543,443985..444204,445723..445950,
FT                   446500..446641,448100..448269,448649..448764,
FT                   449028..449191,449810..449960,452033..452101,
FT                   453496..453585,454262..454390,458257..458381,
FT                   459017..459102,464283..464409,464628..464724,
FT                   464936..465079,465582..465659,466082..466159,
FT                   466654..466742,466957..467109,467228..467351,
FT                   467458..467514,467675..467755,468268..468415,
FT                   470487..470579,471780..471939,472103..473672)
FT                   /locus_tag="mCG_19267"
FT                   /product="mCG19267"
FT                   /note="gene_id=mCG19267.1 transcript_id=mCT18835.1 created
FT                   on 17-JUL-2002"
FT   CDS             join(269582..269603,299472..299501,302759..302858,
FT                   307415..307532,308563..308686,313500..313573,
FT                   326731..326788,373771..374005,388379..388693,
FT                   390820..390910,438921..438967,441333..441411,
FT                   443469..443543,443985..444204,445723..445950,
FT                   446500..446641,448100..448269,448649..448764,
FT                   449028..449191,449810..449960,452033..452101,
FT                   453496..453585,454262..454390,458257..458381,
FT                   459017..459102,464283..464409,464628..464724,
FT                   464936..465079,465582..465659,466082..466159,
FT                   466654..466742,466957..467109,467228..467351,
FT                   467458..467514,467675..467755,468268..468415,
FT                   470487..470579,471780..471939,472103..472388)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19267"
FT                   /product="mCG19267"
FT                   /note="gene_id=mCG19267.1 transcript_id=mCT18835.1
FT                   protein_id=mCP22274.2"
FT                   /protein_id="EDL02484.1"
FT                   /translation="MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSW
FT                   EQDFMFEISRLDLGLSVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETL
FT                   MKDDEICGTKNPTPHKILLDTRFELPFDIPEEEARYWTYKLEQINALADDNEYSSQEES
FT                   QRKPLPTAAAQCSFEDPDSAVDDRDSDYRSETSNSAPPPYHTTTQPNASVHQFPVPVRL
FT                   PQQLFLQGSSHDSCNDSMQSYDLDYPERRALSPTSSSRYGSSCNVSQGSSLLSELDQYH
FT                   EQDDDGRERDSIHSSHSYGSLSKDGQAGLGEQEKALEVTCESEKEKTGESKEMRDDATI
FT                   HPPSDLVLHKDHVLGPQESLPEETASSPFTQARAHWFRAVTKVRLQLQEISDDGDPSLP
FT                   QWLPKGPAGGLYGIDSMPDLRRKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKS
FT                   HVYKKTLQALIYPISCTTPHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHE
FT                   KCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVS
FT                   KVAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKR
FT                   TKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTII
FT                   EVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHY
FT                   LTDIQGSGGVWIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKY
FT                   MCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRID
FT                   LSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNS
FT                   TYEYIFNNCHDLYSHQYQLQEQPLEEPGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVL
FT                   SQFPQELNVGKVSAEVMWHLFAQDMKYALEEHEKDRLCKSADYMNLHFKVKWLHNEYVR
FT                   DLPALQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCS
FT                   VVDVFTQLNQSFEIIRKLECPDPNILAHYMRRFAKTIGKVLMQYADILSKNFPAYCTKE
FT                   RLPCILMNNMQQLRVQLEKMFEAMGGKELDSEAADSLKELQVKLNTVLDELSMVFGNSF
FT                   QVRIDECVRQMADILGQVRGTGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCE
FT                   KTVLKRVLKELWRVVMNTMERVIVLPPLTDQTGTQLILTAAKELSQLSKLKDHMVREET
FT                   RNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIK
FT                   TFVRSQTAQGAGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFV
FT                   EVTMVGPHQSDKKRKFTTKSKSNNWTPKYNETFHFLLGNEEGPEAYELQICVKDYCFAR
FT                   EDRVIGLAVMPLRDVAAKGSCACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKL
FT                   KSESRSTEEGS"
FT   assembly_gap    285235..285254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    287226..287245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    310871..310890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    335224..335261
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    350811..350830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    352999..353018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    355669..355688
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    357561..357618
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    407753..407816
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    409400..409419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    412411..412430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    452416..452435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            475956..583004
FT                   /gene="4930417M19Rik"
FT                   /locus_tag="mCG_19279"
FT                   /note="gene_id=mCG19279.2"
FT   mRNA            join(475956..476040,480119..480162,500514..500588,
FT                   508039..508094,510107..510220,511188..511286,
FT                   513943..514004,517349..517421,517789..517859,
FT                   526419..526501,528238..528396,530487..530575,
FT                   539625..539821,547901..548109,559020..559178,
FT                   561063..561098,565268..565456,566689..566804,
FT                   571506..571670,573829..573940,575212..575317,
FT                   575562..575596,576304..576504,577647..577870,
FT                   579353..579436,580301..580546,580686..580824,
FT                   582079..582209,582306..582651,582671..583004)
FT                   /gene="4930417M19Rik"
FT                   /locus_tag="mCG_19279"
FT                   /product="RIKEN cDNA 4930417M19"
FT                   /note="gene_id=mCG19279.2 transcript_id=mCT18847.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(480135..480162,500514..500588,508039..508094,
FT                   510107..510220,511188..511286,513943..514004,
FT                   517349..517421,517789..517859,526419..526501,
FT                   528238..528396,530487..530575,539625..539821,
FT                   547901..548109,559020..559178,561063..561098,
FT                   565268..565456,566689..566804,571506..571670,
FT                   573829..573940,575212..575317,575562..575596,
FT                   576304..576504,577647..577870,579353..579436,
FT                   580301..580546,580686..580824,582079..582209,
FT                   582306..582491)
FT                   /codon_start=1
FT                   /gene="4930417M19Rik"
FT                   /locus_tag="mCG_19279"
FT                   /product="RIKEN cDNA 4930417M19"
FT                   /note="gene_id=mCG19279.2 transcript_id=mCT18847.2
FT                   protein_id=mCP22304.2"
FT                   /protein_id="EDL02483.1"
FT                   /translation="MKYVKAFVSEISWDCSWYCSAMQERRNEDRQKEEEERILQANNRR
FT                   FNSLFEYPDNSIKTSKYGFFNFLPMNLFEQFQRLANAYFLILLFLQLVPQISSLAWYTT
FT                   VIPLIVVLSITGVKDAIDDVKRHRSDQQINNRSVSILVNGRVEEIKWRNVQVGDIIKLE
FT                   NNHPVTADMLLLSSSEPYGLTYIETADLDGETNLKVKQAISVTSAMEDNLELLSSFNGE
FT                   VRCDPPNNKLDKFSGTLSYLGNTYLLNHERLLLRGCVIRNTDWCYGLVVYTGQDTKLMQ
FT                   NSGRSTFKRTHIDHLMNVLVVWIFMFLGGMCFLLSIGHGIWENSRGYYFQAFLPWKHYI
FT                   TSSATSSALIFWSYFIVLNTMVPISLYVSVEIIRLGNSYYINWDRKMFYAPKNMPAQAR
FT                   TTTLNEELGQVQYVFSDKTGTLTENVMIFNKCSINGKTYDKVDFSYNHLADPKFSFYDK
FT                   TLVEAVKSEDPLVYLFFLCLSLCHTVMSEEKVEGELVYQAQSPDEGELVYQAQSPDEGA
FT                   LVTATRNFGFVFCSRTPETITVIEMGKIRVYRLLAILDFSNERKRMSVIVRTPEDRVML
FT                   FCKGADTIIYELLHPSCASLSEVTMDHLDDFASEGLRTLMVAYRELDKAYFQTWIKKHG
FT                   EAWLTLENRERKLALVYEEIERDLMLLGATAIEDKLQRGVPETIVTLSKAKIKIWVLTG
FT                   DKQETAVNIAYSCRIFKDEMDGVFMVEGTDRETVLEELRSLGPSLSTFPLVCPGLQAYA
FT                   LEGSLEFELLRTACMCKGVVCCRMTPLQKAQVVDLVKRYKKVVTLAIGDGANDISMIKA
FT                   AHIGVGISNQEGMQATLSSDFSFCQFHFLQRLLLVHGRLSYNRMCKFLSYFFYKNFAFT
FT                   LVHFWYAFFNGFSAQTVYDIWFITFYNLIYTSLPVLGLSLFEKDVNETWSLCYPELYEP
FT                   GQHNLYFNKKEFVKCLLHGIYNSFVLFFVPMGTVFNSERNDGKDISDFQSFSLLVQTTL
FT                   IGVMTMQIALRTTSWTMINHTFTWGSLGLYFCILILLCSDGLCLRYPSIFNFLGVARNS
FT                   LSQPQIWLCLILSTILCMIPLIGYNFLRPLLWPINADKVLNRIHFCLKHPIPTQVQTKI
FT                   KHPSLRRSAYAFSHKQGFGALITSGKTLKSSALAKSKRFL"
FT   assembly_gap    490565..490584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    507065..507084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    516919..516938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    529408..529671
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    535341..535457
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    539438..539457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    559857..559876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    561284..561303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    583768..583787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    584922..584941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    586379..586398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    612137..612156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            617843..638189
FT                   /gene="Rusc2"
FT                   /locus_tag="mCG_141252"
FT                   /note="gene_id=mCG141252.0"
FT   mRNA            join(617843..617878,625786..627876,632767..633411,
FT                   633603..633788,633881..634021,634837..634913,
FT                   635082..635256,635346..635451,636060..636106,
FT                   636459..637290,637390..637527,637610..638189)
FT                   /gene="Rusc2"
FT                   /locus_tag="mCG_141252"
FT                   /product="RUN and SH3 domain containing 2"
FT                   /note="gene_id=mCG141252.0 transcript_id=mCT174087.0
FT                   created on 01-OCT-2002"
FT   CDS             join(625854..627876,632767..633411,633603..633788,
FT                   633881..634021,634837..634913,635082..635256,
FT                   635346..635451,636060..636106,636459..637290,
FT                   637390..637527,637610..637811)
FT                   /codon_start=1
FT                   /gene="Rusc2"
FT                   /locus_tag="mCG_141252"
FT                   /product="RUN and SH3 domain containing 2"
FT                   /note="gene_id=mCG141252.0 transcript_id=mCT174087.0
FT                   protein_id=mCP97006.0"
FT                   /protein_id="EDL02482.1"
FT                   /translation="MPLLELSRMDSPPKLTGETLIVHHIPLVHCQVPDRQCCGGAGGGG
FT                   GGTRANPFCPPELGLTQPDHDLGQADSLLYPSLHSAPGAPTGSSDSVKSRSRDGRGPGA
FT                   PKRHNPFLVQEGVGETGLGDLHDSSTGDSVTQQSFHLHSASQPFHLSSFQLPPSGPGQG
FT                   RPWGATHSRPGVVEGQEQDPATALGTQCSTSHCCRPELEAERMELDECGGHGGSGSGGG
FT                   TSDISGFSFEQEWKISSDESPRHPGRSGSGTQHCHCSSTSSQSEAADQSMGYVSDSSCN
FT                   SSDGVLVTFSTLYNKMHGSSRANLNSVPQSCSDSSFCSHADPGAFYLDLQPSPAESRMS
FT                   CESHHPENGDREEGCGCPHVSSPELDANCNAYRPHSEPCPAVADLTACFQSQARLVVAT
FT                   QNYYKLVTCDLSSQSSPSPAGSSITSCSEEHTKISPPPGPCSDPDPNQPSEYYLFQKPD
FT                   IQPEEQEAVGSPAEAATAMGPTVLEGQVYTNTSPPNLNTGRQRSRSYDRSLERSPPVRL
FT                   GSLERMLSCPVRLSEGPAALAGPASPPRRVTSFAELAKGRKKAAGSGSPPLRASVGDSS
FT                   QEFSPIQEAQQDRAAPLDEGTRCSHSLPSLPLGPSLDLLGPEPWSTPVCQGSQSSEMPL
FT                   PSLRAAGQGPLAQLMDPGPAFSGSPATSHTQRDARARADGGGTESRPVLRYSKEQRPTT
FT                   LPIQPFVFQHHFPKQLAKARALHSLSQLYSLSMPCSRAQQPAPLVISTAQGPAPAPSGE
FT                   PQPFTSQASGRGARNAGPEPETSRPSPLGSYSPVRSAGPFGSSTDSSASTSCSPPPEQG
FT                   TAADSVSPWSHTCPPTVRPATSQQPPKEDQKIPTLAEYRLHGTGSLPPLGSWRSGFTRA
FT                   ESLVRGGGEGSMANRPNNANHLSPQALKWREYRRKNPLGPPGLSGSLDRRPPEARLARR
FT                   NPIFEFPGSFGTTSHLNCRLNGQISKPLSLTCPDLQDPFSLTEKPPAEFCLSPDGNSEA
FT                   ISIDILQKKGLVKAVNTAVDLIVAHFGTSRDPGVKAKLGNSSVSPNVGHLVLKYLCPAV
FT                   QAVLEDGLKAFVLDVIIGQRKNMPWSVVEASTQLGPSTKVLHGLYNKVSQFPELTSHTM
FT                   RFNAFILGLLNIRSLEFWFNHLYNHEDIIQTHYQPWGFLRAAHTVCPGLFEELLLLLQP
FT                   LALLPFSLDLLFQHRLLQSGRQQRQHKELLRVSQDLLLSAHSTLQLARSRGQEGPGDMD
FT                   RVAPGERVKGVGASEGGEEDEEDAEEVAVVAGSSDHGKWARGGQAGWWYQLMQSSQVYI
FT                   DGTAEGSRFPRSSSSSSGSGSEKKKGVGSGGPSQAPPPPPREGVVEGAEACPAPEEALG
FT                   QERGWPFWMGSPPDSVLAELRRSREREGPVAPPTENEEGTAEPSPGGIKWGHLFGSRKS
FT                   QREARPTNRLPSDWLSLDKSVFQLVAQTMGARREPEPRENLQESHPPAVPSKPPCEVQA
FT                   LCHHLATGPGQLSFHKGDILRVLGPARGDWLRCSRGPDTGLVPLAYVTLTPTPSSPPGS
FT                   SQN"
FT   gene            complement(638180..>640255)
FT                   /gene="4833436C18Rik"
FT                   /locus_tag="mCG_19288"
FT                   /note="gene_id=mCG19288.3"
FT   mRNA            complement(join(638180..639001,639135..639331,
FT                   639405..639628,640190..>640255))
FT                   /gene="4833436C18Rik"
FT                   /locus_tag="mCG_19288"
FT                   /product="RIKEN cDNA 4833436C18"
FT                   /note="gene_id=mCG19288.3 transcript_id=mCT18856.3 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(638345..639001,639135..639331,
FT                   639405..639628,640190..>640230))
FT                   /codon_start=1
FT                   /gene="4833436C18Rik"
FT                   /locus_tag="mCG_19288"
FT                   /product="RIKEN cDNA 4833436C18"
FT                   /note="gene_id=mCG19288.3 transcript_id=mCT18856.3
FT                   protein_id=mCP22275.3"
FT                   /protein_id="EDL02481.1"
FT                   /translation="IPGLSGENPHYIPGYTGHCPLLRFSMGQTYGQVTGQLLRGPPGLA
FT                   WPPAHRTLLPPIQSPRSPVISKGRLPPRRGHERLSSSIIPGYTGFIPRAQFIFAKNCNQ
FT                   VWAEAMSEFTRRHGEQESHQLPDGAKGEREVEEDQLREAEEPPLKQELAHASPYSMDDT
FT                   DPHKFFMSGERKWVATKGEGRPQDVLTQHLPHPQVSRAMCPVPASSLAPASLCLPTRHC
FT                   RNLGRCAHGAGRTRTPNLSPHFPGPRFRIWVSYLTTEATCQVRRAREGLRELRCVCGWG
FT                   VLWQRELTDTERCPTLGFSFREETLRQFSGELGADFKGQFGGSTQLAFSCLWLYTCQTL
FT                   GHAGYKFQFGGTFGHLTHDALGLSITQKQLPA"
FT   assembly_gap    640256..640649
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    643178..643309
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    644626..645172
FT                   /estimated_length=547
FT                   /gap_type="unknown"
FT   assembly_gap    647817..647836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    650140..650159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    653209..653228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <657371..662011
FT                   /gene="Tesk1"
FT                   /locus_tag="mCG_19271"
FT                   /note="gene_id=mCG19271.2"
FT   mRNA            join(<657371..657574,657719..657840,657968..658016,
FT                   658510..658656,658978..659060,659198..659311,
FT                   659460..659543,659666..659755,659876..660005,
FT                   660551..662011)
FT                   /gene="Tesk1"
FT                   /locus_tag="mCG_19271"
FT                   /product="testis specific protein kinase 1, transcript
FT                   variant mCT18841"
FT                   /note="gene_id=mCG19271.2 transcript_id=mCT18841.2 created
FT                   on 12-JUL-2002"
FT   mRNA            join(<657371..657574,657719..657840,657968..658016,
FT                   658510..658656,658978..659065,659226..659311,
FT                   659460..659543,659666..659755,659876..660005,
FT                   660551..>661434)
FT                   /gene="Tesk1"
FT                   /locus_tag="mCG_19271"
FT                   /product="testis specific protein kinase 1, transcript
FT                   variant mCT189511"
FT                   /note="gene_id=mCG19271.2 transcript_id=mCT189511.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(657371..657574,657719..657840,657968..658016,
FT                   658510..658656,658978..659060,659198..659311,
FT                   659460..659543,659666..659755,659876..659993)
FT                   /codon_start=1
FT                   /gene="Tesk1"
FT                   /locus_tag="mCG_19271"
FT                   /product="testis specific protein kinase 1, isoform CRA_a"
FT                   /note="gene_id=mCG19271.2 transcript_id=mCT18841.2
FT                   protein_id=mCP22289.2 isoform=CRA_a"
FT                   /protein_id="EDL02479.1"
FT                   /translation="MAGERPPLRGPGPGEAPGEGPGGAGGGPGRGRPSSYRALRSAVSS
FT                   LARVDDFDCAEKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRSNTLREVQLMNRLRH
FT                   PNILRFMGVCVHQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIAQGLRYLHA
FT                   KGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEKIPVYRCDHPASAGKGQGRSPWLWWA
FT                   PRTGWLQRCCGESCMMRRPMSSPSGSSSVSSSPECLQTLTTYPALRTLAWMCLLSELWW
FT                   EMTVRYLSCFWPSTAAAWNPAPGPLLLKSPSTWNRSWSSSLRPRPSPSHPSPRLP"
FT   CDS             join(<659065..659065,659226..659311,659460..659543,
FT                   659666..659755,659876..660005,660551..661434)
FT                   /codon_start=1
FT                   /gene="Tesk1"
FT                   /locus_tag="mCG_19271"
FT                   /product="testis specific protein kinase 1, isoform CRA_b"
FT                   /note="gene_id=mCG19271.2 transcript_id=mCT189511.0
FT                   protein_id=mCP110493.0 isoform=CRA_b"
FT                   /protein_id="EDL02480.1"
FT                   /translation="GTRKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIAR
FT                   VPADPDYLPRTEDFGLDVPAFRTLVGNDCPLPFLLLAIHCCSMEPSTRAPFTEITQHLE
FT                   QILEQQPEATPLAKPPLTKAPLTYNQGSVPRGGPSATLPRPDPRLSRSRSDLFLPPSPE
FT                   SPPSWGDNLTRVNPFSLREDLRGGKIKLLDTPCKPATPLPLVPPSPLTSTQLPLVTTPD
FT                   ILVQPETPVRRCRSLPSSPELPRRMETALPGPGPSPMGPTEERMDCEGSSPEPEPPGLA
FT                   PQLPLAVATDNFISTCSSASQPWSPRSGPPLNNNPPAVVVNSPQGWAREPWNRAQHSLP
FT                   RAAALERTEPSPPPSAPREPEEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEA
FT                   GSLLCHRGHHAKPPTPSLQLPGARS"
FT   gene            complement(661672..668504)
FT                   /gene="Cd72"
FT                   /locus_tag="mCG_19287"
FT                   /note="gene_id=mCG19287.2"
FT   mRNA            complement(join(661672..661973,662197..662352,
FT                   663390..663466,663993..664144,666228..666560,
FT                   667003..667092,667561..667632,668162..668269,
FT                   668366..668483))
FT                   /gene="Cd72"
FT                   /locus_tag="mCG_19287"
FT                   /product="CD72 antigen, transcript variant mCT18854"
FT                   /note="gene_id=mCG19287.2 transcript_id=mCT18854.1 created
FT                   on 12-JUL-2002"
FT   mRNA            complement(join(661676..661973,662197..662331,
FT                   663390..663466,663993..664144,666228..666560,
FT                   667003..667092,667561..667632,668162..668269,
FT                   668366..668504))
FT                   /gene="Cd72"
FT                   /locus_tag="mCG_19287"
FT                   /product="CD72 antigen, transcript variant mCT170618"
FT                   /note="gene_id=mCG19287.2 transcript_id=mCT170618.0 created
FT                   on 12-JUL-2002"
FT   CDS             complement(join(662202..662331,663390..663466,
FT                   663993..664144,666228..666560,667003..667092,
FT                   667561..667632,668162..668269,668366..668447))
FT                   /codon_start=1
FT                   /gene="Cd72"
FT                   /locus_tag="mCG_19287"
FT                   /product="CD72 antigen, isoform CRA_a"
FT                   /note="gene_id=mCG19287.2 transcript_id=mCT170618.0
FT                   protein_id=mCP93536.0 isoform=CRA_a"
FT                   /protein_id="EDL02477.1"
FT                   /translation="MADAITYADLRFVKVPLKNSASNHLGQDCEAYEDGELTYENVQVS
FT                   PVPGGPPGLASPALADKAGVGSEQPTATWSSVKSSALRQIPRCPTVCLQNFLLGLLLSC
FT                   LMLGVAVICLGVRYLQVSQQFQEGTRIWEATNSSLQQQLREKISQLGQKEVELQESQKE
FT                   LISSQDTLQEKQRTHKDTEQQLQACQAERAKTKENLKTEEERRRDLDQRLTSTRETLRR
FT                   LSSCSSDTCCPCGWIPYQERCFYISHTLRSLEESQKYCTSLSSKLAAFDEPSKYYYEVS
FT                   LPSGLEELLDRSKSYWIQMSKKWSRYCDKIKKYYQKWKRTFSECAELHPCICESEAFRF
FT                   PDGIHLN"
FT   CDS             complement(join(662202..662352,663390..663466,
FT                   663993..664144,666228..666560,667003..667092,
FT                   667561..667632,668162..668269,668366..668447))
FT                   /codon_start=1
FT                   /gene="Cd72"
FT                   /locus_tag="mCG_19287"
FT                   /product="CD72 antigen, isoform CRA_b"
FT                   /note="gene_id=mCG19287.2 transcript_id=mCT18854.1
FT                   protein_id=mCP22301.2 isoform=CRA_b"
FT                   /protein_id="EDL02478.1"
FT                   /translation="MADAITYADLRFVKVPLKNSASNHLGQDCEAYEDGELTYENVQVS
FT                   PVPGGPPGLASPALADKAGVGSEQPTATWSSVKSSALRQIPRCPTVCLQNFLLGLLLSC
FT                   LMLGVAVICLGVRYLQVSQQFQEGTRIWEATNSSLQQQLREKISQLGQKEVELQESQKE
FT                   LISSQDTLQEKQRTHKDTEQQLQACQAERAKTKENLKTEEERRRDLDQRLTSTRETLRR
FT                   LSSCSSDTCCPCGWIPYQERCFYISHTLRSLEESQKYCTSLSSKLAAFDEPSKYYYEVS
FT                   LPSGLEELLDRSKSYWIQMSKKWRHDYDSQSRYCDKIKKYYQKWKRTFSECAELHPCIC
FT                   ESEAFRFPDGIHLN"
FT   assembly_gap    673872..674036
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    678556..678811
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    691792..694254
FT                   /estimated_length=2463
FT                   /gap_type="unknown"
FT   gene            complement(696274..697876)
FT                   /gene="Sit1"
FT                   /locus_tag="mCG_19264"
FT                   /note="gene_id=mCG19264.1"
FT   mRNA            complement(join(696274..697039,697130..697194,
FT                   697321..697379,697469..697607,697729..697876))
FT                   /gene="Sit1"
FT                   /locus_tag="mCG_19264"
FT                   /product="suppression inducing transmembrane adaptor 1"
FT                   /note="gene_id=mCG19264.1 transcript_id=mCT18832.1 created
FT                   on 12-JUL-2002"
FT   CDS             complement(join(696806..697039,697130..697194,
FT                   697321..697379,697469..697607,697729..697774))
FT                   /codon_start=1
FT                   /gene="Sit1"
FT                   /locus_tag="mCG_19264"
FT                   /product="suppression inducing transmembrane adaptor 1"
FT                   /note="gene_id=mCG19264.1 transcript_id=mCT18832.1
FT                   protein_id=mCP22283.1"
FT                   /protein_id="EDL02476.1"
FT                   /translation="MSRDYNCTTDDQLAWGIPSISHAWGLWALLGVVTVLLLISLAALL
FT                   SQWTRGRRRNQEGQGPLSGRSAEEVPLYGNLHYLQTGRLSQEPRSEEQDPPSSGGLARG
FT                   AEEAMCYTSLQLRPAQGRIPSSGNPIKYCEVVLDSEPKPQAPGPEPELYASVCAQTRRG
FT                   RASFPDQAYANSQPAPS"
FT   assembly_gap    701944..701963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    703741..703813
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    705638..706025
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   gene            707689..710248
FT                   /locus_tag="mCG_19278"
FT                   /note="gene_id=mCG19278.1"
FT   mRNA            join(707689..707858,707930..708081,709517..709577,
FT                   709664..709754,709831..709943,710019..710248)
FT                   /locus_tag="mCG_19278"
FT                   /product="mCG19278"
FT                   /note="gene_id=mCG19278.1 transcript_id=mCT18846.2 created
FT                   on 28-AUG-2002"
FT   CDS             join(707753..707858,707930..708081,709517..709577,
FT                   709664..709754,709831..709943,710019..710224)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19278"
FT                   /product="mCG19278"
FT                   /note="gene_id=mCG19278.1 transcript_id=mCT18846.2
FT                   protein_id=mCP22300.2"
FT                   /protein_id="EDL02475.1"
FT                   /translation="MEGAGPVLSILGLLLVSAPFGVLGERPSADLGAHPERGSQVSPGT
FT                   TEPRRQPPPKDQRERARAGSLSLGALYTAAVVAFVLFKCLQGPDEAAVLREEKNKKKSS
FT                   QSEQQLVQLTQQLAQTEQHLNHLMTQLDPLFEQVTTLVGTQRELLDTKLKTIHHLLQDC
FT                   QPGTGVEVPEPEASIPFTEDLGKEDQEAGNSQAWEEPITWSPETRNLAPSWEVEQGLRR
FT                   RWHKTVTKGPAVNGEQPLKV"
FT   gene            complement(710468..713945)
FT                   /locus_tag="mCG_19286"
FT                   /note="gene_id=mCG19286.3"
FT   mRNA            complement(join(710468..712351,712908..713026,
FT                   713218..713659,713792..>713936))
FT                   /locus_tag="mCG_19286"
FT                   /product="mCG19286, transcript variant mCT189499"
FT                   /note="gene_id=mCG19286.3 transcript_id=mCT189499.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(710469..711042,711143..711231,
FT                   711409..711638,711904..712032,712281..712351,
FT                   712908..713026,713218..713338,713565..713659,
FT                   713792..713945))
FT                   /locus_tag="mCG_19286"
FT                   /product="mCG19286, transcript variant mCT18853"
FT                   /note="gene_id=mCG19286.3 transcript_id=mCT18853.2 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(711000..711042,711143..711231,
FT                   711409..711638,711904..712032,712281..712351,
FT                   712908..713026,713218..713338,713565..713659,
FT                   713792..713929))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19286"
FT                   /product="mCG19286, isoform CRA_b"
FT                   /note="gene_id=mCG19286.3 transcript_id=mCT18853.2
FT                   protein_id=mCP22272.2 isoform=CRA_b"
FT                   /protein_id="EDL02473.1"
FT                   /translation="MESSGSAACCPVLQQRARWERKRVCTARELLETERRYQEQLGLVA
FT                   TYFLRILKAKGTLRPPELQTLFGTWELIYAASLELLPYLEEGQWGLGLQGFCPHLELYA
FT                   QFAANAERSQTTLQAQLKKNKRFRRFVKLQEGRPEFRGLQLQDLLPLPLQRLQQYENLV
FT                   VALAENTVPNSPDYQQLTRAARLVSETAQKVHAIGQSQKNDQHLLRVQALLSGRKAKGL
FT                   TSGRWFLRQGWLLVVPPTGEPRPRMFFLFSDVLLMAKPRPPLHLLKSGTFVCRALYPMS
FT                   QCHLSRVFGHSGGPCGGLLSLSFPHEKLLLMSTDQEELSQWHHSLTLAIRSQKSSTHRS
FT                   VTAT"
FT   mRNA            complement(join(712172..712351,712908..713026,
FT                   713218..713338,713565..713659,713792..713945))
FT                   /locus_tag="mCG_19286"
FT                   /product="mCG19286, transcript variant mCT174084"
FT                   /note="gene_id=mCG19286.3 transcript_id=mCT174084.0 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(712270..712351,712908..713026,
FT                   713218..713338,713565..713659,713792..713929))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19286"
FT                   /product="mCG19286, isoform CRA_a"
FT                   /note="gene_id=mCG19286.3 transcript_id=mCT174084.0
FT                   protein_id=mCP97003.0 isoform=CRA_a"
FT                   /protein_id="EDL02472.1"
FT                   /translation="MESSGSAACCPVLQQRARWERKRVCTARELLETERRYQEQLGLVA
FT                   TYFLRILKAKGTLRPPELQTLFGTWELIYAASLELLPYLEEGQWGLGLQGFCPHLELYA
FT                   QFAANAERSQTTLQAQLKKNKRFRRFVKLQEGRPEFRGLQLQDLLPLPLQRLQQYENLV
FT                   VALAENTVPNSPDYQQLTRRF"
FT   CDS             complement(join(713382..713659,713792..>713936))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19286"
FT                   /product="mCG19286, isoform CRA_c"
FT                   /note="gene_id=mCG19286.3 transcript_id=mCT189499.0
FT                   protein_id=mCP110497.0 isoform=CRA_c"
FT                   /protein_id="EDL02474.1"
FT                   /translation="VKHGEFGIRRVLPGATAACSLGTETCLHRSGAAGDRATLPGTTGA
FT                   GGHVLPADPESQRNTTTTRTPDPVWDLGAHLCRQPVSGRIAGRGSVKPSQKGQVHLPTF
FT                   SPVGLAQCLNLPASPAVKWDNSTTCEAGLMEVYEGV"
FT   assembly_gap    715138..715200
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   gene            721195..727890
FT                   /gene="Car9"
FT                   /locus_tag="mCG_141072"
FT                   /note="gene_id=mCG141072.0"
FT   mRNA            join(721195..721566,722495..722524,722784..722954,
FT                   723074..723216,723299..723391,724376..724442,
FT                   726573..726599,727013..727094,727205..727890)
FT                   /gene="Car9"
FT                   /locus_tag="mCG_141072"
FT                   /product="carbonic anhydrase 9, transcript variant
FT                   mCT172947"
FT                   /note="gene_id=mCG141072.0 transcript_id=mCT172947.0
FT                   created on 28-AUG-2002"
FT   mRNA            join(721206..721566,722495..722524,722784..722954,
FT                   723074..723216,723299..723391,724376..724442,
FT                   725988..726145,726303..726438,726573..726599,
FT                   727013..727094,727205..727890)
FT                   /gene="Car9"
FT                   /locus_tag="mCG_141072"
FT                   /product="carbonic anhydrase 9, transcript variant
FT                   mCT172946"
FT                   /note="gene_id=mCG141072.0 transcript_id=mCT172946.0
FT                   created on 28-AUG-2002"
FT   CDS             join(721227..721566,722495..722524,722784..722954,
FT                   723074..723216,723299..723391,724376..724442,
FT                   725988..726145,726303..726438,726573..726599,
FT                   727013..727094,727205..727271)
FT                   /codon_start=1
FT                   /gene="Car9"
FT                   /locus_tag="mCG_141072"
FT                   /product="carbonic anhydrase 9, isoform CRA_a"
FT                   /note="gene_id=mCG141072.0 transcript_id=mCT172946.0
FT                   protein_id=mCP95866.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UUZ9"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018338"
FT                   /db_xref="InterPro:IPR018429"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="MGI:MGI:2447188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UUZ9"
FT                   /protein_id="EDL02470.1"
FT                   /translation="MASLGPSPWAPLSTPAPTAQLLLFLLLQVSAQPQGLSGMQGEPSL
FT                   GDSSSGEDELGVDVLPSEEDAPEEADPPDGEDPPEVNSEDRMEESLGLEDLSTPEAPEH
FT                   SQGSHGDEKGGGHSHWSYGGTLLWPQVSPACAGRFQSPVDIRLERTAFCRTLQPLELLG
FT                   YELQPLPELSLSNNGHTVQLTLPPGLKMALGPGQEYRALQLHLHWGTSDHPGSEHTVNG
FT                   HRFPAEIHVVHLSTAFSELHEALGRPGGLAVLAAFLQESPEENSAYEQLLSHLEEISEE
FT                   GSKIEIPGLDVSALLPSDLSRYYRYEGSLTTPPCSQGVIWTVFNETVKLSAKQLHTLSV
FT                   SLWGPRDSRLQLNFRATQPLNGRTIEASFPAAEDSSPEPVHVNSCFTAGDILALVFGLL
FT                   FAVTSIAFLLQLRRQHRHRSGTKDRVSYSPAEMTETGA"
FT   CDS             join(721227..721566,722495..722524,722784..722954,
FT                   723074..723216,723299..723391,724376..724442,
FT                   726573..726599,727013..727094,727205..727271)
FT                   /codon_start=1
FT                   /gene="Car9"
FT                   /locus_tag="mCG_141072"
FT                   /product="carbonic anhydrase 9, isoform CRA_b"
FT                   /note="gene_id=mCG141072.0 transcript_id=mCT172947.0
FT                   protein_id=mCP95865.0 isoform=CRA_b"
FT                   /db_xref="GOA:A1ECK8"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018338"
FT                   /db_xref="InterPro:IPR018429"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="MGI:MGI:2447188"
FT                   /db_xref="UniProtKB/TrEMBL:A1ECK8"
FT                   /protein_id="EDL02471.1"
FT                   /translation="MASLGPSPWAPLSTPAPTAQLLLFLLLQVSAQPQGLSGMQGEPSL
FT                   GDSSSGEDELGVDVLPSEEDAPEEADPPDGEDPPEVNSEDRMEESLGLEDLSTPEAPEH
FT                   SQGSHGDEKGGGHSHWSYGGTLLWPQVSPACAGRFQSPVDIRLERTAFCRTLQPLELLG
FT                   YELQPLPELSLSNNGHTVQLTLPPGLKMALGPGQEYRALQLHLHWGTSDHPGSEHTVNG
FT                   HRFPAEIHVVHLSTAFSELHEALGRPGGLAVLAAFLQESPEENSAYEQLLSHLEEISEE
FT                   VHVNSCFTAGDILALVFGLLFAVTSIAFLLQLRRQHRHRSGTKDRVSYSPAEMTETGA"
FT   assembly_gap    725585..725951
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   gene            complement(728867..737627)
FT                   /gene="Tpm2"
FT                   /locus_tag="mCG_19269"
FT                   /note="gene_id=mCG19269.2"
FT   mRNA            complement(join(728867..729022,732374..732443,
FT                   732546..732608,733132..733207,733356..733426,
FT                   733518..733635,733740..733873,736791..736916,
FT                   737369..737627))
FT                   /gene="Tpm2"
FT                   /locus_tag="mCG_19269"
FT                   /product="tropomyosin 2, beta, transcript variant
FT                   mCT170616"
FT                   /note="gene_id=mCG19269.2 transcript_id=mCT170616.0 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(728871..729022,732374..732443,
FT                   732546..732608,732788..732863,733356..733426,
FT                   733518..733635,733740..733873,736791..736916,
FT                   737369..737627))
FT                   /gene="Tpm2"
FT                   /locus_tag="mCG_19269"
FT                   /product="tropomyosin 2, beta, transcript variant
FT                   mCT177703"
FT                   /note="gene_id=mCG19269.2 transcript_id=mCT177703.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(728940..729022,732374..732443,
FT                   732546..732608,732788..732863,733356..733426,
FT                   733518..733635,733740..733873,736791..736916,
FT                   737369..737482))
FT                   /codon_start=1
FT                   /gene="Tpm2"
FT                   /locus_tag="mCG_19269"
FT                   /product="tropomyosin 2, beta, isoform CRA_a"
FT                   /note="gene_id=mCG19269.2 transcript_id=mCT177703.0
FT                   protein_id=mCP100625.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR000533"
FT                   /db_xref="MGI:MGI:98810"
FT                   /db_xref="UniProtKB/TrEMBL:Q61344"
FT                   /protein_id="EDL02468.1"
FT                   /translation="MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQA
FT                   LQKKLKGTEDEVEKYSESVKDAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQE
FT                   RLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYE
FT                   EVARKLVILEGELERSEERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYE
FT                   EEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLEL
FT                   NNL"
FT   CDS             complement(join(728940..729022,732374..732443,
FT                   732546..732608,733132..733207,733356..733426,
FT                   733518..733635,733740..733873,736791..736916,
FT                   737369..737482))
FT                   /codon_start=1
FT                   /gene="Tpm2"
FT                   /locus_tag="mCG_19269"
FT                   /product="tropomyosin 2, beta, isoform CRA_b"
FT                   /note="gene_id=mCG19269.2 transcript_id=mCT170616.0
FT                   protein_id=mCP93535.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR000533"
FT                   /db_xref="MGI:MGI:98810"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PJ18"
FT                   /protein_id="EDL02469.1"
FT                   /translation="MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQA
FT                   LQKKLKGTEDEVEKYSESVKDAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQE
FT                   RLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYE
FT                   EVARKLVILEGELERSEERAEVAESRARQLEEELRTMDQALKSLIASEEEYSTKEDKYE
FT                   EEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLEL
FT                   NNL"
FT   assembly_gap    732936..732959
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            complement(745629..776986)
FT                   /gene="Tln1"
FT                   /locus_tag="mCG_19273"
FT                   /note="gene_id=mCG19273.2"
FT   mRNA            complement(join(745629..746196,746303..746431,
FT                   746941..747123,747237..747299,747415..747540,
FT                   747665..747789,747974..748079,748613..748720,
FT                   748803..748988,749743..749859,749961..750086,
FT                   750176..750359,750467..750633,750747..750893,
FT                   752014..752133,752212..752313,752416..752565,
FT                   752658..752828,752904..753005,753317..753449,
FT                   753603..753784,753874..754014,754213..754374,
FT                   754768..754911,756758..756880,756979..757068,
FT                   757152..757245,757421..757560,757713..757910,
FT                   758094..758213,758557..758765,758853..758955,
FT                   759119..759247,759372..759506,759685..759798,
FT                   759884..760000,760138..760266,761028..761194,
FT                   761780..762074,762257..762424,763364..763462,
FT                   763599..763807,764001..764109,764216..764329,
FT                   764476..764656,765240..765316,765464..765565,
FT                   767331..767436,767741..767845,768573..768633,
FT                   769342..769469,769564..769706,769897..770049,
FT                   770150..770279,770584..770681,770916..771078,
FT                   776426..776551))
FT                   /gene="Tln1"
FT                   /locus_tag="mCG_19273"
FT                   /product="talin 1, transcript variant mCT185379"
FT                   /note="gene_id=mCG19273.2 transcript_id=mCT185379.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(745629..746196,746303..746431,
FT                   746941..747123,747237..747299,747415..747540,
FT                   747665..747789,747974..748079,748613..748720,
FT                   748803..748988,749743..749859,749961..750086,
FT                   750176..750359,750467..750633,750747..750893,
FT                   752014..752133,752212..752313,752416..752565,
FT                   752658..752828,752904..753005,753317..753449,
FT                   753603..753784,753874..754014,754213..754374,
FT                   754768..754911,756758..756880,756979..757068,
FT                   757152..757245,757421..757560,757713..757910,
FT                   758094..758213,758557..758765,758853..758955,
FT                   759119..759247,759372..759506,759685..759798,
FT                   759884..760000,760138..760266,761028..761194,
FT                   761780..762074,762257..762424,763364..763462,
FT                   763599..763807,764001..764109,764216..764329,
FT                   764476..764656,765240..765316,765464..765565,
FT                   767281..767436,767741..767845,768573..768633,
FT                   769342..769469,769564..769706,769897..770049,
FT                   770150..770279,770584..770681,770916..771078,
FT                   772673..772752))
FT                   /gene="Tln1"
FT                   /locus_tag="mCG_19273"
FT                   /product="talin 1, transcript variant mCT185380"
FT                   /note="gene_id=mCG19273.2 transcript_id=mCT185380.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(745630..746196,746303..746431,
FT                   746941..747123,747237..747299,747415..747540,
FT                   747665..747789,747974..748079,748613..748720,
FT                   748803..748988,749743..749859,749961..750086,
FT                   750176..750359,750467..750633,750747..750893,
FT                   752014..752133,752212..752313,752416..752565,
FT                   752658..752828,752904..753005,753317..753449,
FT                   753603..753784,753874..754014,754213..754374,
FT                   754768..754911,756758..756880,756979..757068,
FT                   757152..757245,757421..757560,757713..757910,
FT                   758094..758213,758557..758765,758853..758955,
FT                   759119..759247,759372..759506,759685..759798,
FT                   759884..760000,760138..760266,761028..761194,
FT                   761780..762074,762257..762424,763364..763462,
FT                   763599..763807,764001..764109,764216..764329,
FT                   764476..764656,765240..765316,765464..765565,
FT                   767281..767436,767741..767845,768573..768633,
FT                   769342..769469,769564..769706,769897..770049,
FT                   770150..770279,770584..770681,770916..771078,
FT                   776426..776986))
FT                   /gene="Tln1"
FT                   /locus_tag="mCG_19273"
FT                   /product="talin 1, transcript variant mCT18838"
FT                   /note="gene_id=mCG19273.2 transcript_id=mCT18838.2 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(746071..746196,746303..746431,
FT                   746941..747123,747237..747299,747415..747540,
FT                   747665..747789,747974..748079,748613..748720,
FT                   748803..748988,749743..749859,749961..750086,
FT                   750176..750359,750467..750633,750747..750893,
FT                   752014..752133,752212..752313,752416..752565,
FT                   752658..752828,752904..753005,753317..753449,
FT                   753603..753784,753874..754014,754213..754374,
FT                   754768..754911,756758..756880,756979..757068,
FT                   757152..757245,757421..757560,757713..757910,
FT                   758094..758213,758557..758765,758853..758955,
FT                   759119..759247,759372..759506,759685..759798,
FT                   759884..760000,760138..760266,761028..761194,
FT                   761780..762074,762257..762424,763364..763462,
FT                   763599..763807,764001..764109,764216..764329,
FT                   764476..764656,765240..765316,765464..765565,
FT                   767281..767436,767741..767845,768573..768633,
FT                   769342..769469,769564..769706,769897..770049,
FT                   770150..770279,770584..770681,770916..771045))
FT                   /codon_start=1
FT                   /gene="Tln1"
FT                   /locus_tag="mCG_19273"
FT                   /product="talin 1, isoform CRA_b"
FT                   /note="gene_id=mCG19273.2 transcript_id=mCT185380.0
FT                   protein_id=mCP106637.0 isoform=CRA_b"
FT                   /protein_id="EDL02466.1"
FT                   /translation="MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPN
FT                   DFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDD
FT                   SKTVTDMLMTICARIGITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQ
FT                   KLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDD
FT                   ILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQ
FT                   AHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRV
FT                   DEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDII
FT                   LKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGAS
FT                   GPENFQVGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFE
FT                   TLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCA
FT                   VTTISSNLTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQ
FT                   NLLQAAGNVGQASGELLQQIGESDTDPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTE
FT                   DSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSA
FT                   SQAATEDGQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENI
FT                   FSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMV
FT                   EAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNAIKKKLVQRLEHAAKQAAASATQ
FT                   TIAAAQHAASAPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAA
FT                   SQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPL
FT                   EMDSALSVVQNLEKDLQEIKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAKLLG
FT                   EIAQGNENYAGIAARDVAGGLRSLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLI
FT                   EEAKKASGHPGDPESQQRLAQVAKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLS
FT                   DLLPPSTGTFQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEA
FT                   GVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPASPNLKSQLAAAARAVT
FT                   DSINQLITMCTQQAPGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENSKV
FT                   LGEAMTGISQNAKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGL
FT                   VEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPT
FT                   AKRQFVQSAKEVANSTANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFASNP
FT                   EFSSVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSR
FT                   TVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPREGISQEA
FT                   LHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHP
FT                   QQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLN
FT                   EAASAAGVVGGMVDSITQAINQLDEGPMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTK
FT                   SNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRVQELGHGCSALVTK
FT                   AGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADL
FT                   DTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSS
FT                   VATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPA
FT                   VWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKT
FT                   STPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAFHPEV
FT                   APDVRLRALHYGRECANGYLELLDHVLLTLQKPNPDLKQQLTGHSKRVAGSVTELIQAA
FT                   EAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQIL
FT                   EAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMVAAATN
FT                   NLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVK
FT                   RASDNLVKAAQKAAAFEDQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARKKLA
FT                   QIRQQQYKFLPSELRDEH"
FT   CDS             complement(join(746071..746196,746303..746431,
FT                   746941..747123,747237..747299,747415..747540,
FT                   747665..747789,747974..748079,748613..748720,
FT                   748803..748988,749743..749859,749961..750086,
FT                   750176..750359,750467..750633,750747..750893,
FT                   752014..752133,752212..752313,752416..752565,
FT                   752658..752828,752904..753005,753317..753449,
FT                   753603..753784,753874..754014,754213..754374,
FT                   754768..754911,756758..756880,756979..757068,
FT                   757152..757245,757421..757560,757713..757910,
FT                   758094..758213,758557..758765,758853..758955,
FT                   759119..759247,759372..759506,759685..759798,
FT                   759884..760000,760138..760266,761028..761194,
FT                   761780..762074,762257..762424,763364..763462,
FT                   763599..763807,764001..764109,764216..764329,
FT                   764476..764656,765240..765316,765464..765565,
FT                   767281..767436,767741..767845,768573..768633,
FT                   769342..769469,769564..769706,769897..770049,
FT                   770150..770279,770584..770681,770916..771045))
FT                   /codon_start=1
FT                   /gene="Tln1"
FT                   /locus_tag="mCG_19273"
FT                   /product="talin 1, isoform CRA_b"
FT                   /note="gene_id=mCG19273.2 transcript_id=mCT18838.2
FT                   protein_id=mCP22291.1 isoform=CRA_b"
FT                   /protein_id="EDL02467.1"
FT                   /translation="MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPN
FT                   DFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDD
FT                   SKTVTDMLMTICARIGITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQ
FT                   KLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDD
FT                   ILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQ
FT                   AHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRV
FT                   DEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDII
FT                   LKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGAS
FT                   GPENFQVGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFE
FT                   TLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCA
FT                   VTTISSNLTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQ
FT                   NLLQAAGNVGQASGELLQQIGESDTDPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTE
FT                   DSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSA
FT                   SQAATEDGQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENI
FT                   FSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMV
FT                   EAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNAIKKKLVQRLEHAAKQAAASATQ
FT                   TIAAAQHAASAPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAA
FT                   SQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPL
FT                   EMDSALSVVQNLEKDLQEIKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAKLLG
FT                   EIAQGNENYAGIAARDVAGGLRSLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLI
FT                   EEAKKASGHPGDPESQQRLAQVAKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLS
FT                   DLLPPSTGTFQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEA
FT                   GVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPASPNLKSQLAAAARAVT
FT                   DSINQLITMCTQQAPGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENSKV
FT                   LGEAMTGISQNAKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGL
FT                   VEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPT
FT                   AKRQFVQSAKEVANSTANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFASNP
FT                   EFSSVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSR
FT                   TVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPREGISQEA
FT                   LHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHP
FT                   QQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLN
FT                   EAASAAGVVGGMVDSITQAINQLDEGPMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTK
FT                   SNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRVQELGHGCSALVTK
FT                   AGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADL
FT                   DTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSS
FT                   VATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPA
FT                   VWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKT
FT                   STPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAFHPEV
FT                   APDVRLRALHYGRECANGYLELLDHVLLTLQKPNPDLKQQLTGHSKRVAGSVTELIQAA
FT                   EAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQIL
FT                   EAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMVAAATN
FT                   NLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVK
FT                   RASDNLVKAAQKAAAFEDQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARKKLA
FT                   QIRQQQYKFLPSELRDEH"
FT   CDS             complement(join(746071..746196,746303..746431,
FT                   746941..747123,747237..747299,747415..747540,
FT                   747665..747789,747974..748079,748613..748720,
FT                   748803..748988,749743..749859,749961..750086,
FT                   750176..750359,750467..750633,750747..750893,
FT                   752014..752133,752212..752313,752416..752565,
FT                   752658..752828,752904..753005,753317..753449,
FT                   753603..753784,753874..754014,754213..754374,
FT                   754768..754911,756758..756880,756979..757068,
FT                   757152..757245,757421..757560,757713..757910,
FT                   758094..758213,758557..758765,758853..758955,
FT                   759119..759247,759372..759506,759685..759798,
FT                   759884..760000,760138..760266,761028..761194,
FT                   761780..762074,762257..762424,763364..763462,
FT                   763599..763807,764001..764109,764216..764329,
FT                   764476..764656,765240..765268))
FT                   /codon_start=1
FT                   /gene="Tln1"
FT                   /locus_tag="mCG_19273"
FT                   /product="talin 1, isoform CRA_a"
FT                   /note="gene_id=mCG19273.2 transcript_id=mCT185379.0
FT                   protein_id=mCP106638.0 isoform=CRA_a"
FT                   /protein_id="EDL02465.1"
FT                   /translation="MLEDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENF
FT                   QVGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPL
FT                   GQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTIS
FT                   SNLTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQA
FT                   AGNVGQASGELLQQIGESDTDPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQ
FT                   TQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAAT
FT                   EDGQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMG
FT                   DAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKG
FT                   AAAHPDSEEQQQRLREAAEGLRMATNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAA
FT                   QHAASAPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFL
FT                   QPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSA
FT                   LSVVQNLEKDLQEIKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAKLLGEIAQG
FT                   NENYAGIAARDVAGGLRSLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLIEEAKK
FT                   ASGHPGDPESQQRLAQVAKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDLLPP
FT                   STGTFQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMA
FT                   GQAPSQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPASPNLKSQLAAAARAVTDSINQ
FT                   LITMCTQQAPGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAM
FT                   TGISQNAKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQ
FT                   FARANQAIQMACQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQF
FT                   VQSAKEVANSTANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSV
FT                   PAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDS
FT                   IKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQM
FT                   LTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMAL
FT                   LDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASA
FT                   AGVVGGMVDSITQAINQLDEGPMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSP
FT                   EELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRVQELGHGCSALVTKAGALQ
FT                   CSPSDVYTKKELIECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIM
FT                   FATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATIT
FT                   RLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLK
FT                   NSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKTSTPED
FT                   FIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAFHPEVAPDVR
FT                   LRALHYGRECANGYLELLDHVLLTLQKPNPDLKQQLTGHSKRVAGSVTELIQAAEAMKG
FT                   TEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAKS
FT                   IAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMVAAATNNLCEA
FT                   ANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVKRASDN
FT                   LVKAAQKAAAFEDQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQQ
FT                   QYKFLPSELRDEH"
FT   assembly_gap    748453..748592
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    774989..775008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            776628..781351
FT                   /gene="Creb3"
FT                   /locus_tag="mCG_19274"
FT                   /note="gene_id=mCG19274.3"
FT   mRNA            join(776628..777254,777345..777501,777576..777646,
FT                   777764..777853,779552..779658,779758..779826,
FT                   780411..780495,780585..780669,780760..781351)
FT                   /gene="Creb3"
FT                   /locus_tag="mCG_19274"
FT                   /product="cAMP responsive element binding protein 3"
FT                   /note="gene_id=mCG19274.3 transcript_id=mCT18843.3 created
FT                   on 12-JUN-2003"
FT   CDS             join(777108..777254,777345..777501,777576..777646,
FT                   777764..777853,779552..779658,779758..779826,
FT                   780411..780495,780585..780669,780760..781088)
FT                   /codon_start=1
FT                   /gene="Creb3"
FT                   /locus_tag="mCG_19274"
FT                   /product="cAMP responsive element binding protein 3"
FT                   /note="gene_id=mCG19274.3 transcript_id=mCT18843.3
FT                   protein_id=mCP22295.1"
FT                   /protein_id="EDL02464.1"
FT                   /translation="MDPGGQDLLALDPGDQDLLGFLLEESGDLWAATEPDVKAPLDLEL
FT                   SPSENSVQELSDWEVEDLLSSLLSPSASRDVLGSSSSSILHDHNYSLPQEHVSIDLDTE
FT                   SFEKEGFHVTPLPGEERAAEQEMSRLILTEEEKKLLEKEGLTLPSTLPLTKVEEQVLKR
FT                   VRRKIRNKRAAQESRKKKKVYVVGLESRVLKYTAQNRELQNKVQRLEEQNLSLLDQLRK
FT                   LQAMVIEIANKTSSGSTCVLVLVFSFCLLLVPAMYSSDARGSVPAEYVVLHRKLRALPS
FT                   EDDHQPKPSALSSELPMDSTHQSLDSSEHMFLVSSNFSCVLYHAPQAEQPLHWPLWDLS
FT                   SEMLFSDSNLLLQANLSESEGWQPNHSPSLVIFQGRYSG"
FT   gene            complement(781226..793185)
FT                   /gene="Gba2"
FT                   /locus_tag="mCG_19285"
FT                   /note="gene_id=mCG19285.2"
FT   mRNA            complement(join(781226..781758,782016..782207,
FT                   782291..782406,782487..782629,782729..782835,
FT                   782946..783097,783177..783284,783472..783576,
FT                   783780..783952,784121..784246,784328..784481,
FT                   784637..784739,784963..785202,785480..785698,
FT                   788042..788157,788319..788410,792307..793185))
FT                   /gene="Gba2"
FT                   /locus_tag="mCG_19285"
FT                   /product="glucosidase beta 2, transcript variant mCT18855"
FT                   /note="gene_id=mCG19285.2 transcript_id=mCT18855.2 created
FT                   on 01-OCT-2002"
FT   mRNA            complement(join(781226..781758,782016..782207,
FT                   782291..782406,782487..782629,782729..782835,
FT                   782946..783097,783177..783284,783472..783576,
FT                   783780..784246,784328..784739,784963..785202,
FT                   785480..785698,788042..788157,788319..788410,
FT                   792307..>792828))
FT                   /gene="Gba2"
FT                   /locus_tag="mCG_19285"
FT                   /product="glucosidase beta 2, transcript variant mCT189498"
FT                   /note="gene_id=mCG19285.2 transcript_id=mCT189498.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(781226..782207,782291..782406,
FT                   782487..782629,782729..782835,782946..783097,
FT                   783177..783284,783472..784246,784328..784739,
FT                   784963..785202,785480..785698,788042..788157,
FT                   788319..788410,792307..>792380))
FT                   /gene="Gba2"
FT                   /locus_tag="mCG_19285"
FT                   /product="glucosidase beta 2, transcript variant mCT189497"
FT                   /note="gene_id=mCG19285.2 transcript_id=mCT189497.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(781480..781758,782016..782207,
FT                   782291..782406,782487..782629,782729..782835,
FT                   782946..783097,783177..783284,783472..783576,
FT                   783780..783952,784121..784246,784328..784481,
FT                   784637..784739,784963..785202,785480..785698,
FT                   788042..788157,788319..788410,792307..792638))
FT                   /codon_start=1
FT                   /gene="Gba2"
FT                   /locus_tag="mCG_19285"
FT                   /product="glucosidase beta 2, isoform CRA_a"
FT                   /note="gene_id=mCG19285.2 transcript_id=mCT18855.2
FT                   protein_id=mCP22297.2 isoform=CRA_a"
FT                   /protein_id="EDL02461.1"
FT                   /translation="MVTCVPASEQVGCAERDSQVYCEDTGGTEAVRVTDCGSPEDSGPQ
FT                   DEPSYCNSEDSGQLMASYEGKARGYLVPPFGWRICLAHEFAEKRRPFQANNISLSNLVK
FT                   HLGMGLRYLKWWYRKTHVEKKTPFIDMLNSLPLRQIYGCPLGGIGGGTITRGWRGQFCR
FT                   WQLNPGMYQHQTVIADQFIVCLRRDGRTVYQQVLSLELPNVLRSWNWGLCGYFAFYHAL
FT                   YPRAWTVYQLPGQNVTLTCRQVTPILPHDYQDSSLPVGVFVWDVENEGDETLDVSITFS
FT                   MRNGLGGEDDAAGSLWNEPFRLEQGGTTVQGLLLHHPTPPNPYTMAVAARCTADTTVTH
FT                   TTAFDPNGTGQQVWQDLLQDGQLDSPAGQSTPTQKGEGIAGAVCVSSKLLPRSRCCLEF
FT                   SLAWDMPKIMFGAKSQVHYRRYTRFFGSDGDVAPALSHYALCHYADWEDRISAWQNPVL
FT                   DDRTLPAWYKSALFNELYFLADGGTVWLEVPADSLPEGLGGSMRQLRSTLQDYGRFGYL
FT                   EGQEYRMYNTYDVHFYASFALVMLWPKLELSLQYDMALATLKEDLTRRRYLMSGVVAPV
FT                   KRRNVIPHDIGDPDDEPWLRVNAYLIHDTADWKDLNLKFVLQIYRDYYLTGDQGFLEDM
FT                   WPVCLAVMESEMKFDKDQDGLIENGGYADQTYDAWVTTGPSAYCGGLWLAAVAVMVQMA
FT                   VLCGAQDVQERFASILCRGREAYERLLWNGRYYNYDSSSHPQSRSIMSDQCAGQWFLRA
FT                   CGLGEGDTEVFPTLHVVRALQTIFELNVQAFAGGAMGAVNGMHPHGVPDRSSVQSDEVW
FT                   VGVVYGLAATMIQEGLTWEGFRTAEGCYRTVWERLGLAFQTPEAYCQQQVFRSLAYMRP
FT                   LSIWAMQLALQQQQHKKSRRPSVTQGTGLSTQPECGPKRSLANLNSE"
FT   CDS             complement(join(781480..781758,782016..782207,
FT                   782291..782406,782487..782629,782729..782835,
FT                   782946..783097,783177..783284,783472..783576,
FT                   783780..>783981))
FT                   /codon_start=1
FT                   /gene="Gba2"
FT                   /locus_tag="mCG_19285"
FT                   /product="glucosidase beta 2, isoform CRA_c"
FT                   /note="gene_id=mCG19285.2 transcript_id=mCT189498.0
FT                   protein_id=mCP110496.0 isoform=CRA_c"
FT                   /protein_id="EDL02463.1"
FT                   /translation="SSIPSSWLPRTLPAWYKSALFNELYFLADGGTVWLEVPADSLPEG
FT                   LGGSMRQLRSTLQDYGRFGYLEGQEYRMYNTYDVHFYASFALVMLWPKLELSLQYDMAL
FT                   ATLKEDLTRRRYLMSGVVAPVKRRNVIPHDIGDPDDEPWLRVNAYLIHDTADWKDLNLK
FT                   FVLQIYRDYYLTGDQGFLEDMWPVCLAVMESEMKFDKDQDGLIENGGYADQTYDAWVTT
FT                   GPSAYCGGLWLAAVAVMVQMAVLCGAQDVQERFASILCRGREAYERLLWNGRYYNYDSS
FT                   SHPQSRSIMSDQCAGQWFLRACGLGEGDTEVFPTLHVVRALQTIFELNVQAFAGGAMGA
FT                   VNGMHPHGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFRTAEGCYRTVWERLGLA
FT                   FQTPEAYCQQQVFRSLAYMRPLSIWAMQLALQQQQHKKSRRPSVTQGTGLSTQPECGPK
FT                   RSLANLNSE"
FT   CDS             complement(join(781860..782207,782291..782406,
FT                   782487..782629,782729..782835,782946..783097,
FT                   783177..783284,783472..>783631))
FT                   /codon_start=1
FT                   /gene="Gba2"
FT                   /locus_tag="mCG_19285"
FT                   /product="glucosidase beta 2, isoform CRA_b"
FT                   /note="gene_id=mCG19285.2 transcript_id=mCT189497.0
FT                   protein_id=mCP110495.0 isoform=CRA_b"
FT                   /protein_id="EDL02462.1"
FT                   /translation="RATEQKPAFWQQCLSLPPGQEYRMYNTYDVHFYASFALVMLWPKL
FT                   ELSLQYDMALATLKEDLTRRRYLMSGVVAPVKRRNVIPHDIGDPDDEPWLRVNAYLIHD
FT                   TADWKDLNLKFVLQIYRDYYLTGDQGFLEDMWPVCLAVMESEMKFDKDQDGLIENGGYA
FT                   DQTYDAWVTTGPSAYCGGLWLAAVAVMVQMAVLCGAQDVQERFASILCRGREAYERLLW
FT                   NGRYYNYDSSSHPQSRSIMSDQCAGQWFLRACGLGEGDTEVFPTLHVVRALQTIFELNV
FT                   QAFAGGAMGAVNGMHPHGVPDRSSVQSDEVWVGVVYGLAATMIQEVMNSLPSPSPFVLR
FT                   SRKLPQPLTLFQEHPTACHLIRPQSALLPNKCSTSCL"
FT   gene            792766..797419
FT                   /gene="1110029E03Rik"
FT                   /locus_tag="mCG_141073"
FT                   /note="gene_id=mCG141073.1"
FT   mRNA            join(792766..793214,793664..793798,794176..794312,
FT                   794585..794668,794766..794915,795153..795299,
FT                   795477..795604,795776..796001,797149..797379)
FT                   /gene="1110029E03Rik"
FT                   /locus_tag="mCG_141073"
FT                   /product="RIKEN cDNA 1110029E03, transcript variant
FT                   mCT172945"
FT                   /note="gene_id=mCG141073.1 transcript_id=mCT172945.0
FT                   created on 28-AUG-2002"
FT   mRNA            join(<793247..793298,793664..793798,794176..794312,
FT                   794585..794668,794766..794915,795153..795299,
FT                   795477..795604,795776..795965,797149..797419)
FT                   /gene="1110029E03Rik"
FT                   /locus_tag="mCG_141073"
FT                   /product="RIKEN cDNA 1110029E03, transcript variant
FT                   mCT189516"
FT                   /note="gene_id=mCG141073.1 transcript_id=mCT189516.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<793249..793298,793664..793798,794176..794312,
FT                   794585..794668,794766..794915,795153..795299,
FT                   795477..795604,795776..795965,797149..797372)
FT                   /codon_start=1
FT                   /gene="1110029E03Rik"
FT                   /locus_tag="mCG_141073"
FT                   /product="RIKEN cDNA 1110029E03, isoform CRA_b"
FT                   /note="gene_id=mCG141073.1 transcript_id=mCT189516.0
FT                   protein_id=mCP110480.0 isoform=CRA_b"
FT                   /protein_id="EDL02460.1"
FT                   /translation="DSADATELRAGLAGAGRFGSGAAMIEVVAELSRGPVFLAGEALEC
FT                   VVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFL
FT                   PHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPTEGPPSFRGQSVKYVYKLTI
FT                   GCQRVNSPITLLRVPLRVLVLTGLQDVHFPQDEAVAPSSPFLEEDDSGKKDSWLAELAG
FT                   ERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVS
FT                   LQTEERVQPEYQRRRGTGVAPSVSHVTHARHQESCLHTTRTSFSLPIPLCSTPGFCTAI
FT                   VSLKWRLHFEFVTSREPGLVLLPPLEQPEPATWTGPEQVPVDTFSWDLPIKVLPTSPTL
FT                   VSYAAPGPSTSSITI"
FT   CDS             join(793683..793798,794176..794312,794585..794668,
FT                   794766..794915,795153..795299,795477..795604,
FT                   795776..796001,797149..797372)
FT                   /codon_start=1
FT                   /gene="1110029E03Rik"
FT                   /locus_tag="mCG_141073"
FT                   /product="RIKEN cDNA 1110029E03, isoform CRA_a"
FT                   /note="gene_id=mCG141073.1 transcript_id=mCT172945.0
FT                   protein_id=mCP95864.0 isoform=CRA_a"
FT                   /protein_id="EDL02459.1"
FT                   /translation="MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWA
FT                   SAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPPKILFCDLR
FT                   LDPGESKSYSYSEVLPTEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTG
FT                   LQDVHFPQDEAVAPSSPFLEEDDSGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGK
FT                   VGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGTGVAPSV
FT                   SHVTHARHQESCLHTTRTSFSLPIPLCSTPGFCTAIGENRSTTGEGSGVSLKWRLHFEF
FT                   VTSREPGLVLLPPLEQPEPATWTGPEQVPVDTFSWDLPIKVLPTSPTLVSYAAPGPSTS
FT                   SITI"
FT   gene            complement(797552..>798557)
FT                   /locus_tag="mCG_53831"
FT                   /note="gene_id=mCG53831.1"
FT   mRNA            complement(join(797552..797782,798102..798210,
FT                   798428..>798557))
FT                   /locus_tag="mCG_53831"
FT                   /product="mCG53831"
FT                   /note="gene_id=mCG53831.1 transcript_id=mCT54014.1 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(797602..797782,798102..798210,
FT                   798428..798557))
FT                   /codon_start=1
FT                   /locus_tag="mCG_53831"
FT                   /product="mCG53831"
FT                   /note="gene_id=mCG53831.1 transcript_id=mCT54014.1
FT                   protein_id=mCP42271.0"
FT                   /protein_id="EDL02458.1"
FT                   /translation="MALRMLWAGQAKGILGGWRTICLVVSLFLQHPGVSSKCYFQAQAP
FT                   CHYEGKYFTLGESWLRKDCFHCTCLHPVGVGCCDTAQHPIDFPAECEVLQEAGTCQFSL
FT                   VQKADPRLPCKGGGPDLEWGSANTPAPGASAPHSS"
FT   assembly_gap    799868..799887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <802362..>823238
FT                   /locus_tag="mCG_144947"
FT                   /note="gene_id=mCG144947.0"
FT   mRNA            join(<802362..802435,821350..821446,822265..>823238)
FT                   /locus_tag="mCG_144947"
FT                   /product="mCG144947"
FT                   /note="gene_id=mCG144947.0 transcript_id=mCT184371.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    814107..814126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    820879..821068
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    821856..821875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <822813..>823238
FT                   /codon_start=1
FT                   /locus_tag="mCG_144947"
FT                   /product="mCG144947"
FT                   /note="gene_id=mCG144947.0 transcript_id=mCT184371.0
FT                   protein_id=mCP105213.0"
FT                   /protein_id="EDL02457.1"
FT                   /translation="LLVTSGFFFFFFLYFSFSPSWCVVGKRSSQLSLGGKGSISWPRPF
FT                   HSWAPAGAGVLTLPGGFFFLQPQTSDLLFPHLFSHLNTFYLFIYLFLLKAVLLLGDHLK
FT                   HSGQPTSVGYTVHLLWCLIQMCFYGNKRIRFILASEIT"
FT   assembly_gap    824675..824831
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    826173..826728
FT                   /estimated_length=556
FT                   /gap_type="unknown"
FT   assembly_gap    827935..827954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    836319..836366
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    842352..842371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    846036..846198
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   gene            <846931..866337
FT                   /gene="Npr2"
FT                   /locus_tag="mCG_19280"
FT                   /note="gene_id=mCG19280.2"
FT   mRNA            join(<846931..847597,848271..848476,854987..855100,
FT                   855384..855519,855821..855915,856096..856228,
FT                   856451..856535,857956..858076,858237..858311,
FT                   858508..858585,858985..859089,859210..859281,
FT                   861443..861602,861818..861973,862051..862219,
FT                   862373..862519,862979..863102,863254..863322,
FT                   865056..865230,865301..865399,865615..865706,
FT                   865820..866337)
FT                   /gene="Npr2"
FT                   /locus_tag="mCG_19280"
FT                   /product="natriuretic peptide receptor 2"
FT                   /note="gene_id=mCG19280.2 transcript_id=mCT18848.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(846931..847597,848271..848476,854987..855100,
FT                   855384..855519,855821..855915,856096..856228,
FT                   856451..856535,857956..858076,858237..858311,
FT                   858508..858585,858985..859089,859210..859281,
FT                   861443..861602,861818..861973,862051..862219,
FT                   862373..862519,862979..863102,863254..863322,
FT                   865056..865230,865301..865399,865615..865706,
FT                   865820..865885)
FT                   /codon_start=1
FT                   /gene="Npr2"
FT                   /locus_tag="mCG_19280"
FT                   /product="natriuretic peptide receptor 2"
FT                   /note="gene_id=mCG19280.2 transcript_id=mCT18848.2
FT                   protein_id=mCP22305.2"
FT                   /db_xref="GOA:Q6VVW5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001170"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="MGI:MGI:97372"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6VVW5"
FT                   /protein_id="EDL02456.1"
FT                   /translation="MALPSLLLVVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRV
FT                   GPAVALAVEALGRALPVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYP
FT                   AASVARFASHWRLPLLTAGAVASGFAAKNEHYRTLVRTGPSAPKLGEFVVTLHGHFNWT
FT                   ARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGR
FT                   IVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTQE
FT                   QAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDG
FT                   ILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGD
FT                   LDSGDFQPAAHYSGAEKQIWWTGRPIPWVKGAPPLDNPPCAFDLDDPSCDKTPLSTLAI
FT                   VALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSDRYHKGAGSRLTL
FT                   SLRGSSYGSLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQF
FT                   NHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLH
FT                   NSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPDDSHALYAKKLWTAPELLSG
FT                   NPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSID
FT                   RTQLNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNL
FT                   EKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFT
FT                   ALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEI
FT                   ARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASR
FT                   MESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQKGPPGLL"
FT   assembly_gap    855636..855734
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   gene            complement(<866636..868459)
FT                   /gene="Spag8"
FT                   /locus_tag="mCG_1050929"
FT                   /note="gene_id=mCG1050929.0"
FT   mRNA            complement(join(<866636..866716,866835..866949,
FT                   867024..867069,867252..867426,867548..868328,
FT                   868411..868459))
FT                   /gene="Spag8"
FT                   /locus_tag="mCG_1050929"
FT                   /product="sperm associated antigen 8"
FT                   /note="gene_id=mCG1050929.0 transcript_id=mCT194718.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(866636..866716,866835..866949,
FT                   867024..867069,867252..867426,867548..868328,
FT                   868411..868448))
FT                   /codon_start=1
FT                   /gene="Spag8"
FT                   /locus_tag="mCG_1050929"
FT                   /product="sperm associated antigen 8"
FT                   /note="gene_id=mCG1050929.0 transcript_id=mCT194718.0
FT                   protein_id=mCP115747.0"
FT                   /db_xref="GOA:Q3V0Q6"
FT                   /db_xref="InterPro:IPR026124"
FT                   /db_xref="MGI:MGI:3056295"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3V0Q6"
FT                   /protein_id="EDL02455.1"
FT                   /translation="METTESTEGSLSRSCDVQPSSERLDTPSEPVPSSSSSPRSTAPAE
FT                   APAQYSVLTEPSSDSLYGAPCPPAHHRGHGFGFQPFYVSCIPQDPCNMADLSSRADPTS
FT                   SYPCHSSVHGSGSGTCGLGQSSEPSQGSGPTSGPAPASVPSLVSGPDSASGPDSSASGP
FT                   ALASGPGPADPGQGPKFSTCIPQGYRCIPVDLAPDYNAWCQHLHWKPQRSWEPLQVSEP
FT                   GVRGPYKPPEPGALGPCEPCEPCEPPEAESEETLCKARPRGQCLLYNWEEERATNQLDQ
FT                   IPPLQDGSESYFFRHGHQGLLTTQPQSPMSSSTTQRDSYQLPRHICQPLRGKREAMLEM
FT                   LLRHQICKEVQAEQEPARKLFETESVTHHDYRVELVRAAPPASTKPHDYRQEQPETFWI
FT                   QRAARLPVCVGD"
FT   gene            complement(869135..871355)
FT                   /locus_tag="mCG_19276"
FT                   /note="gene_id=mCG19276.1"
FT   mRNA            complement(join(869135..869318,869420..869492,
FT                   869623..869727,869813..869953,871266..871355))
FT                   /locus_tag="mCG_19276"
FT                   /product="mCG19276"
FT                   /note="gene_id=mCG19276.1 transcript_id=mCT18844.1 created
FT                   on 28-AUG-2002"
FT   CDS             complement(join(869227..869318,869420..869492,
FT                   869623..869727,869813..869953,871266..871346))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19276"
FT                   /product="mCG19276"
FT                   /note="gene_id=mCG19276.1 transcript_id=mCT18844.1
FT                   protein_id=mCP22298.2"
FT                   /db_xref="GOA:Q5M9J2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="MGI:MGI:1916167"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M9J2"
FT                   /protein_id="EDL02454.1"
FT                   /translation="MAAAVLLAVGLRAARRTLAAAGARGAQVRGNAGVSDGSEVAKAQK
FT                   AAPGGASPTIFSRILDRSLPADILYEDQQCLVFRDVAPQAPVHFLVIPRKPIPRISQAE
FT                   EDDQQLLGHLLLVAKKIAQAQGLKDGYRLVVNDGKMGAQSVYHLHIHVLGGRQLQWPPG
FT                   "
FT   gene            complement(874528..875398)
FT                   /locus_tag="mCG_19284"
FT                   /note="gene_id=mCG19284.3"
FT   mRNA            complement(join(874528..874599,874944..875063,
FT                   875189..875398))
FT                   /locus_tag="mCG_19284"
FT                   /product="mCG19284"
FT                   /note="gene_id=mCG19284.3 transcript_id=mCT18852.2 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(874562..874599,874944..875063,
FT                   875189..875345))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19284"
FT                   /product="mCG19284"
FT                   /note="gene_id=mCG19284.3 transcript_id=mCT18852.2
FT                   protein_id=mCP22303.2"
FT                   /protein_id="EDL02453.1"
FT                   /translation="MFCFIPSRPEEVGEFWLKKRATFDPKAWRAQCRCKHTHEEHAATG
FT                   AHPCRHRGCFCPSFESNFLCVACDRRWEEHETFFETGDTRRKGKRPYGANNIKNWHRTY
FT                   "
FT   gene            878821..879320
FT                   /locus_tag="mCG_124399"
FT                   /note="gene_id=mCG124399.1"
FT   mRNA            878821..879320
FT                   /locus_tag="mCG_124399"
FT                   /product="mCG124399"
FT                   /note="gene_id=mCG124399.1 transcript_id=mCT125640.1
FT                   created on 12-JUL-2002"
FT   CDS             878950..879246
FT                   /codon_start=1
FT                   /locus_tag="mCG_124399"
FT                   /product="mCG124399"
FT                   /note="gene_id=mCG124399.1 transcript_id=mCT125640.1
FT                   protein_id=mCP53532.1"
FT                   /db_xref="MGI:MGI:1337041"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TG69"
FT                   /protein_id="EDL02452.1"
FT                   /translation="MMGFLLPPASRGTRRSCSRSRKRQTRRRRNPSSLVASCPTLLPSA
FT                   CVPGASPTMLEFLPVVLTGPSTDGIPFALSLQRVPFVLPSPQVASLPLGHSWG"
FT   gene            complement(879455..883766)
FT                   /locus_tag="mCG_124408"
FT                   /note="gene_id=mCG124408.1"
FT   mRNA            complement(join(879455..880510,880664..881516,
FT                   883501..883766))
FT                   /locus_tag="mCG_124408"
FT                   /product="mCG124408"
FT                   /note="gene_id=mCG124408.1 transcript_id=mCT125649.1
FT                   created on 01-OCT-2002"
FT   CDS             complement(join(880335..880510,880664..881516))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124408"
FT                   /product="mCG124408"
FT                   /note="gene_id=mCG124408.1 transcript_id=mCT125649.1
FT                   protein_id=mCP53587.0"
FT                   /protein_id="EDL02451.1"
FT                   /translation="MEANKTTEGPQDTQDAKEQPSLEDTNAEDLYEATTHETPLQPSSS
FT                   QKHFQPPEIHLETPASLNPDTKGAEGLQDSSVSGTPPVKSSSSGLLSLPPQLSPQSVTS
FT                   LEKAIAEIPLEEFGYDSPISKVKEEPLQLSPTANIPEYGSPISEVQKESLEVSPTANIP
FT                   EYGSPISEVQKEPLEVSSTANIPKYESPVSEVQKEPLEVSPTASIPESSHELTSDKVPQ
FT                   TQVPESEHFPKHSFSESPTQAKEDESTKEGEAGEDELAVGTSKIPAAKPGLRAKKKKEK
FT                   RAGGVTSRPVVPAKRAELVEMAKAVHREQFDDQVNNLFQWEKDSTLKAIQTGEPRWPSR
FT                   GL"
FT   gene            <883877..906279
FT                   /locus_tag="mCG_19281"
FT                   /note="gene_id=mCG19281.2"
FT   mRNA            join(<883877..884079,888803..888992,889340..889547,
FT                   895562..895695,895949..896217,896862..897187,
FT                   900205..900298,900434..900557,900636..900778,
FT                   900919..901097,904335..904481,904599..904715,
FT                   904935..906278)
FT                   /locus_tag="mCG_19281"
FT                   /product="mCG19281, transcript variant mCT189495"
FT                   /note="gene_id=mCG19281.2 transcript_id=mCT189495.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<884079..884079,888803..888992,889340..889547,
FT                   895562..895695,895949..896217,896862..897187,
FT                   900205..900298,900434..900557,900636..900778,
FT                   900919..901097,904335..904481,904599..904715,
FT                   904935..905270)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19281"
FT                   /product="mCG19281, isoform CRA_b"
FT                   /note="gene_id=mCG19281.2 transcript_id=mCT189495.0
FT                   protein_id=mCP110494.0 isoform=CRA_b"
FT                   /protein_id="EDL02450.1"
FT                   /translation="GGLFLTDYSTCSPRKLSPFRSFASTELFHFHVPEDTFLAVWNLII
FT                   FKEQGGTFGDHCPDQSVTVYFRSGAPPVINPLHTHFPADTAVPGVFSLTLSWTLPNRTS
FT                   GIFNVSSPLPGDWFLAAHLPQAHGHISVKGLQDECQYLLQPQLIVRRLLDVAVLVPGRP
FT                   SEQTLSSHNRSALYKVFVPSFTYRVSAQLVCVGGRGASVCPLTLRLRPKAPPLHNSSSV
FT                   ACGGASVCQLELALPPWGHWVYVRVETPSRGPGRTISFQLCVRLQECPQPSLSRALVPG
FT                   AAMNMPQSLGTQPLPPEPPSLGTPIEGSGAIAPTEHCWPVRPTLRNELDTFSVHFYIFF
FT                   GPSVALPPERPAVFALRLLPVLDSGGVLSLELQLNASSLRQENVTVFGCLTHEVPLSLG
FT                   DAAVTCSKESLAGFLLSVSATSRVARLRIPFPQTGTWFLTLRSLCGVGPRFVRCRNATA
FT                   EVRLRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLL
FT                   STLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDV
FT                   LQFCDFLGSLMSVWVTVIAMARLQPVIKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLF
FT                   ALGILATAWTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHS
FT                   IWHMLIAGSVGFLLPPRAKTDRRVPSGARARGCGYQLCINEQEELGLVGPGGTTVSSIC
FT                   VS"
FT   mRNA            join(<884194..884267,884857..884935,888803..888992,
FT                   889340..889547,895562..895695,895949..896217,
FT                   896862..897187,900220..900298,900434..900557,
FT                   900636..900778,900919..901097,904335..904481,
FT                   904599..904715,904935..906279)
FT                   /locus_tag="mCG_19281"
FT                   /product="mCG19281, transcript variant mCT18850"
FT                   /note="gene_id=mCG19281.2 transcript_id=mCT18850.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(<884256..884267,884857..884935,888803..888992,
FT                   889340..889547,895562..895695,895949..896217,
FT                   896862..897187,900220..900298,900434..900557,
FT                   900636..900778,900919..901097,904335..904481,
FT                   904599..904715,904935..905270)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19281"
FT                   /product="mCG19281, isoform CRA_a"
FT                   /note="gene_id=mCG19281.2 transcript_id=mCT18850.2
FT                   protein_id=mCP22293.2 isoform=CRA_a"
FT                   /protein_id="EDL02449.1"
FT                   /translation="TPPQPRLRSGLQLPPALLLLLLFSVLGPGAGGLFLTDYSTCSPRK
FT                   LSPFRSFASTELFHFHVPEDTFLAVWNLIIFKEQGGTFGDHCPDQSVTVYFRSGAPPVI
FT                   NPLHTHFPADTAVPGVFSLTLSWTLPNRTSGIFNVSSPLPGDWFLAAHLPQAHGHISVK
FT                   GLQDECQYLLQPQLIVRRLLDVAVLVPGRPSEQTLSSHNRSALYKVFVPSFTYRVSAQL
FT                   VCVGGRGASVCPLTLRLRPKAPPLHNSSSVACGGASVCQLELALPPWGHWVYVRVETPS
FT                   RGPGRTISFQLCVRLQECPQPSLSRALVPGAAMNMPQSLGTQPLPPEPPSLGTPIEGSG
FT                   AIAPTEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFALRLLPVLDSGGVLS
FT                   LELQLNAENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATSRVARLRIPFPQT
FT                   GTWFLTLRSLCGVGPRFVRCRNATAEVRLRTFLSPCVDDCGPYGQCKLLRTHNYLYAAC
FT                   ECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFT
FT                   MFFSTFYHACDQPGIVVFCIMDYDVLQFCDFLGSLMSVWVTVIAMARLQPVIKQVLYLL
FT                   GAMLLSMALQLDRHGLWNLLGPSLFALGILATAWTVRSVRRRHCYPPTWRRWLFYLCPG
FT                   SLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGSVGFLLPPRAKTDRRVPSGARARGCG
FT                   YQLCINEQEELGLVGPGGTTVSSICVS"
FT   gene            complement(910322..915620)
FT                   /locus_tag="mCG_19275"
FT                   /note="gene_id=mCG19275.1"
FT   mRNA            complement(join(910322..912092,915556..915620))
FT                   /locus_tag="mCG_19275"
FT                   /product="mCG19275"
FT                   /note="gene_id=mCG19275.1 transcript_id=mCT18839.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(911027..911977)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19275"
FT                   /product="mCG19275"
FT                   /note="gene_id=mCG19275.1 transcript_id=mCT18839.1
FT                   protein_id=mCP22279.0"
FT                   /db_xref="GOA:Q8VFM2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFM2"
FT                   /protein_id="EDL02448.1"
FT                   /translation="MAGTNHTEVIEYVLLGLQDHHGLEIALFVLCLGIYCMTLLGNSFL
FT                   VGLIVLDTHLHSPMYFFISNLSLIDICGTSSFTPMMLLNFLDVQRTISFPSCALQMYLT
FT                   LALGTTECLLLAVMAYDRYVAICQPLHYPELMNGPLCIQMAGISWGTGFANSLLHSILV
FT                   WHLPFCGHYIINHFFCEILAVLKLACGDISLNALILTVATAVLTMTPLLLICLSYIFIL
FT                   AAILRVPSAAGRSKAFSTCSAHLTVVVIFYGTITFMYLKPKDQDPSVGKIITLLYAIVA
FT                   PSLNAFIYSLRNSEVKAAVTALLWGGLLTRKMSHF"
FT   gene            complement(<920457..>921395)
FT                   /gene="Olfr71"
FT                   /locus_tag="mCG_19277"
FT                   /note="gene_id=mCG19277.0"
FT   mRNA            complement(<920457..>921395)
FT                   /gene="Olfr71"
FT                   /locus_tag="mCG_19277"
FT                   /product="olfactory receptor 71"
FT                   /note="gene_id=mCG19277.0 transcript_id=mCT18845.0 created
FT                   on 12-JUL-2002"
FT   CDS             complement(920457..921395)
FT                   /codon_start=1
FT                   /gene="Olfr71"
FT                   /locus_tag="mCG_19277"
FT                   /product="olfactory receptor 71"
FT                   /note="gene_id=mCG19277.0 transcript_id=mCT18845.0
FT                   protein_id=mCP22280.0"
FT                   /db_xref="GOA:Q9QZ18"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1860080"
FT                   /db_xref="UniProtKB/TrEMBL:Q9QZ18"
FT                   /protein_id="EDL02447.1"
FT                   /translation="MEPSNRTAVSEFVLKGFSGYPALERLLFPLCSVMYLVTLLGNTAI
FT                   VAVSMLDARLHTPMYFFLGNLSILDICYTSTFVPLMLVHLLSSRKTISFTGCAVQMCLS
FT                   LSTGSTECLLLAVMAYDRYLAICQPLRYPVLMSHRLCLMLAGASWVLCLFKSVAETVIA
FT                   MRLPFCGHHVIRHFTCEILAVLKLTCGDTSVSDAFLLVGAILLLPIPLTLICLSYMLIL
FT                   ATILRVPSATGRSKAFSTCSAHLAVVLLFYSTIIFMYMKPKSKEARISDQVFTVLYAVV
FT                   TPMLNPIIYSLRNKEVKEAARKAWGSRWACR"
FT   assembly_gap    928930..929448
FT                   /estimated_length=519
FT                   /gap_type="unknown"
FT   assembly_gap    934463..934482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            941903..943346
FT                   /locus_tag="mCG_56574"
FT                   /note="gene_id=mCG56574.2"
FT   mRNA            941903..943346
FT                   /locus_tag="mCG_56574"
FT                   /product="mCG56574"
FT                   /note="gene_id=mCG56574.2 transcript_id=mCT56757.1 created
FT                   on 28-AUG-2002"
FT   CDS             942069..942398
FT                   /codon_start=1
FT                   /locus_tag="mCG_56574"
FT                   /product="mCG56574"
FT                   /note="gene_id=mCG56574.2 transcript_id=mCT56757.1
FT                   protein_id=mCP42274.1"
FT                   /protein_id="EDL02446.1"
FT                   /translation="MLGLLGNTTLVCWITGTALAFLMLLWLMALCLFHRSQEHDVERNR
FT                   VRQARPRLFHGRRLRLPRLVHHHHHHHVTGVTSVGVHHHHHHSPHRLHHHKHHHRHHHA
FT                   HGARR"
FT   gene            944772..946803
FT                   /gene="5430416O09Rik"
FT                   /locus_tag="mCG_1041300"
FT                   /note="gene_id=mCG1041300.0"
FT   mRNA            join(944772..944885,945305..946803)
FT                   /gene="5430416O09Rik"
FT                   /locus_tag="mCG_1041300"
FT                   /product="RIKEN cDNA 5430416O09"
FT                   /note="gene_id=mCG1041300.0 transcript_id=mCT159004.0
FT                   created on 28-AUG-2002"
FT   CDS             945772..946113
FT                   /codon_start=1
FT                   /gene="5430416O09Rik"
FT                   /locus_tag="mCG_1041300"
FT                   /product="RIKEN cDNA 5430416O09"
FT                   /note="gene_id=mCG1041300.0 transcript_id=mCT159004.0
FT                   protein_id=mCP53616.1"
FT                   /db_xref="MGI:MGI:1918656"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D3L1"
FT                   /protein_id="EDL02445.1"
FT                   /translation="MTHTPKTQSAAPDVASPWPRFTRRRRSSRGRLSNPGHCRGPRTSG
FT                   LLCEVGNSLDIYSASGSDPSAPSISSVWCLTPPSSPSVSFYVSQTSCLPPFWLALPSLP
FT                   GELRCQDQV"
FT   assembly_gap    949803..949877
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   gene            <966679..974569
FT                   /locus_tag="mCG_144529"
FT                   /note="gene_id=mCG144529.0"
FT   mRNA            join(<966679..966707,970943..970985,971743..972421,
FT                   974364..974569)
FT                   /locus_tag="mCG_144529"
FT                   /product="mCG144529"
FT                   /note="gene_id=mCG144529.0 transcript_id=mCT183953.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<972326..972421,974364..974504)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144529"
FT                   /product="mCG144529"
FT                   /note="gene_id=mCG144529.0 transcript_id=mCT183953.0
FT                   protein_id=mCP105209.0"
FT                   /protein_id="EDL02444.1"
FT                   /translation="GQYDSVPLRRTVLMPNLPVSVEATSLLGEGHQGRMCRTHGSFQKT
FT                   QLVCVSISQAWQYVPDSFLCDKQPHLFLRTASF"
FT   gene            complement(<985081..>986040)
FT                   /locus_tag="mCG_19262"
FT                   /note="gene_id=mCG19262.0"
FT   mRNA            complement(<985081..>986040)
FT                   /locus_tag="mCG_19262"
FT                   /product="mCG19262"
FT                   /note="gene_id=mCG19262.0 transcript_id=mCT18830.0 created
FT                   on 12-JUL-2002"
FT   CDS             complement(985081..986040)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19262"
FT                   /product="mCG19262"
FT                   /note="gene_id=mCG19262.0 transcript_id=mCT18830.0
FT                   protein_id=mCP22282.0"
FT                   /db_xref="GOA:Q9QZ19"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1352686"
FT                   /db_xref="UniProtKB/TrEMBL:Q9QZ19"
FT                   /protein_id="EDL02443.1"
FT                   /translation="MERSNKTTPVSSFILLGLSAHPKLEKTFFVLILLMYLVILLGNVV
FT                   LILVSILDSHLHTPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSGCAVQMFL
FT                   SFAMGATECVLLGMMAFDRYVAICNPLRYPVVMSKAAYVPMAAGSWVSGSITATVQISL
FT                   AMTLPFCGDNVINHFTCEILAVLKLACADISINVISMAVANAMFLGVPVLFIFVSYIFI
FT                   LSTILRIPSAEGRKKAFSTCSAHLTVVLVFYGTILFMYGKPKSKDPLGADKQDLADKLI
FT                   SLFYGVVTPMLNPIIYSLRNKDVKAAVTNLVGQKHFKW"
FT   gene            complement(996345..>997307)
FT                   /locus_tag="mCG_19266"
FT                   /note="gene_id=mCG19266.2"
FT   mRNA            complement(996345..>997307)
FT                   /locus_tag="mCG_19266"
FT                   /product="mCG19266"
FT                   /note="gene_id=mCG19266.2 transcript_id=mCT18834.2 created
FT                   on 12-JUL-2002"
FT   CDS             complement(996468..997307)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19266"
FT                   /product="mCG19266"
FT                   /note="gene_id=mCG19266.2 transcript_id=mCT18834.2
FT                   protein_id=mCP22284.2"
FT                   /protein_id="EDL02442.1"
FT                   /translation="MEINNQTSFPVSSFILLGLSAHPKLEKTFFMLILLMYLVILLGNG
FT                   ILILVSILDSHLHTPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSGCAVQMF
FT                   LSFAMGATECVLLSMMAFDRYVAICNPLRYPVVMNKAAYVPMAVSSWSGGIAVSVVQTS
FT                   LAMKLTFCGDNVINHFTCEILAVLKLACADISINVISMGVTNIIFLGVPVLFISFSYVF
FT                   ILVTILRIPSAEGRKKAFSTCSAHLTVVLVFYGTILFMYGKPKSKDPLGADKQDLAD"
FT   assembly_gap    1001067..1001086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1023727..1023746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1025314..1026616)
FT                   /locus_tag="mCG_19268"
FT                   /note="gene_id=mCG19268.0"
FT   mRNA            complement(1025314..1026616)
FT                   /locus_tag="mCG_19268"
FT                   /product="mCG19268"
FT                   /note="gene_id=mCG19268.0 transcript_id=mCT18836.0 created
FT                   on 12-JUL-2002"
FT   CDS             complement(1025581..1026537)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19268"
FT                   /product="mCG19268"
FT                   /note="gene_id=mCG19268.0 transcript_id=mCT18836.0
FT                   protein_id=mCP22285.1"
FT                   /db_xref="GOA:Q8VGA9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1352683"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGA9"
FT                   /protein_id="EDL02441.1"
FT                   /translation="MEGANQSTVAEFVLLGLSDHPKLEKTFFVLILLMYLVILLGNGVL
FT                   ILVSILDSHLHTPMYFFLGNLSFLDICYTTSSIPLVLDGFLTPRKTISFSGCAVQMFLS
FT                   FAMGATECVLLGMMAFDRYVAICNPLRYPVVMNKSAYVPMAVSSWVAGGANSLVQISLA
FT                   VQLPFCGDNVINHFTCEILAVLKLACADISINVISMGVANVIFLGVPVLFIFVSYIFIL
FT                   STILRIPSAEGRKKAFSTCSAHLTVVLVFYGTILFMYGKPKSKDPLGADKQDVSDKLIS
FT                   LFYGVLTPMLNPIIYSLRNKDVKAAVRNLVGQKCLIQ"
FT   gene            complement(1039931..1041697)
FT                   /locus_tag="mCG_19270"
FT                   /note="gene_id=mCG19270.1"
FT   mRNA            complement(1039931..1041697)
FT                   /locus_tag="mCG_19270"
FT                   /product="mCG19270"
FT                   /note="gene_id=mCG19270.1 transcript_id=mCT18840.1 created
FT                   on 12-JUL-2002"
FT   CDS             complement(1040711..1041667)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19270"
FT                   /product="mCG19270"
FT                   /note="gene_id=mCG19270.1 transcript_id=mCT18840.1
FT                   protein_id=mCP22286.2"
FT                   /db_xref="GOA:Q9QZ20"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1352684"
FT                   /db_xref="UniProtKB/TrEMBL:Q9QZ20"
FT                   /protein_id="EDL02440.1"
FT                   /translation="MDVSNQTTVTEFVLLGLSAHPKLEKTFFVLILSMYLVILLGNGVL
FT                   ILVSILDSHLHTPMYFFLGNLSFLDICYTTSSVPLVLDGFLTPRKTISFSGCAVQMFLS
FT                   FAMGATECVLLGMMAFDRYVAICNPLRYPVVMNKAAYVPMAVSSWVAGGANSLVQISLA
FT                   VQLPFCGDNVINHFICEILAVLKLACADISINVISMGVANVIFLGVPVLFIFVSYIFIL
FT                   STILRIPSAEGRKKAFSTCSAHLTVVIIFYGTILFMYGKPKSKDPLGADKQDLADKLIS
FT                   LFYGLLTPMLNPIIYSLRNKDVKAAVRNLASHRCLTF"
FT   gene            1059462..1060633
FT                   /locus_tag="mCG_19272"
FT                   /note="gene_id=mCG19272.0"
FT   mRNA            1059462..1060633
FT                   /locus_tag="mCG_19272"
FT                   /product="mCG19272"
FT                   /note="gene_id=mCG19272.0 transcript_id=mCT18842.1 created
FT                   on 12-JUL-2002"
FT   CDS             1059481..1060440
FT                   /codon_start=1
FT                   /locus_tag="mCG_19272"
FT                   /product="mCG19272"
FT                   /note="gene_id=mCG19272.0 transcript_id=mCT18842.1
FT                   protein_id=mCP22287.1"
FT                   /db_xref="GOA:Q9QZ22"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1352681"
FT                   /db_xref="UniProtKB/TrEMBL:Q9QZ22"
FT                   /protein_id="EDL02439.1"
FT                   /translation="MDRSNETAPLSGFILLGLSAHPKLEKTFFVLILMMYLVILLGNGV
FT                   LILVSILDSHLHTPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSGCAVQMFL
FT                   SFAMGATECVLLSMMAFDRYVAICNPLRYPVVMNKAAYVPMAASSWAGGITNSVVQTSL
FT                   AMRLPFCGDNVINHFTCEILAVLKLACADISINVISMVVANMIFLAVPVLFIFVSYVFI
FT                   LVTILRIPSAEGRKKAFSTCSAHLTVVLVFYGTILFMYGKPKSKDPLGADKQDLADKLI
FT                   SLFYGVVTPMLNPIIYSLRNKDVRAAVRNLVGQKHLTE"
FT   assembly_gap    1069506..1069525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1083189..1138281
FT                   /locus_tag="mCG_124394"
FT                   /note="gene_id=mCG124394.0"
FT   mRNA            join(1083189..1083294,1098553..1098611,1102425..1102499,
FT                   1103456..1103492,1105601..1105686,1107676..1107723,
FT                   1116796..1116829,1119148..1119345,1120993..1121260,
FT                   1125523..1125702,1130002..1130214,1132272..1132408,
FT                   1134357..1134497,1135489..1135677,1137405..1137527,
FT                   1138101..1138281)
FT                   /locus_tag="mCG_124394"
FT                   /product="mCG124394"
FT                   /note="gene_id=mCG124394.0 transcript_id=mCT125635.0
FT                   created on 12-JUL-2002"
FT   CDS             join(1083195..1083294,1098553..1098611,1102425..1102499,
FT                   1103456..1103492,1105601..1105686,1107676..1107723,
FT                   1116796..1116829,1119148..1119345,1120993..1121260,
FT                   1125523..1125702,1130002..1130214,1132272..1132408,
FT                   1134357..1134497,1135489..1135677,1137405..1137527,
FT                   1138101..1138276)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124394"
FT                   /product="mCG124394"
FT                   /note="gene_id=mCG124394.0 transcript_id=mCT125635.0
FT                   protein_id=mCP53382.1"
FT                   /protein_id="EDL02438.1"
FT                   /translation="MASVRASPRSALLLLLAAAGVAEVTGGLAPGSAGAVCCNHSKDNQ
FT                   MCRDVCEQIFSSKSESRLKHLLQRAPDYCPETMVEIWSCMNSSLPGVFKKSDGWVGLGC
FT                   CELAIGLECRQACKQASSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCRE
FT                   FCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAED
FT                   HACQNACKRILMSKKTEMEIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPPP
FT                   STGLDGAKLHCCSKANTSTCRELCTKLYSMSWGNTQSWQEFDRICEYNPVEVSMLTCLA
FT                   DVREPCQLGCTNLTYCTNFNNRPTELFRSCTAQSDQGAMSDMKLWEKGSIKMPFISIPV
FT                   LDIKTCQPEMWKAVACSLQIKPCHSKSRGSIICKSDCVEILKKCGDQNKFPEEHTAESI
FT                   CEFLSPADDLESCIPLDTYLRPSALGNIIEEVTHPCNPNPCPANELCEVNRKGCPSADP
FT                   CLPYSCVQGCKLGEASDFIVRQGTLIQVPSSAGEVGCYKICSCGQSGLLENCMEMHCID
FT                   LQKSCIVGGKRKSHGTSFTIDCNVCSCFAGNLVCSTRLCLSEHSSDDDRRTFTGLPCNC
FT                   ADQFVPVCAQNGRTYPSACIARCVGLQDHQFEFGPCISKNPCNPNLCPKSQR"
FT   assembly_gap    1113563..1113582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1115455..1115474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1142933..1151844
FT                   /estimated_length=8912
FT                   /gap_type="unknown"
FT   gene            1159082..1180634
FT                   /gene="Glipr2"
FT                   /locus_tag="mCG_117779"
FT                   /note="gene_id=mCG117779.1"
FT   mRNA            join(1159082..1159165,1169525..1169633,1169985..1170088,
FT                   1171913..1171990,1178867..1179706,1179828..1180634)
FT                   /gene="Glipr2"
FT                   /locus_tag="mCG_117779"
FT                   /product="GLI pathogenesis-related 2"
FT                   /note="gene_id=mCG117779.1 transcript_id=mCT118930.1
FT                   created on 19-JUN-2003"
FT   CDS             join(1159153..1159165,1169525..1169633,1169985..1170088,
FT                   1171913..1171990,1178867..1179027)
FT                   /codon_start=1
FT                   /gene="Glipr2"
FT                   /locus_tag="mCG_117779"
FT                   /product="GLI pathogenesis-related 2"
FT                   /note="gene_id=mCG117779.1 transcript_id=mCT118930.1
FT                   protein_id=mCP53566.1"
FT                   /protein_id="EDL02437.1"
FT                   /translation="MGKSASKQFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEA
FT                   LASTRILKHSPESSRGQCGENLAWASYDQTGKDVADRWYSEIKSYNFQQPGFTSGTGHF
FT                   TAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENVPPPKK"
FT   assembly_gap    1166305..1166336
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    1179728..1179811
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   gene            1185020..1187048
FT                   /gene="Ccin"
FT                   /locus_tag="mCG_51613"
FT                   /note="gene_id=mCG51613.1"
FT   mRNA            1185020..1187048
FT                   /gene="Ccin"
FT                   /locus_tag="mCG_51613"
FT                   /product="calicin"
FT                   /note="gene_id=mCG51613.1 transcript_id=mCT51796.1 created
FT                   on 01-OCT-2002"
FT   CDS             1185113..1186879
FT                   /codon_start=1
FT                   /gene="Ccin"
FT                   /locus_tag="mCG_51613"
FT                   /product="calicin"
FT                   /note="gene_id=mCG51613.1 transcript_id=mCT51796.1
FT                   protein_id=mCP42269.1"
FT                   /db_xref="GOA:B2RX51"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR011705"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="MGI:MGI:3045316"
FT                   /db_xref="UniProtKB/TrEMBL:B2RX51"
FT                   /protein_id="EDL02436.1"
FT                   /translation="MKLEFTEKNYNSFVLQNLNKQRKRKEYWDMALTVDHHVFFAHRNV
FT                   LAAVSPLVKSLISSNDMKTTDELYITIDPNYLSPATVDQLLDYFYSGKVVISEQNVEEL
FT                   LRGAQYFNTPRLRIHCNDFLIKSIRRVNCLRYLFLAELFELKEVSDLAYSGIRDNFHFW
FT                   ASPEGSMHFMRCPPVIFGRLLRDENLHVLNEDQALSALISWVYFRKEEREKYFKKFFNY
FT                   INLNAVSNKTLMFASNKLVGLENNSAHATLIESVLMDRKQERPCSLLSYQRKGALLDSV
FT                   VILGGQKAHGKFNDGVFAYIIQENLWLKLSEMPYRAAALSATAAGRYIYISGGTTEQIS
FT                   GLKTAWRYDMDDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYDER
FT                   KEAWCLAGKMSIPMDGTAVITKGDRNLYIVTGRCLVKGYISRVGVVDCFDTCTGEVVQC
FT                   ITFPIEFNHRPLLSFHQDNILRVHSHRQSVEINLQKIKANKSTTSVPLLPNSCPLDVSH
FT                   AICSIGDSKVFVCGGVTTASDVQTKDYTINPNAYLLDQKIGEWQTLACPPEALDCPACC
FT                   LAKLPCKILQRI"
FT   assembly_gap    1197824..1197843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1202702..1202721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1212059..1212078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1214185..1234348
FT                   /gene="Clta"
FT                   /locus_tag="mCG_16456"
FT                   /note="gene_id=mCG16456.2"
FT   mRNA            join(1214185..1214509,1220314..1220351,1221375..1221492,
FT                   1226950..1227061,1231716..1231769,1233899..1234344)
FT                   /gene="Clta"
FT                   /locus_tag="mCG_16456"
FT                   /product="clathrin, light polypeptide (Lca), transcript
FT                   variant mCT17967"
FT                   /note="gene_id=mCG16456.2 transcript_id=mCT17967.1 created
FT                   on 12-JUL-2002"
FT   mRNA            join(1214236..1214509,1220314..1220351,1221375..1221492,
FT                   1226950..1227061,1233899..1234348)
FT                   /gene="Clta"
FT                   /locus_tag="mCG_16456"
FT                   /product="clathrin, light polypeptide (Lca), transcript
FT                   variant mCT170615"
FT                   /note="gene_id=mCG16456.2 transcript_id=mCT170615.0 created
FT                   on 12-JUL-2002"
FT   CDS             join(1214293..1214509,1220314..1220351,1221375..1221492,
FT                   1226950..1227061,1231716..1231769,1233899..1234070)
FT                   /codon_start=1
FT                   /gene="Clta"
FT                   /locus_tag="mCG_16456"
FT                   /product="clathrin, light polypeptide (Lca), isoform CRA_c"
FT                   /note="gene_id=mCG16456.2 transcript_id=mCT17967.1
FT                   protein_id=mCP22290.2 isoform=CRA_c"
FT                   /db_xref="GOA:B1AWD8"
FT                   /db_xref="InterPro:IPR000996"
FT                   /db_xref="MGI:MGI:894297"
FT                   /db_xref="UniProtKB/TrEMBL:B1AWD8"
FT                   /protein_id="EDL02435.1"
FT                   /translation="MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAG
FT                   IENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISEVDRLQ
FT                   SEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRV
FT                   ADEAFYKQPFADLIGYVAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRM
FT                   RSVLISLKQAPLVH"
FT   CDS             join(1214293..1214509,1220314..1220351,1221375..1221492,
FT                   1226950..1227061,1233899..1234070)
FT                   /codon_start=1
FT                   /gene="Clta"
FT                   /locus_tag="mCG_16456"
FT                   /product="clathrin, light polypeptide (Lca), isoform CRA_b"
FT                   /note="gene_id=mCG16456.2 transcript_id=mCT170615.0
FT                   protein_id=mCP93532.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6PFA2"
FT                   /db_xref="InterPro:IPR000996"
FT                   /db_xref="MGI:MGI:894297"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PFA2"
FT                   /protein_id="EDL02434.1"
FT                   /translation="MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAG
FT                   IENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISEVDRLQ
FT                   SEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRA
FT                   AEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH"
FT   mRNA            join(1214430..1214442,1214482..1214509,1220314..1220351,
FT                   1221375..1221492,1226950..1227061,1233936..1234325)
FT                   /gene="Clta"
FT                   /locus_tag="mCG_16456"
FT                   /product="clathrin, light polypeptide (Lca), transcript
FT                   variant mCT170614"
FT                   /note="gene_id=mCG16456.2 transcript_id=mCT170614.0 created
FT                   on 12-JUL-2002"
FT   CDS             join(1220331..1220351,1221375..1221492,1226950..1227061,
FT                   1233936..1234047)
FT                   /codon_start=1
FT                   /gene="Clta"
FT                   /locus_tag="mCG_16456"
FT                   /product="clathrin, light polypeptide (Lca), isoform CRA_a"
FT                   /note="gene_id=mCG16456.2 transcript_id=mCT170614.0
FT                   protein_id=mCP93533.0 isoform=CRA_a"
FT                   /protein_id="EDL02433.1"
FT                   /translation="MNGEYYQESNGPTDSYAAISEVDRLQSEPESIRKWREEQTERLEA
FT                   LDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNSHPQALSGSGWPACVTLTPSP
FT                   ANRPKMSLACAQSSSP"
FT   gene            complement(1238229..1286179)
FT                   /gene="Gne"
FT                   /locus_tag="mCG_16457"
FT                   /note="gene_id=mCG16457.2"
FT   mRNA            complement(join(1238229..1238851,1240445..1240561,
FT                   1241752..1241934,1243161..1243382,1243661..1243790,
FT                   1246257..1246467,1247401..1247488,1254270..1254482,
FT                   1256704..1256856,1261275..1261726,1268615..1268820,
FT                   1286075..1286179))
FT                   /gene="Gne"
FT                   /locus_tag="mCG_16457"
FT                   /product="glucosamine"
FT                   /note="gene_id=mCG16457.2 transcript_id=mCT18007.1 created
FT                   on 12-JUL-2002"
FT   CDS             complement(join(1238616..1238851,1240445..1240561,
FT                   1241752..1241934,1243161..1243382,1243661..1243790,
FT                   1246257..1246467,1247401..1247488,1254270..1254482,
FT                   1256704..1256856,1261275..1261726,1268615..1268778))
FT                   /codon_start=1
FT                   /gene="Gne"
FT                   /locus_tag="mCG_16457"
FT                   /product="glucosamine"
FT                   /note="gene_id=mCG16457.2 transcript_id=mCT18007.1
FT                   protein_id=mCP22292.0"
FT                   /db_xref="GOA:Q3TCI8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="MGI:MGI:1354951"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TCI8"
FT                   /protein_id="EDL02432.1"
FT                   /translation="MEKNGNNRKLRVCVATCNRADYSKLAPIMFGIKTEPAFFELDVVV
FT                   LGSHLIDDYGNTYRMIEQDDFDINTRLHTIVRGEDEAAMVESVGLALVKLPDVLNRLKP
FT                   DIMIVHGDRFDALALATSAALMNIRILHIEGGEVSGTIDDSIRHAITKLAHYHVCCTRS
FT                   AEQHLISMCEDHDRILLAGCPSYDKLLSAKNKDYMSIIRMWLGDDVKCKDYIVALQHPV
FT                   TTDIKHSIKMFELTLDALISFNKRTLVLFPNIDAGSKEMVRVMRKKGIEHHPNFRAVKH
FT                   VPFDQFIQLVAHAGCMIGNSSCGVREVGAFGTPVINLGTRQIGRETGENVLHVRDADTQ
FT                   DKILQALHLQFGKQYPCSKIYGDGNAVPRILKFLKSIDLQEPLQKKFCFPPVKENISQD
FT                   IDHILETLSALAVDLGGTNLRVAIVSMKGEIVKKYTQFNPKTYEERISLILQMCVEAAA
FT                   EAVKLNCRILGVGISTGGRVNPQEGVVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDND
FT                   GNCAAMAERKFGQGKGQENFVTLITGTGIGGGIIHQHELIHGSSFCAAELGHLVVSLDG
FT                   PDCSCGSHGCIEAYASGMALQREAKKLHDEDLLLVEGMSVPKDEAVGALHLIQAAKLGN
FT                   VKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLASHYIHIVKDVIRQQALSSVQDV
FT                   DVVVSDLVDPALLGAASMVLDYTTRRIH"
FT   assembly_gap    1263135..1263154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1266276..1266295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1270301..1270320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1279262..1279281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1281464..1281785
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   gene            1294663..1311331
FT                   /locus_tag="mCG_147029"
FT                   /note="gene_id=mCG147029.0"
FT   mRNA            join(1294663..1294808,1308351..1311331)
FT                   /locus_tag="mCG_147029"
FT                   /product="mCG147029"
FT                   /note="gene_id=mCG147029.0 transcript_id=mCT187292.0
FT                   created on 13-JAN-2004"
FT   CDS             1309205..1309441
FT                   /codon_start=1
FT                   /locus_tag="mCG_147029"
FT                   /product="mCG147029"
FT                   /note="gene_id=mCG147029.0 transcript_id=mCT187292.0
FT                   protein_id=mCP108163.0"
FT                   /protein_id="EDL02431.1"
FT                   /translation="MCIHHTHATNTHSRKEGFYELGMVTLAYNTRISRGRGRAVVLGHP
FT                   QLHSKLEASLVGCPWDSVLNNKRAIVESCHVDS"
FT   assembly_gap    1313819..1313906
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   gene            1325030..1326078
FT                   /locus_tag="mCG_1041267"
FT                   /note="gene_id=mCG1041267.1"
FT   mRNA            1325030..1326078
FT                   /locus_tag="mCG_1041267"
FT                   /product="mCG1041267"
FT                   /note="gene_id=mCG1041267.1 transcript_id=mCT158971.1
FT                   created on 01-OCT-2002"
FT   CDS             1325100..1325405
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041267"
FT                   /product="mCG1041267"
FT                   /note="gene_id=mCG1041267.1 transcript_id=mCT158971.1
FT                   protein_id=mCP53401.1"
FT                   /db_xref="InterPro:IPR004931"
FT                   /db_xref="MGI:MGI:3651567"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CAQ5"
FT                   /protein_id="EDL02430.1"
FT                   /translation="MSDEAVDTSSEITTKDLNEKEEVVEEAESGRDAPANGNAQNEENG
FT                   EQEAGNEVDEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVDTKKQKTEEDD"
FT   gene            complement(1328080..>1369499)
FT                   /gene="Rnf38"
FT                   /locus_tag="mCG_16453"
FT                   /note="gene_id=mCG16453.3"
FT   mRNA            complement(join(1328080..1331518,1333406..1333505,
FT                   1335474..1335595,1336724..1336808,1339389..1339495,
FT                   1340504..1340665,1344130..1344300,1345283..1345450,
FT                   1350875..1351088,1354209..1354402,1369167..>1369364))
FT                   /gene="Rnf38"
FT                   /locus_tag="mCG_16453"
FT                   /product="ring finger protein 38, transcript variant
FT                   mCT189505"
FT                   /note="gene_id=mCG16453.3 transcript_id=mCT189505.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(1328081..1331518,1333406..1333505,
FT                   1335474..1335595,1336724..1336808,1339389..1339495,
FT                   1340504..1340665,1344130..1344300,1345283..1345450,
FT                   1350875..1351088,1354209..1354402,1369315..1369499))
FT                   /gene="Rnf38"
FT                   /locus_tag="mCG_16453"
FT                   /product="ring finger protein 38, transcript variant
FT                   mCT17964"
FT                   /note="gene_id=mCG16453.3 transcript_id=mCT17964.2 created
FT                   on 23-AUG-2002"
FT   mRNA            complement(join(1331286..1331518,1333406..1333505,
FT                   1336724..1336808,1339389..1339495,1340504..1340665,
FT                   1344130..1344300,1345283..1345450,1350875..1351088,
FT                   1354209..1354402,1369315..>1369499))
FT                   /gene="Rnf38"
FT                   /locus_tag="mCG_16453"
FT                   /product="ring finger protein 38, transcript variant
FT                   mCT189506"
FT                   /note="gene_id=mCG16453.3 transcript_id=mCT189506.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1331456..1331518,1333406..1333505,
FT                   1335474..1335595,1336724..1336808,1339389..1339495,
FT                   1340504..1340665,1344130..1344300,1345283..1345450,
FT                   1350875..1351088,1354209..1354402,1369167..>1369178))
FT                   /codon_start=1
FT                   /gene="Rnf38"
FT                   /locus_tag="mCG_16453"
FT                   /product="ring finger protein 38, isoform CRA_a"
FT                   /note="gene_id=mCG16453.3 transcript_id=mCT189505.0
FT                   protein_id=mCP110486.0 isoform=CRA_a"
FT                   /protein_id="EDL02427.1"
FT                   /translation="RMRESEDSPSPKRQRLSHSVFDYTSASPAPSPPMRPWEMTSNRQP
FT                   PSVRPNQHHFSGERCNTPARNRRSPPVRRQRGRRERLSRHNSISQDENYHHLPYAQQQA
FT                   IEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQLHQGTVPVSYTVTTVAPHGLPLC
FT                   TGQHIPACSTQQVPGCSVVFSGQHLPVCSVPPPMLQACSVQHLPVPYAAFPPLISSDPF
FT                   LIHPPHLSPHHPPHLPPPGQFVPFQTQQSRSPLQRIENEVELLGEHLQVGSFTYPPSAH
FT                   PPTLPPSAPLQFLTHDPLHQEVSFGVPYPPFMPRRLTGRSRYRSQQPMPPPPYHPSLLP
FT                   YVLSMLPVPPAVGPTFSFELDVEDGEVENYEALLNLAERLGEAKPRGLTKADIEQLPSY
FT                   RFNPSNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICRADAS
FT                   EVHRDSE"
FT   CDS             complement(join(1331456..1331518,1333406..1333505,
FT                   1335474..1335595,1336724..1336808,1339389..1339495,
FT                   1340504..1340665,1344130..1344300,1345283..1345450,
FT                   1350875..1351088,1354209..1354315))
FT                   /codon_start=1
FT                   /gene="Rnf38"
FT                   /locus_tag="mCG_16453"
FT                   /product="ring finger protein 38, isoform CRA_c"
FT                   /note="gene_id=mCG16453.3 transcript_id=mCT17964.2
FT                   protein_id=mCP22302.2 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="MGI:MGI:1920719"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UH35"
FT                   /protein_id="EDL02429.1"
FT                   /translation="MRPWEMTSNRQPPSVRPNQHHFSGERCNTPARNRRSPPVRRQRGR
FT                   RERLSRHNSISQDENYHHLPYAQQQAIEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDI
FT                   HDQLHQGTVPVSYTVTTVAPHGLPLCTGQHIPACSTQQVPGCSVVFSGQHLPVCSVPPP
FT                   MLQACSVQHLPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPPGQFVPFQTQQSRSPL
FT                   QRIENEVELLGEHLQVGSFTYPPSAHPPTLPPSAPLQFLTHDPLHQEVSFGVPYPPFMP
FT                   RRLTGRSRYRSQQPMPPPPYHPSLLPYVLSMLPVPPAVGPTFSFELDVEDGEVENYEAL
FT                   LNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSEQTLCVVCMCDFESRQLLRVLPCN
FT                   HEFHAKCVDKWLKGNRTCPICRADASEVHRDSE"
FT   CDS             complement(join(1333485..1333505,1336724..1336808,
FT                   1339389..1339495,1340504..1340665,1344130..1344300,
FT                   1345283..1345450,1350875..1351088,1354209..1354402,
FT                   1369315..>1369497))
FT                   /codon_start=1
FT                   /gene="Rnf38"
FT                   /locus_tag="mCG_16453"
FT                   /product="ring finger protein 38, isoform CRA_b"
FT                   /note="gene_id=mCG16453.3 transcript_id=mCT189506.0
FT                   protein_id=mCP110487.0 isoform=CRA_b"
FT                   /protein_id="EDL02428.1"
FT                   /translation="RAEPPLAGTGGDGRWLPREGGTGRGRLGAGGPRSADVSRQPGALC
FT                   SRGGGEPARPCLDETQSEDSPSPKRQRLSHSVFDYTSASPAPSPPMRPWEMTSNRQPPS
FT                   VRPNQHHFSGERCNTPARNRRSPPVRRQRGRRERLSRHNSISQDENYHHLPYAQQQAIE
FT                   EPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQLHQGTVPVSYTVTTVAPHGLPLCTG
FT                   QHIPACSTQQVPGCSVVFSGQHLPVCSVPPPMLQACSVQHLPVPYAAFPPLISSDPFLI
FT                   HPPHLSPHHPPHLPPPGQFVPFQTQQSRSPLQRIENEVELLGEHLQVGSFTYPPSAHPP
FT                   TLPPSAPLQFLTHDPLHQEVSFGVPYPPFMPRRLTGRSRYRSQQPMPPPPYHPSLLPYV
FT                   LSMLPVPPAVGPTFSFELDVEDGEVENYEVCSMHV"
FT   assembly_gap    1392366..1394868
FT                   /estimated_length=2503
FT                   /gap_type="unknown"
FT   assembly_gap    1400617..1400636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1402042..1402061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1436741..1437158
FT                   /estimated_length=418
FT                   /gap_type="unknown"
FT   assembly_gap    1441161..1441441
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    1455610..1459262
FT                   /estimated_length=3653
FT                   /gap_type="unknown"
FT   assembly_gap    1466991..1467314
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    1471788..1471807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1473103..1473198
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    1476916..1477327
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    1486288..1486781
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   gene            <1500835..1565016
FT                   /gene="Melk"
FT                   /locus_tag="mCG_16451"
FT                   /note="gene_id=mCG16451.2"
FT   mRNA            join(1500835..1500929,1503564..1503659,1506016..1506101,
FT                   1506974..1507090,1508890..1509033,1510274..1510342,
FT                   1512148..1512240,1518076..1518174,1524242..1524310,
FT                   1525683..1525781,1533291..1533377,1540964..1541087,
FT                   1545251..1545355,1547456..1547687,1550180..1550276,
FT                   1551278..1551446,1561213..1561316,1564051..1565016)
FT                   /gene="Melk"
FT                   /locus_tag="mCG_16451"
FT                   /product="maternal embryonic leucine zipper kinase,
FT                   transcript variant mCT17962"
FT                   /note="gene_id=mCG16451.2 transcript_id=mCT17962.2 created
FT                   on 12-JUL-2002"
FT   mRNA            join(<1500835..1500929,1503564..1503659,1506016..1506101,
FT                   1506974..1507090,1508890..1509033,1510274..1510342,
FT                   1512148..1512240,1518076..1518174,1524242..1524310,
FT                   1525683..1525781,1533291..1533377,1540964..1541083,
FT                   1545245..1545355,1547456..1547687,1550180..1550276,
FT                   1551278..1551446,1561213..1561316,1564051..1564635)
FT                   /gene="Melk"
FT                   /locus_tag="mCG_16451"
FT                   /product="maternal embryonic leucine zipper kinase,
FT                   transcript variant mCT189504"
FT                   /note="gene_id=mCG16451.2 transcript_id=mCT189504.0 created
FT                   on 08-MAR-2004"
FT   assembly_gap    1501917..1502027
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   CDS             join(<1503587..1503659,1506016..1506101,1506974..1507090,
FT                   1508890..1509033,1510274..1510342,1512148..1512240,
FT                   1518076..1518174,1524242..1524310,1525683..1525781,
FT                   1533291..1533377,1540964..1541083,1545245..1545355,
FT                   1547456..1547687,1550180..1550276,1551278..1551446,
FT                   1561213..1561316,1564051..1564228)
FT                   /codon_start=1
FT                   /gene="Melk"
FT                   /locus_tag="mCG_16451"
FT                   /product="maternal embryonic leucine zipper kinase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16451.2 transcript_id=mCT189504.0
FT                   protein_id=mCP110485.0 isoform=CRA_b"
FT                   /protein_id="EDL02426.1"
FT                   /translation="PSRWTMKDYDELLKYYELYETIGTGGFAKVKLACHVLTGEMVAIK
FT                   IMDKNALGSDLPRVKTEIDALKSLRHQHICQLYHVLETKNKIFMVLEYCPGGELFDYII
FT                   SQDRLSEEETRVVFRQILSAVAYVHSQGYAHRDLKPENLLFDENHKLKLIDFGLCAKPK
FT                   GNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMAL
FT                   YKKIMRGKYEVPKWLSPSSILLLQQMLQVDPKKRISMRNLLNHPWVMQDYSCPVEWQSK
FT                   TPLTHLDEDCVTELSVHHRSSRQTMEDLISSWQYDHLTATYLLLLAKKARGKPARLQLL
FT                   SFSCGTASTTPKSKNLSLEDMSTSDDNCVAGLIDYELCEDKLLAPKTPQVTKHLAESNH
FT                   AASKSPAPGVRRAVANKLMDKENVCTPKSSVKNEEQFVFSEPKIPVSKNQYKREIPASP
FT                   TRFPTPAKARAQCLREAPVRTPGNSAGADTLTTGVISPERRCRSMDVDLNQAHMEDTPK
FT                   KKGTNVFGSLERGLDKVLTALTRNKKKGSARDGPRKRKLHYNVTTTRLVNPDQLLSEIM
FT                   AILPKKNVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQRPDVVGIRRQRLKGDAWVY
FT                   KRLVEDILSGCKM"
FT   CDS             join(1503602..1503659,1506016..1506101,1506974..1507090,
FT                   1508890..1509033,1510274..1510342,1512148..1512240,
FT                   1518076..1518174,1524242..1524310,1525683..1525781,
FT                   1533291..1533377,1540964..1541087,1545251..1545282)
FT                   /codon_start=1
FT                   /gene="Melk"
FT                   /locus_tag="mCG_16451"
FT                   /product="maternal embryonic leucine zipper kinase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16451.2 transcript_id=mCT17962.2
FT                   protein_id=mCP22294.2 isoform=CRA_a"
FT                   /protein_id="EDL02425.1"
FT                   /translation="MKDYDELLKYYELYETIGTGGFAKVKLACHVLTGEMVAIKIMDKN
FT                   ALGSDLPRVKTEIDALKSLRHQHICQLYHVLETKNKIFMVLEYCPGGELFDYIISQDRL
FT                   SEEETRVVFRQILSAVAYVHSQGYAHRDLKPENLLFDENHKLKLIDFGLCAKPKGNKDY
FT                   HLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIM
FT                   RGKYEVPKWLSPSSILLLQQMLQVDPKKRISMRNLLNHPWVMQDYSCPVEWQSKTPLTH
FT                   LDEDCVTELSVHHRSSRQTMEDLISSWQYDHLTATYLLLLAKKARGKPARLQLLSFSCG
FT                   TASTTPKAKSEPGRYEHK"
FT   assembly_gap    1513545..1513564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1527415..1527434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1528723..1529236
FT                   /estimated_length=514
FT                   /gap_type="unknown"
FT   assembly_gap    1569383..1569402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1580936..1581057
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    1582486..1582524
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   gene            <1583315..1597572
FT                   /locus_tag="mCG_55329"
FT                   /note="gene_id=mCG55329.1"
FT   mRNA            join(<1583315..1583670,1597249..1597572)
FT                   /locus_tag="mCG_55329"
FT                   /product="mCG55329"
FT                   /note="gene_id=mCG55329.1 transcript_id=mCT55512.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(<1583444..1583670,1597249..1597402)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55329"
FT                   /product="mCG55329"
FT                   /note="gene_id=mCG55329.1 transcript_id=mCT55512.2
FT                   protein_id=mCP42282.2"
FT                   /protein_id="EDL02424.1"
FT                   /translation="DLHQRDGTTSAAKEKRRSEGVAKVIMKIYISLKWGTKKKFKDPSA
FT                   PKRPPPAFLLCSEYRPQPADLVKKLGEMWNRKEKKRKKKKKKKKKKKKKKKKKKKKKKK
FT                   KKKKKKKKRNSASKNQRGVWGE"
FT   assembly_gap    1591717..1591736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1593298..1593483
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    1594367..1594386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1599206..1599225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1608100..1608401
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   gene            complement(<1624511..1625128)
FT                   /locus_tag="mCG_1041398"
FT                   /note="gene_id=mCG1041398.1"
FT   mRNA            complement(<1624511..1625128)
FT                   /locus_tag="mCG_1041398"
FT                   /product="mCG1041398"
FT                   /note="gene_id=mCG1041398.1 transcript_id=mCT159102.1
FT                   created on 01-OCT-2002"
FT   CDS             complement(1624511..1624879)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041398"
FT                   /product="mCG1041398"
FT                   /note="gene_id=mCG1041398.1 transcript_id=mCT159102.1
FT                   protein_id=mCP53601.0"
FT                   /protein_id="EDL02423.1"
FT                   /translation="MSVQPLRLINFPILSANKSCSGDHSPDDSSSGTAADFSRSTRSQS
FT                   IKEAARACQVLSPAAAPRCPSPRCGGRQPHCSHRGGDSPARGPSPRGVSGPSGRRPHGS
FT                   GSRPSELPPAQARAARIN"
FT   assembly_gap    1637878..1637903
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    1644082..1644111
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    1703135..1703154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1725439..1726596)
FT                   /locus_tag="mCG_141253"
FT                   /note="gene_id=mCG141253.0"
FT   mRNA            complement(join(1725439..1725593,1725689..1726596))
FT                   /locus_tag="mCG_141253"
FT                   /product="mCG141253"
FT                   /note="gene_id=mCG141253.0 transcript_id=mCT174088.0
FT                   created on 01-OCT-2002"
FT   CDS             complement(join(1725464..1725593,1725689..1726134))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141253"
FT                   /product="mCG141253"
FT                   /note="gene_id=mCG141253.0 transcript_id=mCT174088.0
FT                   protein_id=mCP97007.0"
FT                   /protein_id="EDL02422.1"
FT                   /translation="MTPPRLQARIHFNETVLLYLRKWRVEHSNQSIAKKCYKHKKKINP
FT                   KPILNILQDSEPQSQAFLSIPCAEMHGKGSMYTHTHTHSYTHTQSHTHTHTHSYTHTQS
FT                   HTSTHCYTHTQSHAHAHTYTQSHTHTHLYTHSYSHTQSHTHTYTHHTHTHLYTHIVTHS
FT                   PDTITYTLTHLYIHSHTLILGHETQKNC"
FT   gene            complement(<1731138..1910300)
FT                   /gene="Pax5"
FT                   /locus_tag="mCG_2326"
FT                   /note="gene_id=mCG2326.1"
FT   mRNA            complement(join(<1731138..1731214,1737053..1737139,
FT                   1769741..1769842,1809544..1809673,1845379..1845554,
FT                   1879298..1879426,1882527..1882591,1891695..1891892,
FT                   1897382..1897547,1910223..1910300))
FT                   /gene="Pax5"
FT                   /locus_tag="mCG_2326"
FT                   /product="paired box gene 5"
FT                   /note="gene_id=mCG2326.1 transcript_id=mCT1355.0 created on
FT                   12-JUL-2002"
FT   CDS             complement(join(1731138..1731214,1737053..1737139,
FT                   1769741..1769842,1809544..1809673,1845379..1845554,
FT                   1879298..1879426,1882527..1882591,1891695..1891892,
FT                   1897382..1897547,1910223..1910268))
FT                   /codon_start=1
FT                   /gene="Pax5"
FT                   /locus_tag="mCG_2326"
FT                   /product="paired box gene 5"
FT                   /note="gene_id=mCG2326.1 transcript_id=mCT1355.0
FT                   protein_id=mCP5827.1"
FT                   /protein_id="EDL02420.1"
FT                   /translation="MDLEKNYPTPRTIRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELA
FT                   HQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKR
FT                   QNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGS
FT                   VTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRK
FT                   QMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANL
FT                   TSPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSE
FT                   FSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSPAARGAAPPAAATAYDRH"
FT   assembly_gap    1769314..1769502
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    1774136..1774155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1802285..1802821
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   gene            1864242..1885205
FT                   /locus_tag="mCG_147030"
FT                   /note="gene_id=mCG147030.0"
FT   mRNA            join(1864242..1865384,1883292..1885205)
FT                   /locus_tag="mCG_147030"
FT                   /product="mCG147030"
FT                   /note="gene_id=mCG147030.0 transcript_id=mCT187293.0
FT                   created on 13-JAN-2004"
FT   CDS             1864379..1864594
FT                   /codon_start=1
FT                   /locus_tag="mCG_147030"
FT                   /product="mCG147030"
FT                   /note="gene_id=mCG147030.0 transcript_id=mCT187293.0
FT                   protein_id=mCP108165.0"
FT                   /protein_id="EDL02421.1"
FT                   /translation="MSIKLQMFSGGPARAAMAGGPFPRAPGAAAVGLSSPPTPRAAWLS
FT                   LPGPATLRPRLGVGGRPTEPNKPALE"
FT   assembly_gap    1877729..1877783
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    1918997..1919069
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    1922041..1922181
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    1938140..1938336
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    1944475..1944831
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   gene            complement(1952250..1953238)
FT                   /locus_tag="mCG_117783"
FT                   /note="gene_id=mCG117783.0"
FT   mRNA            complement(1952250..1953238)
FT                   /locus_tag="mCG_117783"
FT                   /product="mCG117783"
FT                   /note="gene_id=mCG117783.0 transcript_id=mCT118927.0
FT                   created on 12-JUL-2002"
FT   CDS             complement(1952377..1953225)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117783"
FT                   /product="mCG117783"
FT                   /note="gene_id=mCG117783.0 transcript_id=mCT118927.0
FT                   protein_id=mCP53424.1"
FT                   /protein_id="EDL02419.1"
FT                   /translation="MEPSTSTRKHFTINDFEIGRPLGRGKFGRVYLARLKENHFIVALK
FT                   VLFKSEIEKEGLEHQLRREVEIQAHLQHRNILRLYNYFYDDTRIYLILEYAPGGELYKE
FT                   LQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVH
FT                   TPSLRRKTMCGTLDYLPPEMIAQKPYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYR
FT                   RIRQVDFKFPSSVPAGAQDLISKLLRYHPSERLSLAQVLKHPWVREHSRRVLPRCVQGA
FT                   S"
FT   gene            <1960543..2132285
FT                   /locus_tag="mCG_2332"
FT                   /note="gene_id=mCG2332.2"
FT   mRNA            join(1960543..1960683,1961950..1962574,2093556..2093593,
FT                   2094939..2095064,2095842..2096012,2108474..2108509,
FT                   2125998..2126093,2129187..2129304,2131105..2132285)
FT                   /locus_tag="mCG_2332"
FT                   /product="mCG2332, transcript variant mCT1347"
FT                   /note="gene_id=mCG2332.2 transcript_id=mCT1347.2 created on
FT                   22-AUG-2002"
FT   mRNA            join(<1960543..1960683,1961950..1962574,2093556..2093593,
FT                   2094939..2095064,2095842..2096012,2108474..2112082)
FT                   /locus_tag="mCG_2332"
FT                   /product="mCG2332, transcript variant mCT189525"
FT                   /note="gene_id=mCG2332.2 transcript_id=mCT189525.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1961965..1962574,2093556..2093593,2094939..2095064,
FT                   2095842..2096012,2108474..2108566)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2332"
FT                   /product="mCG2332, isoform CRA_b"
FT                   /note="gene_id=mCG2332.2 transcript_id=mCT189525.0
FT                   protein_id=mCP110507.0 isoform=CRA_b"
FT                   /protein_id="EDL02417.1"
FT                   /translation="LSIMFGGYETIEAFEDDLYRDDSSSELSVDSEVEFQLYSQVHYAQ
FT                   SIHNANKEEGYEEKNCENSETVSSQPNQKNLIVLSDSEVIQLSDTSEVITLSDEDSIYR
FT                   CKRKNIEVQAEEKTQSPATSHSNKVAQKCKRNNKKPKPEERPGVIREVMIIEVSSNEEE
FT                   ESTTSENENVESWMLLGSEEDGKDNDILLNLVGCETAGAEDDVNWFISDKDIEAKIDNN
FT                   RSSGRWNNRYYSVNKNVTCRNCDKRGHLSKNCPLPQKVRACCLCSERGHLQYGCPARYC
FT                   LDCSLPMSSNHRCFERLSWRKRCDRCDMIGHHADACPEIWRQYHLTVSKNTFLFSPRPS
FT                   LFTLL"
FT   CDS             join(1961974..1962574,2093556..2093593,2094939..2095064,
FT                   2095842..2096012,2108474..2108509,2125998..2126093,
FT                   2129187..2129304,2131105..2131544)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2332"
FT                   /product="mCG2332, isoform CRA_c"
FT                   /note="gene_id=mCG2332.2 transcript_id=mCT1347.2
FT                   protein_id=mCP5826.2 isoform=CRA_c"
FT                   /db_xref="GOA:B1AX39"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="MGI:MGI:2442912"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1AX39"
FT                   /protein_id="EDL02418.1"
FT                   /translation="MFGGYETIEAFEDDLYRDDSSSELSVDSEVEFQLYSQVHYAQSIH
FT                   NANKEEGYEEKNCENSETVSSQPNQKNLIVLSDSEVIQLSDTSEVITLSDEDSIYRCKR
FT                   KNIEVQAEEKTQSPATSHSNKVAQKCKRNNKKPKPEERPGVIREVMIIEVSSNEEEEST
FT                   TSENENVESWMLLGSEEDGKDNDILLNLVGCETAGAEDDVNWFISDKDIEAKIDNNRSS
FT                   GRWNNRYYSVNKNVTCRNCDKRGHLSKNCPLPQKVRACCLCSERGHLQYGCPARYCLDC
FT                   SLPMSSNHRCFERLSWRKRCDRCDMIGHHADACPEIWRQYHLTTKPGPPKKPKTPSGQS
FT                   ALVYCYNCAQKGHYGHECTERRMFNQTFPTSPFIYCYDGKYDIQQRDRRIKRKVKDLKK
FT                   NGDFPRQFKRPHVEETDKRRHHDMRKSRSPRKYRRWPRENKETQKEKTRSREGKTHRRG
FT                   HQPRGEDEDFPRGSKPNASGCANNQKPSKSLHHASHYHRLREERLLRESKRSKPKKRKS
FT                   TEDGSHDDLFLIKQKKKKPKPSGL"
FT   assembly_gap    1979570..1979589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2007388..2007469
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    2027263..2027282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2036457..2036568
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   mRNA            join(2125384..2126093,2129187..2129304,2131105..2132276)
FT                   /locus_tag="mCG_2332"
FT                   /product="mCG2332, transcript variant mCT171214"
FT                   /note="gene_id=mCG2332.2 transcript_id=mCT171214.0 created
FT                   on 22-AUG-2002"
FT   CDS             join(2125989..2126093,2129187..2129304,2131105..2131544)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2332"
FT                   /product="mCG2332, isoform CRA_a"
FT                   /note="gene_id=mCG2332.2 transcript_id=mCT171214.0
FT                   protein_id=mCP94132.0 isoform=CRA_a"
FT                   /db_xref="GOA:B1AX39"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="MGI:MGI:2442912"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1AX39"
FT                   /protein_id="EDL02416.1"
FT                   /translation="MLQTKPGPPKKPKTPSGQSALVYCYNCAQKGHYGHECTERRMFNQ
FT                   TFPTSPFIYCYDGKYDIQQRDRRIKRKVKDLKKNGDFPRQFKRPHVEETDKRRHHDMRK
FT                   SRSPRKYRRWPRENKETQKEKTRSREGKTHRRGHQPRGEDEDFPRGSKPNASGCANNQK
FT                   PSKSLHHASHYHRLREERLLRESKRSKPKKRKSTEDGSHDDLFLIKQKKKKPKPSGL"
FT   assembly_gap    2128439..2128619
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   gene            <2143819..2148142
FT                   /locus_tag="mCG_1041394"
FT                   /note="gene_id=mCG1041394.1"
FT   mRNA            join(<2143819..2143968,2148081..2148142)
FT                   /locus_tag="mCG_1041394"
FT                   /product="mCG1041394"
FT                   /note="gene_id=mCG1041394.1 transcript_id=mCT159098.1
FT                   created on 22-AUG-2002"
FT   CDS             <2143821..2143967
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041394"
FT                   /product="mCG1041394"
FT                   /note="gene_id=mCG1041394.1 transcript_id=mCT159098.1
FT                   protein_id=mCP53576.1"
FT                   /protein_id="EDL02415.1"
FT                   /translation="ETVVPSLCPSGHRWISEAQTRLQDYESHVEKVSHQDLQRCGHKKV
FT                   DLG"
FT   assembly_gap    2144503..2144609
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    2147499..2147747
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    2155959..2155978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2164914..2164933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2165263..2165441
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    2175044..2175220
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   gene            2181756..2191096
FT                   /gene="Grhpr"
FT                   /locus_tag="mCG_2331"
FT                   /note="gene_id=mCG2331.1"
FT   mRNA            join(2181756..2181896,2183241..2183371,2184236..2184308,
FT                   2184792..2184908,2185669..2185757,2186648..2186752,
FT                   2187578..2187713,2189282..2189412,2190739..2191096)
FT                   /gene="Grhpr"
FT                   /locus_tag="mCG_2331"
FT                   /product="glyoxylate reductase/hydroxypyruvate reductase"
FT                   /note="gene_id=mCG2331.1 transcript_id=mCT1346.1 created on
FT                   22-JUL-2002"
FT   CDS             join(2181814..2181896,2183241..2183371,2184236..2184308,
FT                   2184792..2184908,2185669..2185757,2186648..2186752,
FT                   2187578..2187713,2189282..2189412,2190739..2190860)
FT                   /codon_start=1
FT                   /gene="Grhpr"
FT                   /locus_tag="mCG_2331"
FT                   /product="glyoxylate reductase/hydroxypyruvate reductase"
FT                   /note="gene_id=mCG2331.1 transcript_id=mCT1346.1
FT                   protein_id=mCP5790.2"
FT                   /db_xref="GOA:Q3T9Z2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="MGI:MGI:1923488"
FT                   /db_xref="UniProtKB/TrEMBL:Q3T9Z2"
FT                   /protein_id="EDL02414.1"
FT                   /translation="MKPARLMKVFVTGPLPAEGRAALAQAADCEVEQWNSDDPIPRKDL
FT                   EQGVVGAHGLLCRLSDRVDKKLLDAAGANLRVISTLSVGVDHLALDEIKKRGIRVGYTP
FT                   GVLTDATAELAVSLLLTTCRRLPEAIEEVKNGGWSSWSPLWMCGYGLSQSTVGIVGLGR
FT                   IGQAIARRLKPFGVQRFLYTGRQPRPQEAAEFQAEFVPIAQLAAESDFIVVSCSLTPDT
FT                   MGLCSKDFFQKMKNTAIFINISRGDVVNQEDLYQALASGQIAAAGLDVTTPEPLPPSHP
FT                   LLTLKNCVILPHIGSATYKTRNTMSLLAANNLLAGLRGEAMPSELKL"
FT   gene            complement(2191607..2212730)
FT                   /gene="Zbtb5"
FT                   /locus_tag="mCG_2323"
FT                   /note="gene_id=mCG2323.2"
FT   mRNA            complement(join(2191607..2195748,2212586..2212730))
FT                   /gene="Zbtb5"
FT                   /locus_tag="mCG_2323"
FT                   /product="zinc finger and BTB domain containing 5,
FT                   transcript variant mCT1352"
FT                   /note="gene_id=mCG2323.2 transcript_id=mCT1352.2 created on
FT                   22-AUG-2002"
FT   mRNA            complement(join(2191607..2195748,2211314..2211496))
FT                   /gene="Zbtb5"
FT                   /locus_tag="mCG_2323"
FT                   /product="zinc finger and BTB domain containing 5,
FT                   transcript variant mCT172431"
FT                   /note="gene_id=mCG2323.2 transcript_id=mCT172431.0 created
FT                   on 22-AUG-2002"
FT   CDS             complement(2193732..2195744)
FT                   /codon_start=1
FT                   /gene="Zbtb5"
FT                   /locus_tag="mCG_2323"
FT                   /product="zinc finger and BTB domain containing 5, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2323.2 transcript_id=mCT1352.2
FT                   protein_id=mCP5795.2 isoform=CRA_a"
FT                   /protein_id="EDL02412.1"
FT                   /translation="MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAAC
FT                   STHFRALFSVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAAS
FT                   HLHLNSVVKACKHYLTTRTLPMSPSSERAQEQSARMQRSFMLQQLGLSIVSSALSSSQS
FT                   AEEPTAPMSSSMRSSLDQRTPFPMRRLHKRKQSVEERARQRLRSSMEESAISDVTPESG
FT                   PAGVHSREEFFSPDSLKIVDNPKPDGMADNQEDGAMMFDRPFGAQEDAQVPSQSDGSAG
FT                   NMASRATQVETSFEQEAVAEKGSFQCENPEVGLGEKEHMRVVVKSEPLSSPEPQDEVSD
FT                   VTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHK
FT                   TSFSISNFLNKSRGSNFSASQSTDDNLPNTTSDCRLEGEAPYLLSPEAGPAGGPSSAPG
FT                   SHVENPFSEPADSHFVRPMQEVMGLPCVQTSGYQGEQFGMDFSRSGLGLHSSFSRAMMG
FT                   SPRGGASNFPYYRRIAPKMPVVTSVRSSQISENSASSQLMMNGATSFENGHTSQPGPPQ
FT                   LTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYA
FT                   CLKCGKRFSQSSHLYKHSKTTCLRWQSSNLPSTLL"
FT   CDS             complement(2193732..2195744)
FT                   /codon_start=1
FT                   /gene="Zbtb5"
FT                   /locus_tag="mCG_2323"
FT                   /product="zinc finger and BTB domain containing 5, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2323.2 transcript_id=mCT172431.0
FT                   protein_id=mCP95350.0 isoform=CRA_a"
FT                   /protein_id="EDL02413.1"
FT                   /translation="MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAAC
FT                   STHFRALFSVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAAS
FT                   HLHLNSVVKACKHYLTTRTLPMSPSSERAQEQSARMQRSFMLQQLGLSIVSSALSSSQS
FT                   AEEPTAPMSSSMRSSLDQRTPFPMRRLHKRKQSVEERARQRLRSSMEESAISDVTPESG
FT                   PAGVHSREEFFSPDSLKIVDNPKPDGMADNQEDGAMMFDRPFGAQEDAQVPSQSDGSAG
FT                   NMASRATQVETSFEQEAVAEKGSFQCENPEVGLGEKEHMRVVVKSEPLSSPEPQDEVSD
FT                   VTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHK
FT                   TSFSISNFLNKSRGSNFSASQSTDDNLPNTTSDCRLEGEAPYLLSPEAGPAGGPSSAPG
FT                   SHVENPFSEPADSHFVRPMQEVMGLPCVQTSGYQGEQFGMDFSRSGLGLHSSFSRAMMG
FT                   SPRGGASNFPYYRRIAPKMPVVTSVRSSQISENSASSQLMMNGATSFENGHTSQPGPPQ
FT                   LTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYA
FT                   CLKCGKRFSQSSHLYKHSKTTCLRWQSSNLPSTLL"
FT   assembly_gap    2217206..2217653
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   gene            2219246..2232964
FT                   /gene="Polr1e"
FT                   /locus_tag="mCG_2334"
FT                   /note="gene_id=mCG2334.2"
FT   mRNA            join(2219246..2219392,2219874..2219977,2222808..2222884,
FT                   2223793..2223878,2226370..2226428,2227364..2227508,
FT                   2227964..2228071,2228603..2228699,2229938..2230071,
FT                   2231353..2231434,2231967..2232098,2232541..2232959)
FT                   /gene="Polr1e"
FT                   /locus_tag="mCG_2334"
FT                   /product="polymerase (RNA) I polypeptide E, transcript
FT                   variant mCT1350"
FT                   /note="gene_id=mCG2334.2 transcript_id=mCT1350.0 created on
FT                   12-JUL-2002"
FT   mRNA            join(<2219262..2219392,2219874..2219977,2222808..2222884,
FT                   2223793..2223878,2225079..2225149,2225746..2225818,
FT                   2226370..2226428,2227364..2227508,2227964..2228071,
FT                   2228603..2228699,2229938..2230071,2231353..2231434,
FT                   2231967..2232098,2232541..2232964)
FT                   /gene="Polr1e"
FT                   /locus_tag="mCG_2334"
FT                   /product="polymerase (RNA) I polypeptide E, transcript
FT                   variant mCT189528"
FT                   /note="gene_id=mCG2334.2 transcript_id=mCT189528.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2219263..2219392,2219874..2219977,2222808..2222884,
FT                   2223793..2223878,2225079..2225149,2225746..2225818,
FT                   2226370..2226428,2227364..2227508,2227964..2228071,
FT                   2228603..2228699,2229938..2230071,2231353..2231434,
FT                   2231967..2232098,2232541..2232700)
FT                   /codon_start=1
FT                   /gene="Polr1e"
FT                   /locus_tag="mCG_2334"
FT                   /product="polymerase (RNA) I polypeptide E, isoform CRA_a"
FT                   /note="gene_id=mCG2334.2 transcript_id=mCT189528.0
FT                   protein_id=mCP110508.0 isoform=CRA_a"
FT                   /protein_id="EDL02410.1"
FT                   /translation="GELMATLESPGMDDQAGDTETEALQSARWLYCGEPDDRQKAVLVQ
FT                   FSNGKLQNPGDMRFTLYNSTDLVNPRQRSHRIVAAETDRLSYVGNNFGTGALKCNALCR
FT                   HFVGILNKTSGQMEVYDAELFNMQPLFAGMGTEVIKLGGQHLYLLAFCQPSKNLAEAGD
FT                   LLLSRHRQGHCIAVLLDDDAIEREPPLENQNKTFRDKLDSCIEAFGSTKQKRSLNSRRM
FT                   NKVGSESLNLSVAKAAESIIDTKGVNALVSDAMQDDLQDGVLYLPPCYADAAKPEDVYR
FT                   FEDILSPAEYDALESPSEAFRKVTSEDILKMIEENSHCSYVIEMLKSLPIDEVHRNRQA
FT                   RSIWFLDALIRFRAQKVIKGKRALGPGIPHIINTKLLKQFTCLTYNNGRLQNLISSSMR
FT                   AKITSYAIILALHINNFQVDLTALQKDLKLSEKRMIEIAKAMRLKISKQKVSLADGREE
FT                   SHRLGTLSVPLPPAQNSDRQSKRRKMN"
FT   CDS             join(2219272..2219392,2219874..2219977,2222808..2222884,
FT                   2223793..2223878,2226370..2226428,2227364..2227508,
FT                   2227964..2228071,2228603..2228699,2229938..2230071,
FT                   2231353..2231434,2231967..2232098,2232541..2232700)
FT                   /codon_start=1
FT                   /gene="Polr1e"
FT                   /locus_tag="mCG_2334"
FT                   /product="polymerase (RNA) I polypeptide E, isoform CRA_b"
FT                   /note="gene_id=mCG2334.2 transcript_id=mCT1350.0
FT                   protein_id=mCP5814.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V1B9"
FT                   /db_xref="InterPro:IPR009668"
FT                   /db_xref="MGI:MGI:1929022"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V1B9"
FT                   /protein_id="EDL02411.1"
FT                   /translation="MATLESPGMDDQAGDTETEALQSARWLYCGEPDDRQKAVLVQFSN
FT                   GKLQNPGDMRFTLYNSTDLVNPRQRSHRIVAAETDRLSYVGNNFGTGALKCNALCRHFV
FT                   GILNKTSGQMEVYDAELFNMQPLFADDAIEREPPLENQNKTFRDKLDSCIEAFGSTKQK
FT                   RSLNSRRMNKVGSESLNLSVAKAAESIIDTKGVNALVSDAMQDDLQDGVLYLPPCYADA
FT                   AKPEDVYRFEDILSPAEYDALESPSEAFRKVTSEDILKMIEENSHCSYVIEMLKSLPID
FT                   EVHRNRQARSIWFLDALIRFRAQKVIKGKRALGPGIPHIINTKLLKQFTCLTYNNGRLQ
FT                   NLISSSMRAKITSYAIILALHINNFQVDLTALQKDLKLSEKRMIEIAKAMRLKISKQKV
FT                   SLADGREESHRLGTLSVPLPPAQNSDRQSKRRKMN"
FT   gene            complement(<2236512..>2285168)
FT                   /locus_tag="mCG_2325"
FT                   /note="gene_id=mCG2325.3"
FT   mRNA            complement(join(<2236512..2236682,2241126..2241307,
FT                   2242332..2242645,2244264..2244527,2245340..2245492,
FT                   2246968..2247038,2249064..2249200,2252177..2252326,
FT                   2258953..2259774,2262564..2263154,2285136..>2285168))
FT                   /locus_tag="mCG_2325"
FT                   /product="mCG2325"
FT                   /note="gene_id=mCG2325.3 transcript_id=mCT1354.1 created on
FT                   19-JUN-2003"
FT   CDS             complement(join(<2236512..2236682,2241126..2241307,
FT                   2242332..2242645,2244264..2244527,2245340..2245492,
FT                   2246968..2247038,2249064..2249200,2252177..2252326,
FT                   2258953..2259774,2262564..2263154,2285136..>2285168))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2325"
FT                   /product="mCG2325"
FT                   /note="gene_id=mCG2325.3 transcript_id=mCT1354.1
FT                   protein_id=mCP5796.1"
FT                   /protein_id="EDL02409.1"
FT                   /translation="RGRGRAAPLPEVTMETGGLPLELWRMILAYLHLPDLGRCSLVCRA
FT                   WYELILSLDSTRWRQLCLGCTECRHPNWPNQPDVEPESWREAFKQHYLASKTWTKNALD
FT                   LESSICFSLFRRKKERRTLSVGPGHEFDSLGSALAMASLYDRIVLFPGVYEEQGEIILK
FT                   VPVEIVGQGKLGEVALLASIDQHCSTTRVCNLVFMPAWFSPIMYKTTSGHIQFDNCNFE
FT                   NGHIQVHGPGTCQVKFCTFKNTHVFLHNVPLCMLENCEFVGSENNCVTVEGHPSADKNW
FT                   AYKYLLGLIKSSPIFLPAEDHDFLMSLDLESRDQAWSPRTCDIVIEGSQSPTSPVCSSP
FT                   KPGSKEAEVGSDGERVAQTPDSSDGGLSPSGEDEDDEQLTYRLSYQVQGPRPVLGGSFL
FT                   GPPLPGASIQLPSCLVLNSLHQELQKDKEAMALASSVQGCLIRKCLFRDGKGGVFVCSY
FT                   GRAKMEGNVFRNLTYAVRCIHNSKIVMLRNDIYRCRASGIFLRLEGGGLIAGNNIYHNA
FT                   EAGVDIRKKSNPLILCNQIHHGLRSGIVVLGNGKGVIRNNQIFSNKEAGIYILYHGNPI
FT                   VSGNHIFKGRAAGIAVNENGKGLITENVIRENQWGGVDIRRGGVPILRSNLICFGYSDG
FT                   VVVGDEGKGLIEGNTIYANKGCGVWMMSSSLPHVTSNHVSYNGLYGVAVFSQKDGEFPG
FT                   GHGAQENFSEDGDAILWEAELEKEDDPLRRPITVALVESNSINHNGASGIFVQSSEALQ
FT                   VVANVIHANGDRGITIVQSSQLTRVANNSISCNRQSGVKVEFQCKVELRGNGIYDNRGH
FT                   GIITKGDGTAVVENDIIGNRGSGLQLLPRSDTKVLKNRIHSFRAYGIAVRGRVKALVQE
FT                   NIIFQGKTNKTIFQQITNNRECIMQNNKFLVFKKKSDTWRLVNPPARPHLENSLRGSSA
FT                   AHSGHKVTAMATRITARVEGGYHSNRSIFCTIL"
FT   assembly_gap    2243137..2243156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2282841..2282860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2288581..2288761
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   gene            complement(2305923..2308823)
FT                   /locus_tag="mCG_2330"
FT                   /note="gene_id=mCG2330.2"
FT   mRNA            complement(join(2305923..2306355,2308628..2308823))
FT                   /locus_tag="mCG_2330"
FT                   /product="mCG2330, transcript variant mCT172432"
FT                   /note="gene_id=mCG2330.2 transcript_id=mCT172432.0 created
FT                   on 28-OCT-2002"
FT   mRNA            complement(join(2305923..2306355,2308624..2308820))
FT                   /locus_tag="mCG_2330"
FT                   /product="mCG2330, transcript variant mCT1345"
FT                   /note="gene_id=mCG2330.2 transcript_id=mCT1345.2 created on
FT                   28-OCT-2002"
FT   mRNA            complement(join(2305923..2306355,2307326..2307504,
FT                   2308624..2308820))
FT                   /locus_tag="mCG_2330"
FT                   /product="mCG2330, transcript variant mCT172433"
FT                   /note="gene_id=mCG2330.2 transcript_id=mCT172433.0 created
FT                   on 28-OCT-2002"
FT   mRNA            complement(join(2305923..2306355,2307550..2307599,
FT                   2308624..2308820))
FT                   /locus_tag="mCG_2330"
FT                   /product="mCG2330, transcript variant mCT172434"
FT                   /note="gene_id=mCG2330.2 transcript_id=mCT172434.0 created
FT                   on 28-OCT-2002"
FT   CDS             complement(join(2306321..2306355,2308624..2308744))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2330"
FT                   /product="mCG2330, isoform CRA_c"
FT                   /note="gene_id=mCG2330.2 transcript_id=mCT1345.2
FT                   protein_id=mCP5782.2 isoform=CRA_c"
FT                   /protein_id="EDL02407.1"
FT                   /translation="MFRIEGLAPKLDPEEMKRKMREDVVSSIRNFLIYVALLRVTPYIL
FT                   KKLDSI"
FT   CDS             complement(join(2306341..2306355,2308628..2308744))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2330"
FT                   /product="mCG2330, isoform CRA_d"
FT                   /note="gene_id=mCG2330.2 transcript_id=mCT172432.0
FT                   protein_id=mCP95351.0 isoform=CRA_d"
FT                   /protein_id="EDL02408.1"
FT                   /translation="MFRIEGLAPKLDPEEMKRKMREDVVSSIRNFLIYVALLRLHIS"
FT   CDS             complement(join(2306341..2306355,2307326..2307504,
FT                   2308624..2308744))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2330"
FT                   /product="mCG2330, isoform CRA_a"
FT                   /note="gene_id=mCG2330.2 transcript_id=mCT172433.0
FT                   protein_id=mCP95353.0 isoform=CRA_a"
FT                   /protein_id="EDL02405.1"
FT                   /translation="MFRIEGLAPKLDPEEMKRKMREDVVSSIRNFLIYVALLRVNQPGL
FT                   QMEFQDRQGGYTEKSVLKQETFVMCFSACLYVNHVPAVQKGALESLELESSWPLILHIS
FT                   "
FT   CDS             complement(join(2306341..2306355,2307550..2307599,
FT                   2308624..2308744))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2330"
FT                   /product="mCG2330, isoform CRA_b"
FT                   /note="gene_id=mCG2330.2 transcript_id=mCT172434.0
FT                   protein_id=mCP95352.0 isoform=CRA_b"
FT                   /protein_id="EDL02406.1"
FT                   /translation="MFRIEGLAPKLDPEEMKRKMREDVVSSIRNFLIYVALLRVKPGMV
FT                   AHTFNPSTQKAELHIS"
FT   assembly_gap    2321525..2321544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2373364..2373403
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    2375039..2376341
FT                   /estimated_length=1303
FT                   /gap_type="unknown"
FT   assembly_gap    2385770..2385838
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   gene            2386100..2487868
FT                   /locus_tag="mCG_2333"
FT                   /note="gene_id=mCG2333.2"
FT   mRNA            join(2386100..2386152,2431938..2432042,2445960..2446117,
FT                   2446914..2447016,2451305..2451350,2458903..2459010,
FT                   2463826..2463921,2470440..2470565,2471871..2471990,
FT                   2473079..2473215,2475027..2475153,2475307..2475402,
FT                   2476265..2476441,2477197..2477344,2480773..2481588,
FT                   2485679..2487868)
FT                   /locus_tag="mCG_2333"
FT                   /product="mCG2333"
FT                   /note="gene_id=mCG2333.2 transcript_id=mCT1348.2 created on
FT                   22-AUG-2002"
FT   assembly_gap    2395532..2396379
FT                   /estimated_length=848
FT                   /gap_type="unknown"
FT   assembly_gap    2407109..2407128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(2431942..2432042,2445960..2446117,2446914..2447016,
FT                   2451305..2451350,2458903..2459010,2463826..2463921,
FT                   2470440..2470565,2471871..2471990,2473079..2473215,
FT                   2475027..2475153,2475307..2475402,2476265..2476441,
FT                   2477197..2477344,2480773..2481588,2485679..2487762)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2333"
FT                   /product="mCG2333"
FT                   /note="gene_id=mCG2333.2 transcript_id=mCT1348.2
FT                   protein_id=mCP5785.2"
FT                   /protein_id="EDL02403.1"
FT                   /translation="MEELDGSLSQTRKAHRIEQMVARWLRRSRDSSARAKVAAADGPPG
FT                   NPAQALTPVRHTVTLDKDVLLQNYGFHISETLPLTVVAVTAGGSAHGKLFPGDQILQMN
FT                   NELAEDLSCERAADILRETEDALSITVVRCTSGVPKSSFLTEEKRARLKSNPVKVHFAE
FT                   EVLVSGHSQGNSLLCMPNVLKVYLENGQTKAFKFEANTTVKDIILTVKEKLSIRSIEYF
FT                   ALALEEQYSISRLHLLHEEELVQQVVEREESQDSRCLFRVSFVPKDPLDLLKEDPVAFE
FT                   YLYLQSCSDVLQERFAVEMKCNSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENF
FT                   ISPTLLRNMKGKDIKKAISFHMKRNQNLLEPRQKQLISAAQLRLNYLQILGELKTYGGK
FT                   VFNATLMDRESYIALLVGAKYGISQIINSKLNIISTLAEFANISRVELTEESEKVSMVK
FT                   VYLQDVKVLTLLLESSSAKDLACLIAGYYRLFVDPANSVFHWSGNRRPTHRVSAEEGYE
FT                   SRACSDSEESSEVDCVLEPLSDRCLVKLSLCRPFAREEQPPGDSPTPEATRRGPSTCGA
FT                   SSMTDSAESEASDSANTESRGCRTSGSSESMDALEEDDLDACSSSGTSFFHFGPPGFSK
FT                   GLETNSQEENSRVETSGFLCLLDLGQNANPQCQKIDGPQGLASEACSWGPELSMGRLDP
FT                   RLYEGSRTDYYNLCSSISPGSHLSDSGSESTASRQGAAPPQWCQQGWMEAQSGSMLESL
FT                   GLPALPPLAFEGGSSDEEYYDAADKLTPPDTLSEASASQENTDDVCYYDREPYLTLTAP
FT                   SPTVSSLQDMQGEPGLLETKALGLLASLRETKSTNPASRIMEMEPETMETKSVIDSRVS
FT                   SISAIRLRIDPSNTENPVTTDGSSASIPHSPHHSNPGSSSPQAAQVRPFPIVSPDQDPG
FT                   GTTPKELTAEPEDSTFPLSSDHPNPDNPGPHHVSQGDTSELGEVRSEIGSESFLINHVQ
FT                   EVIPQITGPLCPGDGPTSGECEVNSEETALAADEVQGQLSLDSDREVMHRNGPSLFQKG
FT                   SGKDLGDSKGDRLDNVPQALDVRAPAGEINSSLCSEPPATGTGRTSPDSEGENREAQEQ
FT                   ELLTELDLAPDFLLPSAFPPETIKAEQLDRVIGEDSAPVSTSQQVCVHTVPSLPKLSPC
FT                   QEEPRSVDSGHGSPAESKGDSPIICLPPERSFLCFAPESHPEGSTSLSRVTSFSFAGIN
FT                   EVAPAEIGIEHCRCQFSYATCFRGLQPETEEEDGDPQTHPAAPLTSPPSAGSQVTLPWR
FT                   AARAYSCTTPLSRKSHIWPEFCSRALRQLKTTPTNAPEGFVQLTESLLELQDILEASWG
FT                   VGNKHPPDKCTLHFSESRSRLCMGSQKLLASCQHVIRMDQSPEEMQGAVRVTFQHLVQL
FT                   AGLCFQFTDCSRCSTRHREVAGNLRDVVYTYHQFVEAAKLTCERGYHDFSVKLLARQCT
FT                   ALTAAVFCLTQKFRASTAL"
FT   assembly_gap    2433840..2433859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2437030..>2446335)
FT                   /locus_tag="mCG_2329"
FT                   /note="gene_id=mCG2329.1"
FT   mRNA            complement(join(2437030..2437281,2439741..2439830,
FT                   2446267..>2446335))
FT                   /locus_tag="mCG_2329"
FT                   /product="mCG2329"
FT                   /note="gene_id=mCG2329.1 transcript_id=mCT1344.1 created on
FT                   22-AUG-2002"
FT   CDS             complement(join(2437182..2437281,2439741..2439830,
FT                   2446267..>2446274))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2329"
FT                   /product="mCG2329"
FT                   /note="gene_id=mCG2329.1 transcript_id=mCT1344.1
FT                   protein_id=mCP5780.1"
FT                   /protein_id="EDL02404.1"
FT                   /translation="LLRSRSIRKIWYLKGYLSSGILEKTEKATSTSCVLKLCATKMYSW
FT                   KKERQKKIHGLPFKRAVCSS"
FT   assembly_gap    2446178..2446197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2450501..2450597
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    2458199..2458421
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    2459765..2460013
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    2484739..2485177
FT                   /estimated_length=439
FT                   /gap_type="unknown"
FT   assembly_gap    2493205..2496895
FT                   /estimated_length=3691
FT                   /gap_type="unknown"
FT   gene            2498877..2517825
FT                   /gene="Rg9mtd3"
FT                   /locus_tag="mCG_118084"
FT                   /note="gene_id=mCG118084.1"
FT   mRNA            join(2498877..2498943,2502168..2502378,2502987..2503101,
FT                   2506015..2506139,2507496..2507648,2509644..2509722,
FT                   2510250..2510317,2515977..2516100,2516706..2517825)
FT                   /gene="Rg9mtd3"
FT                   /locus_tag="mCG_118084"
FT                   /product="RNA (guanine-9-) methyltransferase domain
FT                   containing 3"
FT                   /note="gene_id=mCG118084.1 transcript_id=mCT119232.1
FT                   created on 22-AUG-2002"
FT   CDS             join(2502196..2502378,2502987..2503101,2506015..2506139,
FT                   2507496..2507648,2509644..2509722,2510250..2510317,
FT                   2515977..2516100,2516706..2516815)
FT                   /codon_start=1
FT                   /gene="Rg9mtd3"
FT                   /locus_tag="mCG_118084"
FT                   /product="RNA (guanine-9-) methyltransferase domain
FT                   containing 3"
FT                   /note="gene_id=mCG118084.1 transcript_id=mCT119232.1
FT                   protein_id=mCP53504.1"
FT                   /protein_id="EDL02402.1"
FT                   /translation="MDCKSEESAQRTDSQAFQEPDGLPEAGGEDGLSESFQLLQVDVEY
FT                   ERPEETSPANSAVWSSKNMQRKQRHWERIVSSKKSKRKQERERRKAKRAEDPGNGTCPQ
FT                   HSKRFLKALTKEKLLEAKHSGPRLCVDLSMTQHMSKKELSRLAGQIRRLYGSNKKASRP
FT                   FWICLTGFSTASPLYEECLRMNDGFSAYLLDVTEEDCFSLFPLETLVYLTPDSEHSLED
FT                   IDQSTVYVIGGLVDESIQKKVTFQKAREYSVKTARLPIQEYMIKRQNEKNYHSEILAIN
FT                   QVFDILSTYFETRNWPEALKKGVSPGKGYVLQNSAEG"
FT   assembly_gap    2515445..2515678
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   gene            complement(2517997..2522275)
FT                   /gene="Exosc3"
FT                   /locus_tag="mCG_14142"
FT                   /note="gene_id=mCG14142.2"
FT   mRNA            complement(join(2517997..2518722,2519348..2519499,
FT                   2521220..2521369,2521941..2522275))
FT                   /gene="Exosc3"
FT                   /locus_tag="mCG_14142"
FT                   /product="exosome component 3, transcript variant mCT13913"
FT                   /note="gene_id=mCG14142.2 transcript_id=mCT13913.2 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(2518521..2518722,2519348..2519499,
FT                   2521220..2521369,2521941..2522261))
FT                   /codon_start=1
FT                   /gene="Exosc3"
FT                   /locus_tag="mCG_14142"
FT                   /product="exosome component 3, isoform CRA_a"
FT                   /note="gene_id=mCG14142.2 transcript_id=mCT13913.2
FT                   protein_id=mCP5794.2 isoform=CRA_a"
FT                   /protein_id="EDL02400.1"
FT                   /translation="MAEVLSAGPESVAGCRARAVHKVLNQVVLPGEELVLPDHEDVDGL
FT                   GGAGEQPLRLNAGARPRLRVVCGPGLRRCGDRLLVTKCGRLRHKEPSGGGGGVYWVDSQ
FT                   QKRYVPVKGDHVIGIVIAKSGDIFKVDVGGSEPASLSYLAFEGATKRNRPNVQVGDLIY
FT                   GQCVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIVQELGK
FT                   LYPLEIVFGMNGRIWVKAKTIQQTLILANVLEACEHMTTEQRKQIFARLAES"
FT   mRNA            complement(join(2519157..2519499,2521220..2521369,
FT                   2521941..2522275))
FT                   /gene="Exosc3"
FT                   /locus_tag="mCG_14142"
FT                   /product="exosome component 3, transcript variant
FT                   mCT172426"
FT                   /note="gene_id=mCG14142.2 transcript_id=mCT172426.0 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(2519344..2519499,2521220..2521369,
FT                   2521941..2522261))
FT                   /codon_start=1
FT                   /gene="Exosc3"
FT                   /locus_tag="mCG_14142"
FT                   /product="exosome component 3, isoform CRA_b"
FT                   /note="gene_id=mCG14142.2 transcript_id=mCT172426.0
FT                   protein_id=mCP95345.0 isoform=CRA_b"
FT                   /protein_id="EDL02401.1"
FT                   /translation="MAEVLSAGPESVAGCRARAVHKVLNQVVLPGEELVLPDHEDVDGL
FT                   GGAGEQPLRLNAGARPRLRVVCGPGLRRCGDRLLVTKCGRLRHKEPSGGGGGVYWVDSQ
FT                   QKRYVPVKGDHVIGIVIAKSGDIFKVDVGGSEPASLSYLAFEGATKRNRPNVQVGDLIY
FT                   GQCVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRK"
FT   gene            2522027..2523545
FT                   /locus_tag="mCG_147024"
FT                   /note="gene_id=mCG147024.0"
FT   mRNA            2522027..2523545
FT                   /locus_tag="mCG_147024"
FT                   /product="mCG147024"
FT                   /note="gene_id=mCG147024.0 transcript_id=mCT187287.0
FT                   created on 13-JAN-2004"
FT   CDS             2523182..2523307
FT                   /codon_start=1
FT                   /locus_tag="mCG_147024"
FT                   /product="mCG147024"
FT                   /note="gene_id=mCG147024.0 transcript_id=mCT187287.0
FT                   protein_id=mCP108158.0"
FT                   /protein_id="EDL02399.1"
FT                   /translation="MEVVEYQVILPFCGASSHLNPPFPEHFQSIDSILIREISWI"
FT   gene            <2572088..2579354
FT                   /gene="Wdr32"
FT                   /locus_tag="mCG_140952"
FT                   /note="gene_id=mCG140952.0"
FT   mRNA            join(<2572088..2572238,2574394..2574504,2574653..2574798,
FT                   2575638..2579354)
FT                   /gene="Wdr32"
FT                   /locus_tag="mCG_140952"
FT                   /product="WD repeat domain 32"
FT                   /note="gene_id=mCG140952.0 transcript_id=mCT172438.0
FT                   created on 22-AUG-2002"
FT   CDS             join(2572088..2572238,2574394..2574504,2574653..2574798,
FT                   2575638..2576006)
FT                   /codon_start=1
FT                   /gene="Wdr32"
FT                   /locus_tag="mCG_140952"
FT                   /product="WD repeat domain 32"
FT                   /note="gene_id=mCG140952.0 transcript_id=mCT172438.0
FT                   protein_id=mCP95357.0"
FT                   /protein_id="EDL02398.1"
FT                   /translation="MRMRLTPDCSKMLISTSSGYLLILHELDLTKSLEVGSYPILRARR
FT                   TTSSSDLTTTSSSSGSRVSGSPCHHNDSNSTEKHMSRASQREGVSPRNSLEVLTPEVPG
FT                   ERDRGNCITSLQLHPKGWATLLRCSSNTDDQEWTCVYEFQEGAPVRPVSPRCSLRLTHY
FT                   IEEANVGRGYIKELCFSPDGRMISSPHGYGIRLLGFDKQCSELVDCLPKEASPLRVIRS
FT                   LYSHNDVVLTTKFSPTHCQIASGCLSGRVSLYQPKF"
FT   assembly_gap    2588875..2588997
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    2595388..2595407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2597749..2610699)
FT                   /gene="Mcart1"
FT                   /locus_tag="mCG_118089"
FT                   /note="gene_id=mCG118089.1"
FT   mRNA            complement(join(2597749..2602022,2606557..2606665,
FT                   2610633..2610699))
FT                   /gene="Mcart1"
FT                   /locus_tag="mCG_118089"
FT                   /product="mitochondrial carrier triple repeat 1, transcript
FT                   variant mCT119237"
FT                   /note="gene_id=mCG118089.1 transcript_id=mCT119237.1
FT                   created on 13-JUN-2003"
FT   mRNA            complement(join(2597749..2602022,2610633..2610698))
FT                   /gene="Mcart1"
FT                   /locus_tag="mCG_118089"
FT                   /product="mitochondrial carrier triple repeat 1, transcript
FT                   variant mCT172425"
FT                   /note="gene_id=mCG118089.1 transcript_id=mCT172425.1
FT                   created on 13-JUN-2003"
FT   CDS             complement(2601084..2601980)
FT                   /codon_start=1
FT                   /gene="Mcart1"
FT                   /locus_tag="mCG_118089"
FT                   /product="mitochondrial carrier triple repeat 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG118089.1 transcript_id=mCT119237.1
FT                   protein_id=mCP53663.2 isoform=CRA_a"
FT                   /protein_id="EDL02396.1"
FT                   /translation="MMDSEAHEKRPPMLTSSNQDLSPHIAGVGDMKHYLCGYCAAFNNV
FT                   AITYPVQKILFRQQLYGIKTRDAVLQLRKDGFRNLYRGILPPLMQKTTTLALMFGLYED
FT                   LSRLLHKHVSSAPEFATRSVAALLAGTTEAILTPFERVQTLLQDHKHHDKFTNTYQAFR
FT                   ALRCHGIAEYYRGMVPILFRNGFGNVLFFGLRGPIKESLPTATTYSAHLVNDFICGGVL
FT                   GAVLGFLSFPINVVKARIQSQIGGPFLSLPMVFKTIWIERDRKLINLFRGAHLNYHRSL
FT                   ISWGIINATYEFLLKIV"
FT   CDS             complement(2601084..2601980)
FT                   /codon_start=1
FT                   /gene="Mcart1"
FT                   /locus_tag="mCG_118089"
FT                   /product="mitochondrial carrier triple repeat 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG118089.1 transcript_id=mCT172425.1
FT                   protein_id=mCP95344.0 isoform=CRA_a"
FT                   /protein_id="EDL02397.1"
FT                   /translation="MMDSEAHEKRPPMLTSSNQDLSPHIAGVGDMKHYLCGYCAAFNNV
FT                   AITYPVQKILFRQQLYGIKTRDAVLQLRKDGFRNLYRGILPPLMQKTTTLALMFGLYED
FT                   LSRLLHKHVSSAPEFATRSVAALLAGTTEAILTPFERVQTLLQDHKHHDKFTNTYQAFR
FT                   ALRCHGIAEYYRGMVPILFRNGFGNVLFFGLRGPIKESLPTATTYSAHLVNDFICGGVL
FT                   GAVLGFLSFPINVVKARIQSQIGGPFLSLPMVFKTIWIERDRKLINLFRGAHLNYHRSL
FT                   ISWGIINATYEFLLKIV"
FT   assembly_gap    2607968..2607987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2610062..2610878
FT                   /locus_tag="mCG_1041324"
FT                   /note="gene_id=mCG1041324.1"
FT   mRNA            2610062..2610878
FT                   /locus_tag="mCG_1041324"
FT                   /product="mCG1041324"
FT                   /note="gene_id=mCG1041324.1 transcript_id=mCT159028.1
FT                   created on 22-AUG-2002"
FT   CDS             2610242..2610793
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041324"
FT                   /product="mCG1041324"
FT                   /note="gene_id=mCG1041324.1 transcript_id=mCT159028.1
FT                   protein_id=mCP53641.1"
FT                   /protein_id="EDL02395.1"
FT                   /translation="MKHGASERAFSRLPSAHSGRTERRWAEWPAPPDTTGRRDPAGGRQ
FT                   REPRATAIPRGLHLPSCGRLPAGARRSTTGPSAGAGPQLPGPGRVESAGPGARQPATLL
FT                   QASLLSGPKLGQHSGLRSPPHPTQDSPTARGASPQDGWRASPRPRRRRLVRPRQGRGGA
FT                   GRGGTSSSHVTRALPRSGSG"
FT   assembly_gap    2616405..2616426
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   gene            complement(2625223..2736793)
FT                   /locus_tag="mCG_14152"
FT                   /note="gene_id=mCG14152.1"
FT   mRNA            complement(join(2625223..2626067,2646793..2646912,
FT                   2650151..2650214,2653211..2653243,2664083..2664313,
FT                   2695103..2695254,2736134..2736793))
FT                   /locus_tag="mCG_14152"
FT                   /product="mCG14152"
FT                   /note="gene_id=mCG14152.1 transcript_id=mCT13923.2 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(2625884..2626067,2646793..2646912,
FT                   2650151..2650214,2653211..2653243,2664083..2664313,
FT                   2695103..2695254,2736134..2736300))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14152"
FT                   /product="mCG14152"
FT                   /note="gene_id=mCG14152.1 transcript_id=mCT13923.2
FT                   protein_id=mCP5792.2"
FT                   /protein_id="EDL02394.1"
FT                   /translation="MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERREQPPQAVP
FT                   QACSASSASCGDGLTLSPSLQVTIADDYSDPFDAKSDLKSKAGKGESAGYMEPYEAQRI
FT                   MTESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSLRLRESKLPQDDDRPADEYDQPWE
FT                   WNRVTIPALAGRSSVPAWEAGGTGPQVGWAPGPEFCGILGERVDPTIPLEKQIWYHGAI
FT                   SRSDAENLLRLCKECSYLVRNSQTSKHDYSLSLKSNQGFMHMKLAKTKEKYVLGQNSPP
FT                   FDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL"
FT   assembly_gap    2636702..2636884
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    2648397..2648416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2650331..2650350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2651522..2651541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2657383..2657402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2715843..2715862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2736021..2736053
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            <2755951..2756522
FT                   /locus_tag="mCG_118081"
FT                   /note="gene_id=mCG118081.1"
FT   mRNA            <2755951..2756522
FT                   /locus_tag="mCG_118081"
FT                   /product="mCG118081"
FT                   /note="gene_id=mCG118081.1 transcript_id=mCT119229.1
FT                   created on 12-JUL-2002"
FT   CDS             <2756088..2756474
FT                   /codon_start=1
FT                   /locus_tag="mCG_118081"
FT                   /product="mCG118081"
FT                   /note="gene_id=mCG118081.1 transcript_id=mCT119229.1
FT                   protein_id=mCP53488.0"
FT                   /protein_id="EDL02393.1"
FT                   /translation="IYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAMGIIVN
FT                   KQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPR
FT                   EAHFVRTNGKEPELLEPIPYKFMA"
FT   assembly_gap    2758028..2760204
FT                   /estimated_length=2177
FT                   /gap_type="unknown"
FT   assembly_gap    2763018..2763037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2763170..2763539
FT                   /locus_tag="mCG_1041266"
FT                   /note="gene_id=mCG1041266.1"
FT   mRNA            <2763170..2763539
FT                   /locus_tag="mCG_1041266"
FT                   /product="mCG1041266"
FT                   /note="gene_id=mCG1041266.1 transcript_id=mCT158970.1
FT                   created on 22-AUG-2002"
FT   CDS             2763170..2763448
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041266"
FT                   /product="mCG1041266"
FT                   /note="gene_id=mCG1041266.1 transcript_id=mCT158970.1
FT                   protein_id=mCP53399.0"
FT                   /protein_id="EDL02392.1"
FT                   /translation="MPHKCYHGKTGRVYNVTQHAMGIIVNKQVKGKILAKRINVRIEHI
FT                   KHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLEVPACATQRSTLCED"
FT   assembly_gap    2765434..2765453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2767568..2768518
FT                   /estimated_length=951
FT                   /gap_type="unknown"
FT   assembly_gap    2769740..2769759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2779657..2779884
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    2787340..2787396
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    2795994..2796021
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    2825380..2825543
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    2837592..2837953
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    2844807..2845500
FT                   /estimated_length=694
FT                   /gap_type="unknown"
FT   assembly_gap    2853172..2854127
FT                   /estimated_length=956
FT                   /gap_type="unknown"
FT   assembly_gap    2860218..2860468
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    2874326..2874567
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    2881070..2881645
FT                   /estimated_length=576
FT                   /gap_type="unknown"
FT   assembly_gap    2885506..2885525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2891263..2891282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2901667..2901847
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    2916718..2916737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2920992..2922238
FT                   /locus_tag="mCG_1041391"
FT                   /note="gene_id=mCG1041391.0"
FT   mRNA            join(2920992..2921095,2921938..2922238)
FT                   /locus_tag="mCG_1041391"
FT                   /product="mCG1041391"
FT                   /note="gene_id=mCG1041391.0 transcript_id=mCT159095.0
FT                   created on 22-AUG-2002"
FT   CDS             join(2920993..2921095,2921938..2922044)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041391"
FT                   /product="mCG1041391"
FT                   /note="gene_id=mCG1041391.0 transcript_id=mCT159095.0
FT                   protein_id=mCP53443.1"
FT                   /protein_id="EDL02391.1"
FT                   /translation="MMLEKELRVLHLDYQAAGRQQDNGPGLTSCSWLLSFRICTFQQFS
FT                   NSTLAGPPQSHLNQPRKESHQVLP"
FT   assembly_gap    2921212..2921231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2923566..2923611
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    2927029..2934904
FT                   /estimated_length=7876
FT                   /gap_type="unknown"
FT   assembly_gap    2942378..2942397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2954100..2954149
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            complement(2965551..>2967399)
FT                   /locus_tag="mCG_144949"
FT                   /note="gene_id=mCG144949.0"
FT   mRNA            complement(join(2965551..2966086,2966193..2966223,
FT                   2967319..>2967399))
FT                   /locus_tag="mCG_144949"
FT                   /product="mCG144949"
FT                   /note="gene_id=mCG144949.0 transcript_id=mCT184373.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(2966039..2966086,2966193..2966223,
FT                   2967319..>2967398))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144949"
FT                   /product="mCG144949"
FT                   /note="gene_id=mCG144949.0 transcript_id=mCT184373.0
FT                   protein_id=mCP105214.0"
FT                   /protein_id="EDL02390.1"
FT                   /translation="SLGLLPFFHNTSSLQSGKKTSAANLSRLASDSSLLKKVPAEARRG
FT                   CEIPGAA"
FT   assembly_gap    2969287..2969446
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    2979632..2979701
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    2981477..2981496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3000104..3000123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3003963..3009441
FT                   /gene="Aldh1b1"
FT                   /locus_tag="mCG_51656"
FT                   /note="gene_id=mCG51656.1"
FT   mRNA            join(3003963..3004006,3007290..3009441)
FT                   /gene="Aldh1b1"
FT                   /locus_tag="mCG_51656"
FT                   /product="aldehyde dehydrogenase 1 family, member B1"
FT                   /note="gene_id=mCG51656.1 transcript_id=mCT51839.1 created
FT                   on 22-AUG-2002"
FT   CDS             3007299..3008858
FT                   /codon_start=1
FT                   /gene="Aldh1b1"
FT                   /locus_tag="mCG_51656"
FT                   /product="aldehyde dehydrogenase 1 family, member B1"
FT                   /note="gene_id=mCG51656.1 transcript_id=mCT51839.1
FT                   protein_id=mCP28424.2"
FT                   /protein_id="EDL02389.1"
FT                   /translation="MLTARLLLPRLLCLQGRTTSYSTAAALPNPIPNPEICYNKLFINN
FT                   EWHDAVSKKTFPTVNPTTGEVIGHVAEGDRADVDLAVKAAREAFRLGSPWRRMDASERG
FT                   RLLNRLADLVERDRVYLASLETLDNGKPFQESYVLDLDEVIKVYRYFAGWADKWHGKTI
FT                   PMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALY
FT                   LASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGESNL
FT                   KRVTLELGGKSPSIVLADADMEHAVDQCHEALFFNMGQCCCAGSRTFVEESIYREFLER
FT                   TVEKAKQRKVGNPFELDTQQGPQVDKEQFERILGYIRLGQKEGAKLLCGGERLGERGFF
FT                   IKPTVFGDVQDGMRIAKEEIFGPVQPLFKFKKIEEVIQRANNTRYGLAAAVFTRDLDKA
FT                   IYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLRAYTEVKTVTIKVPEK
FT                   NS"
FT   gene            complement(3014309..3031822)
FT                   /gene="Igfbpl1"
FT                   /locus_tag="mCG_14155"
FT                   /note="gene_id=mCG14155.1"
FT   mRNA            complement(join(3014309..3016202,3018215..3018372,
FT                   3020294..3020410,3021100..3021209,3031365..3031822))
FT                   /gene="Igfbpl1"
FT                   /locus_tag="mCG_14155"
FT                   /product="insulin-like growth factor binding protein-like
FT                   1"
FT                   /note="gene_id=mCG14155.1 transcript_id=mCT12508.1 created
FT                   on 12-JUL-2002"
FT   CDS             complement(join(3018223..3018372,3020294..3020410,
FT                   3021100..3021209,3031365..3031800))
FT                   /codon_start=1
FT                   /gene="Igfbpl1"
FT                   /locus_tag="mCG_14155"
FT                   /product="insulin-like growth factor binding protein-like
FT                   1"
FT                   /note="gene_id=mCG14155.1 transcript_id=mCT12508.1
FT                   protein_id=mCP5789.1"
FT                   /protein_id="EDL02388.1"
FT                   /translation="MPRLPLLLLLLPSLARGLGLRDAGRRHPECSPCQQDRCPAPSPCP
FT                   APWISARDECGCCARCLGAEGASCGGPVGSRCGPGLVCASRASGTAPEGTGLCVCAQRG
FT                   AVCGSDGRSYSSICALRLRARHAPRAHHGHLHKARDGPCEFAPVVLMPPRDIHNVTGTQ
FT                   VFLSCEVKAVPTPVITWKKVKHSPEGTEGLEELPGDHVNIAVQVRGGPSDHETTSWILI
FT                   NPLRKEDEGVYHCHAANAIGEAQSHGTVTVLDLNRYKSLYSSVPGDLL"
FT   assembly_gap    3021982..3022001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3024001..3024363
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    3047619..3047638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3048966..3088884
FT                   /gene="1300002K09Rik"
FT                   /locus_tag="mCG_14143"
FT                   /note="gene_id=mCG14143.2"
FT   mRNA            join(<3048966..3049410,3053369..3053514,3058329..3058404,
FT                   3060138..3060203,3066914..3067044,3068216..3068336,
FT                   3069245..3069290,3071118..3071246,3071601..3071671,
FT                   3072871..3072982,3075537..3075690,3079793..3079868,
FT                   3081301..3081382,3081562..3081610,3082052..3082169,
FT                   3083310..3083429,3084575..3084738,3086418..3086564,
FT                   3087127..3088490)
FT                   /gene="1300002K09Rik"
FT                   /locus_tag="mCG_14143"
FT                   /product="RIKEN cDNA 1300002K09, transcript variant
FT                   mCT189496"
FT                   /note="gene_id=mCG14143.2 transcript_id=mCT189496.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(3049099..3049249,3058329..3058404,3060103..3060203,
FT                   3066914..3067044,3068216..3068336,3069245..3069290,
FT                   3071118..3071246,3071601..3071671,3072871..3072982,
FT                   3075537..3075690,3079793..3079868,3081301..3081382,
FT                   3081562..3081610,3082052..3082169,3083310..3083429,
FT                   3084575..3084738,3086418..3086564,3087127..3088884)
FT                   /gene="1300002K09Rik"
FT                   /locus_tag="mCG_14143"
FT                   /product="RIKEN cDNA 1300002K09, transcript variant
FT                   mCT13914"
FT                   /note="gene_id=mCG14143.2 transcript_id=mCT13914.1 created
FT                   on 10-JUL-2002"
FT   CDS             join(3049230..3049249,3058329..3058404,3060103..3060203,
FT                   3066914..3067044,3068216..3068336,3069245..3069290,
FT                   3071118..3071246,3071601..3071671,3072871..3072982,
FT                   3075537..3075690,3079793..3079868,3081301..3081382,
FT                   3081562..3081610,3082052..3082169,3083310..3083429,
FT                   3084575..3084738,3086418..3086564,3087127..3087275)
FT                   /codon_start=1
FT                   /gene="1300002K09Rik"
FT                   /locus_tag="mCG_14143"
FT                   /product="RIKEN cDNA 1300002K09, isoform CRA_b"
FT                   /note="gene_id=mCG14143.2 transcript_id=mCT13914.1
FT                   protein_id=mCP5797.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q9DBN1"
FT                   /db_xref="MGI:MGI:1921402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DBN1"
FT                   /protein_id="EDL02387.1"
FT                   /translation="MLAASTRTRQINITCDNPVDREVFLHYSLIPSLCIILVLSFLQRR
FT                   EHRRQRDDTSYLLGNHFGIIVPLDFVGTFSNRWSYGAAFGATANKVMFLFSEGYQPLTV
FT                   PQWAQAFVLFIGGMEVGLSYFPFFACLSSEFQLVSSILGFGYSLTWFVVTVLQISQCPH
FT                   GQFLGRFETLVFYWPSLLCLGFLLGRFLHMFLKALPVHLGLEPQTEEKSMLEAHQAKHV
FT                   KQLLSKPRPQEGEKSWFQTRVYEWDPCFQFPSRMVGTLLLAFICLYLFIVIEFCVFLHV
FT                   RDKLDMFEDKLESYLTHMNETGTLTPIILQVKELISVTKGVWVVTILPAALTCVTYLFH
FT                   ILACYRKHMKRLWAGDKHFLPQKFHSPSSAASVVAIARYSGWQIAYILWGYLIIHVVQS
FT                   LCGVMLMYGLVLPIIHHRGLEMLQGFGLGVLTLSIVVGLIILQVWIAGTFFLQPKLGTS
FT                   DKQKPLALNNRRAFHNFNYFLFFYNVLLGLGACLSRLLISCLLGTWLIARIDRTIMQSG
FT                   YEGADMGFGAWIGMLFVDHYHTNPVLVSFCHILITSHKDRKLQKTVKYWCLNQSAGPRF
FT                   SARARTRWFLLQTLINNPRLVMLRKSKSGHSSGEFTQILLTCSDC"
FT   assembly_gap    3056817..3057753
FT                   /estimated_length=937
FT                   /gap_type="unknown"
FT   CDS             join(<3058343..3058404,3060138..3060203,3066914..3067044,
FT                   3068216..3068336,3069245..3069290,3071118..3071246,
FT                   3071601..3071671,3072871..3072982,3075537..3075690,
FT                   3079793..3079868,3081301..3081382,3081562..3081610,
FT                   3082052..3082169,3083310..3083429,3084575..3084738,
FT                   3086418..3086564,3087127..3087275)
FT                   /codon_start=1
FT                   /gene="1300002K09Rik"
FT                   /locus_tag="mCG_14143"
FT                   /product="RIKEN cDNA 1300002K09, isoform CRA_a"
FT                   /note="gene_id=mCG14143.2 transcript_id=mCT189496.0
FT                   protein_id=mCP110481.0 isoform=CRA_a"
FT                   /protein_id="EDL02386.1"
FT                   /translation="ISPVTTQWTGRSSSITPSFHQREHRRQRDDTSYLLGNHFGIIVPL
FT                   DFVGTFSNRWSYGAAFGATANKVMFLFSEGYQPLTVPQWAQAFVLFIGGMEVGLSYFPF
FT                   FACLSSEFQLVSSILGFGYSLTWFVVTVLQISQCPHGQFLGRFETLVFYWPSLLCLGFL
FT                   LGRFLHMFLKALPVHLGLEPQTEEKSMLEAHQAKHVKQLLSKPRPQEGEKSWFQTRVYE
FT                   WDPCFQFPSRMVGTLLLAFICLYLFIVIEFCVFLHVRDKLDMFEDKLESYLTHMNETGT
FT                   LTPIILQVKELISVTKGVWVVTILPAALTCVTYLFHILACYRKHMKRLWAGDKHFLPQK
FT                   FHSPSSAASVVAIARYSGWQIAYILWGYLIIHVVQSLCGVMLMYGLVLPIIHHRGLEML
FT                   QGFGLGVLTLSIVVGLIILQVWIAGTFFLQPKLGTSDKQKPLALNNRRAFHNFNYFLFF
FT                   YNVLLGLGACLSRLLISCLLGTWLIARIDRTIMQSGYEGADMGFGAWIGMLFVDHYHTN
FT                   PVLVSFCHILITSHKDRKLQKTVKYWCLNQSAGPRFSARARTRWFLLQTLINNPRLVML
FT                   RKSKSGHSSGEFTQILLTCSDC"
FT   assembly_gap    3058453..3058742
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    3064793..3064812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3066343..3066362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3072380..3072487
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   gene            3092251..3152594
FT                   /locus_tag="mCG_14146"
FT                   /note="gene_id=mCG14146.2"
FT   mRNA            join(3092251..3092274,3092739..3092836,3095106..3095296,
FT                   3098041..3098129,3100431..3100543,3101855..3101983,
FT                   3102060..3102197,3102289..3102384,3104320..3104483,
FT                   3105748..3105867,3106438..3106517,3107908..3107996,
FT                   3108728..3108850,3111158..3111331,3113185..3113300,
FT                   3114595..3114721,3116064..3116103,3116226..3116428,
FT                   3118052..3118269,3125022..3125166,3125340..3125456,
FT                   3128028..3128126,3129796..3129915,3131393..3131565,
FT                   3131808..3131862,3134277..3134386,3142769..3142835,
FT                   3143642..3143783,3146197..3146357,3146800..3146937,
FT                   3148066..3148177,3150579..3150684,3151278..3151413,
FT                   3152420..3152594)
FT                   /locus_tag="mCG_14146"
FT                   /product="mCG14146"
FT                   /note="gene_id=mCG14146.2 transcript_id=mCT13917.2 created
FT                   on 24-JUL-2002"
FT   CDS             join(3092253..3092274,3092739..3092836,3095106..3095296,
FT                   3098041..3098129,3100431..3100543,3101855..3101983,
FT                   3102060..3102197,3102289..3102384,3104320..3104483,
FT                   3105748..3105867,3106438..3106517,3107908..3107996,
FT                   3108728..3108850,3111158..3111331,3113185..3113300,
FT                   3114595..3114721,3116064..3116103,3116226..3116428,
FT                   3118052..3118269,3125022..3125166,3125340..3125456,
FT                   3128028..3128126,3129796..3129915,3131393..3131565,
FT                   3131808..3131862,3134277..3134386,3142769..3142835,
FT                   3143642..3143783,3146197..3146357,3146800..3146937,
FT                   3148066..3148177,3150579..3150684,3151278..3151413,
FT                   3152420..3152575)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14146"
FT                   /product="mCG14146"
FT                   /note="gene_id=mCG14146.2 transcript_id=mCT13917.2
FT                   protein_id=mCP5818.2"
FT                   /protein_id="EDL02385.1"
FT                   /translation="MREPPGLERRGIGPAVKMSPVGKVSQVQNGKVYQQIFQAQVQLVQ
FT                   SLAATRKQAAERSETQKNVKTPMMKKVPLPEGETMTPRQRKWVRSLPNDWVTENPVLYR
FT                   EKEEARKEKERLTDDMIASQEVQGLMDNIVPQLTERVSNLQEQEEFKKRKYLSALASFQ
FT                   EELEQIGVEMEPLILEKGDLLLRKISKSDEDVDMLFKKVEGEPDLESHTIETLLELWEK
FT                   VAERFMQQKQEIKELDEELLALEVSRADKARWLQMSSLLKEVLKRYVGIIEKTSYILQP
FT                   DVYRLIDKEAMAMNQALLGNRRAIAQLLVNLTESTLQQELDNRHRWQGLVDTWKALKKE
FT                   ALIQSFSEFMASEEIQEPPEVKKKLEEMQKNQEMLQSVRLDHLCTLCDLLPPNYNKTQL
FT                   TEWYDSLTSLNKQLDTYHMDCMSLVHFLYEKIWQQCLSHVQECKQQLLNWKAFSEAEAE
FT                   SLVNPTFFLMVGEFQSKVEKQLELLDNSFEDLARETEWQSSDLFRYFQEAVKLWEGHQS
FT                   VLMTQELELEKRIEQHRQKHNQENQNQETLLDKLLDQLRQQSQEESLKAHMEKARTFLK
FT                   NMKSRYECFHLLLTKEVMEYPGLVLKELNCYSFTLSRHFFIREIFEQNLSGEVIFKFRQ
FT                   PETHEKLFIQKIRKMKKKQRKRKGEESIGQDLGSEKPTESMKEEGSGESEPSTAGEALN
FT                   QENKSPQSDRAESREESDEIPYEEMEFFTTTSGNTYFAFLSVEDEQQIHSRPHSHHNLL
FT                   NSFCTKYIEQVSIPQKLILKVKKGLFSEGGNFSPEEVETLCHRLEKEATRIEFVESLIM
FT                   IHMEKMETEYLDQANDVINKFESKFHNLSSDLIFVEKIQRLMTNLQVNIKCQEAKSNSQ
FT                   AEGLNSSLEQLQQKIQTCQDHRGDKDIVTTDDLLAFVRSWKEKLSQRIKYLNCSLDMVS
FT                   ITQEVFTDTILADTEVESDMHMSMEALEEDVKVGLVTPESFAQPTRMGRPMIEDPAVDV
FT                   VRRILQISQAKSTCPCDKDRSQTGVQSTDLLLPHSMTRHPKYIRVDKKYQVLGEKPTSQ
FT                   AEDFKGIILNLLWESNEHLMVVVEDFYRKEKRPVTRPECMYESFDQCADHISRKILEYH
FT                   RQADEYHNSCLLELRAQVRRFEELLPQVCWLVTENYKEQHWGKFCASLKEVQEQFEQQQ
FT                   KQLELEKDENARKLHPNLGHPTYISQMESLQMAEELRQQELNRMIHENQEKMEEFAKKY
FT                   ARFFISNLASFTERFLMQLDEVITIDDIQVPRSEPPKQKVSILIRRKLAMLSLEEESEK
FT                   PLIERGSRKWPGIKPNEITIQNKILTRRTPSITTNKTTLGHLAAIEARDAVYLKYLALF
FT                   DKELKGIQDHFRKLLLESQRWKESWKRSLSTIQTLYSTCSPLQLK"
FT   assembly_gap    3093610..3093629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3097101..3097120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3114537..3114556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3150015..3150106
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   gene            3174195..3237207
FT                   /gene="Tdrd7"
FT                   /locus_tag="mCG_14149"
FT                   /note="gene_id=mCG14149.1"
FT   mRNA            join(3174195..3174271,3189641..3189853,3191214..3191355,
FT                   3192186..3192366,3207284..3207769,3209572..3209767,
FT                   3212907..3213018,3215184..3215386,3218987..3219121,
FT                   3220648..3220734,3222929..3223063,3225519..3225629,
FT                   3227781..3228283,3232093..3232253,3236743..3237207)
FT                   /gene="Tdrd7"
FT                   /locus_tag="mCG_14149"
FT                   /product="tudor domain containing 7"
FT                   /note="gene_id=mCG14149.1 transcript_id=mCT13921.1 created
FT                   on 10-JUL-2002"
FT   assembly_gap    3176144..3176163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3182523..3183143
FT                   /estimated_length=621
FT                   /gap_type="unknown"
FT   CDS             join(3189647..3189853,3191214..3191355,3192186..3192366,
FT                   3207284..3207769,3209572..3209767,3212907..3213018,
FT                   3215184..3215386,3218987..3219121,3220648..3220734,
FT                   3222929..3223063,3225519..3225629,3227781..3228283,
FT                   3232093..3232253,3236743..3236963)
FT                   /codon_start=1
FT                   /gene="Tdrd7"
FT                   /locus_tag="mCG_14149"
FT                   /product="tudor domain containing 7"
FT                   /note="gene_id=mCG14149.1 transcript_id=mCT13921.1
FT                   protein_id=mCP5776.2"
FT                   /protein_id="EDL02384.1"
FT                   /translation="MLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLG
FT                   YPTLEAYLRSVPAVVRIEASRSGEIVCYAVACTETARIAQLVARQRTSKRKIGRQINCQ
FT                   MRVKKAMPFFLEGKPKATLRQPGFASDYSISRKPNSALLRDRGSALGVKADVDMPPYPD
FT                   TPVQRHASMSANSRREQPLKSDQDPEKELPPPPPAPKQEVPSQGSPAVMPDVKEKVAEL
FT                   LGKYSSGLWASALPKAFEDMYKVKFPEDALKNLASLSDVCTINYISGNTQKAILYAKLP
FT                   LPTDKILKDEGQAQGDFDIKSMIEQEYLQIEKNMAESADEFLEDITVPPLVIPTEASPY
FT                   VGKDYSAAQELMEDEMKEFYSKNPRVTPIQTVHVGQLLAVNAEEDAWLRAQIISTDENK
FT                   IKASSVCYVDYGFCENIEKSKAYRLNPRFCSLSFQATKCKLAGLEVLNDDPDLVKAVES
FT                   LTCGKIFAVEILDKSDVPLVVLYDTSGEDDININATCLKAICDRSLQVHLQVDAMYTNV
FT                   KVTNICSDGTLYCQVPCKGLNKLNDLLHKTEDYFHCKHMTSEYFISLPFCGKICLFHCK
FT                   GKWLRVEITNVHSSRALDVQFLDSGNSTSVKVSELREIPPRFLQEMLAIPPQAIKCCLA
FT                   DLPQSIGMWTPDAVLWLRDSVLNCSDCSIKVTKMDETKGVAYVYLFTPNNFPDPHRSIN
FT                   RQITNADLWKHQKDVFLSAVSTAASSPGNRNGGTPAPGSPAESLRKSHPEVIKKSVLDH
FT                   TSSFSLEELPPPVHLSRSGEHMDVYVPVACHPGHFVIQPWQEIHKLEVLMEEMILYYSV
FT                   SEERHIAVERDQVYAAKVENKWYRVLLKGILTNGLVSVYELDYGKHELVNIRKVQPLVD
FT                   VFRKLPFQAVTAQLAGVKCSQWSEEASMVFRNHVEKKALVALVQTVVEHTNPWDRKVVL
FT                   YLVDTSLPDTDTWIHDFMSQYLLELSKVN"
FT   gene            3241721..3317353
FT                   /gene="Tmod1"
FT                   /locus_tag="mCG_14153"
FT                   /note="gene_id=mCG14153.2"
FT   mRNA            join(3241721..3241756,3263260..3263428,3280613..3280769,
FT                   3285753..3285872,3293028..3293117,3294363..3294493,
FT                   3296133..3296240,3299160..3299303,3309377..3309521,
FT                   3316862..3317353)
FT                   /gene="Tmod1"
FT                   /locus_tag="mCG_14153"
FT                   /product="tropomodulin 1"
FT                   /note="gene_id=mCG14153.2 transcript_id=mCT13924.1 created
FT                   on 10-JUL-2002"
FT   assembly_gap    3248783..3248857
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    3252749..3252821
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   CDS             join(3263309..3263428,3280613..3280769,3285753..3285872,
FT                   3293028..3293117,3294363..3294493,3296133..3296240,
FT                   3299160..3299303,3309377..3309521,3316862..3316926)
FT                   /codon_start=1
FT                   /gene="Tmod1"
FT                   /locus_tag="mCG_14153"
FT                   /product="tropomodulin 1"
FT                   /note="gene_id=mCG14153.2 transcript_id=mCT13924.1
FT                   protein_id=mCP5778.1"
FT                   /db_xref="GOA:P49813"
FT                   /db_xref="InterPro:IPR004934"
FT                   /db_xref="InterPro:IPR030135"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:98775"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49813"
FT                   /protein_id="EDL02383.1"
FT                   /translation="MSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLP
FT                   AGLRQKDQTTKAPTGPFKREELLDHLEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPMD
FT                   PVLESVTLEPELEEALANASDAELCDIAAILGMHTLMSNQQYYQALGSSSIVNKEGLNS
FT                   VIKPTQYKPVPDEEPNSTDVEETLERIKNNDPELEEVNLNNIRNIPIPTLKAYAEALKE
FT                   NSYVKKFSIVGTRSNDPVAFALAEMLKVNKVLKTLNVESNFISGAGILRLVEALPHNTS
FT                   LVELKIDNQSQPLGNKVEMEIVNMLEKNTTLLKFGYHFTQQGPRLRASNAMMSNNDLVR
FT                   KRRLADLTGPIIPKCRSGV"
FT   assembly_gap    3306370..3306543
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    3314546..3314957
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   gene            complement(3318057..3341085)
FT                   /gene="BC057893"
FT                   /locus_tag="mCG_119327"
FT                   /note="gene_id=mCG119327.1"
FT   mRNA            complement(join(3318057..3319633,3321693..3321831,
FT                   3322391..3322549,3322998..3323116,3326594..3326699,
FT                   3327451..3327576,3331779..3331899,3334293..3334606,
FT                   3337834..3338041,3340934..3341085))
FT                   /gene="BC057893"
FT                   /locus_tag="mCG_119327"
FT                   /product="cDNA sequence BC057893, transcript variant
FT                   mCT120497"
FT                   /note="gene_id=mCG119327.1 transcript_id=mCT120497.1
FT                   created on 10-JUL-2002"
FT   mRNA            complement(join(3318282..3319633,3321693..3321831,
FT                   3322391..3322549,3322998..3323116,3326594..3326699,
FT                   3327451..3327576,3331779..3331899,3334293..3334606,
FT                   3337834..3338038,3340822..>3340863))
FT                   /gene="BC057893"
FT                   /locus_tag="mCG_119327"
FT                   /product="cDNA sequence BC057893, transcript variant
FT                   mCT189487"
FT                   /note="gene_id=mCG119327.1 transcript_id=mCT189487.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(3319395..3319633,3321693..3321831,
FT                   3322391..3322549,3322998..3323116,3326594..3326699,
FT                   3327451..3327576,3331779..3331899,3334293..3334606,
FT                   3337834..>3338004))
FT                   /codon_start=1
FT                   /gene="BC057893"
FT                   /locus_tag="mCG_119327"
FT                   /product="cDNA sequence BC057893, isoform CRA_b"
FT                   /note="gene_id=mCG119327.1 transcript_id=mCT189487.0
FT                   protein_id=mCP110475.0 isoform=CRA_b"
FT                   /protein_id="EDL02382.1"
FT                   /translation="SQMPSSTSPDEEDGLETCVLKVFDLDLKESNLVNPSNSLKAELDG
FT                   STKKKYSFAKKKAFAILVKTKQVPAPSYEFKGKRWRCCQQLFADQISIHRHVATQHAED
FT                   VYQQTASLLKQLTAALSASQSLTPTDKRSSPKDCLTPSQEVSAWLPDVSHVSPQELRSG
FT                   QGDEEGEVLLYYCYCDLEDPHWVCAWQTALCHHLHLTGKIRIATEGINGTVGGSKVATR
FT                   LYVEVMLSCPLFKDYLSEDDFKSSKGGSHCFPELRVGVFEEIVPMGISPSQVSYKKPGI
FT                   HLSPGEFHKEIEKLLSQSSEEQGDTIILDCRNFYESKIGRFQGCLAPDIRKFSYFPSYV
FT                   DKNLDIFRQKRVLMYCTGGIRCERGSAYLRAKGVCKEVFQLKGGIHKYLEEFPDGFYKG
FT                   KLFVFDERFALAYNSSVVSECSYCGAPWDQYKLCSTPQCRQLVLTCSACQGQGFTACCV
FT                   TCQDKGGKQASGPSQDSFKEECECTARRPRIPQEQQAQS"
FT   CDS             complement(join(3319395..3319633,3321693..3321831,
FT                   3322391..3322549,3322998..3323116,3326594..3326699,
FT                   3327451..3327576,3331779..3331899,3334293..3334606,
FT                   3337834..3337998))
FT                   /codon_start=1
FT                   /gene="BC057893"
FT                   /locus_tag="mCG_119327"
FT                   /product="cDNA sequence BC057893, isoform CRA_a"
FT                   /note="gene_id=mCG119327.1 transcript_id=mCT120497.1
FT                   protein_id=mCP53647.1 isoform=CRA_a"
FT                   /protein_id="EDL02381.1"
FT                   /translation="MPSSTSPDEEDGLETCVLKVFDLDLKESNLVNPSNSLKAELDGST
FT                   KKKYSFAKKKAFAILVKTKQVPAPSYEFKGKRWRCCQQLFADQISIHRHVATQHAEDVY
FT                   QQTASLLKQLTAALSASQSLTPTDKRSSPKDCLTPSQEVSAWLPDVSHVSPQELRSGQG
FT                   DEEGEVLLYYCYCDLEDPHWVCAWQTALCHHLHLTGKIRIATEGINGTVGGSKVATRLY
FT                   VEVMLSCPLFKDYLSEDDFKSSKGGSHCFPELRVGVFEEIVPMGISPSQVSYKKPGIHL
FT                   SPGEFHKEIEKLLSQSSEEQGDTIILDCRNFYESKIGRFQGCLAPDIRKFSYFPSYVDK
FT                   NLDIFRQKRVLMYCTGGIRCERGSAYLRAKGVCKEVFQLKGGIHKYLEEFPDGFYKGKL
FT                   FVFDERFALAYNSSVVSECSYCGAPWDQYKLCSTPQCRQLVLTCSACQGQGFTACCVTC
FT                   QDKGGKQASGPSQDSFKEECECTARRPRIPQEQQAQS"
FT   gene            3340996..3374845
FT                   /locus_tag="mCG_14148"
FT                   /note="gene_id=mCG14148.2"
FT   mRNA            join(3340996..3341328,3347223..3347311,3347812..3347912,
FT                   3349844..3350000,3352326..3352433,3353103..3353224,
FT                   3354480..3354549,3355374..3355589,3358200..3358297,
FT                   3359213..3359276,3360270..3360380,3362101..3362165,
FT                   3363699..3363761,3364530..3364604,3365402..3365505,
FT                   3367609..3367731,3369180..3369282,3369744..3369837,
FT                   3370893..3370996,3371571..3371685,3372387..3372515,
FT                   3372912..3373025,3374334..3374845)
FT                   /locus_tag="mCG_14148"
FT                   /product="mCG14148"
FT                   /note="gene_id=mCG14148.2 transcript_id=mCT13920.1 created
FT                   on 10-JUL-2002"
FT   CDS             join(3341295..3341328,3347223..3347311,3347812..3347912,
FT                   3349844..3350000,3352326..3352433,3353103..3353224,
FT                   3354480..3354549,3355374..3355589,3358200..3358297,
FT                   3359213..3359276,3360270..3360380,3362101..3362165,
FT                   3363699..3363761,3364530..3364604,3365402..3365505,
FT                   3367609..3367731,3369180..3369282,3369744..3369837,
FT                   3370893..3370996,3371571..3371685,3372387..3372515,
FT                   3372912..3373025,3374334..3374447)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14148"
FT                   /product="mCG14148"
FT                   /note="gene_id=mCG14148.2 transcript_id=mCT13920.1
FT                   protein_id=mCP5819.1"
FT                   /db_xref="GOA:Q3UYV9"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR015172"
FT                   /db_xref="InterPro:IPR015174"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027159"
FT                   /db_xref="MGI:MGI:1891840"
FT                   /db_xref="PDB:3UKZ"
FT                   /db_xref="PDB:3UL0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3UYV9"
FT                   /protein_id="EDL02380.1"
FT                   /translation="MSRRRHSYENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACS
FT                   LESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEF
FT                   VEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQ
FT                   VRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFSTTESYLKRRQKTHVPMLQVWTADKP
FT                   HPQEEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDSV
FT                   YPMPRVIFRMFDYTDDPEGPVMPGSHSVERFVIEENLHCIIKSYWKERKTCAAQLVSYP
FT                   GKNKIPLNYHIVEVIFAELFQLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLY
FT                   MRLDTMSTTCVDRFINWFSHHLSNFQFRWSWEDWSDCLTQDLESPKPKFVREVLEKCMR
FT                   LSYHQHILDIVPPTFSALCPANPTCIYKYGDESSNSLPGHSVALCLSVAFKSKATNDEI
FT                   FSILKDVPNPNQVDDDDEGFRFNPLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTL
FT                   AESDKGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRL
FT                   FVWEILHSTIRKMNKHVLKIQKELEEAKEKLARQHKRRSDDDDRSSDRKDGALEEQIER
FT                   LQEKVEAAQSEQKNLFLVIFQRFIMILTEHLVRCETDGTSILTPWYKNCIERLQQIFLQ
FT                   HHQTIQQYMVTLENLLFTAELDPHILAVFQQFCALQA"
FT   gene            complement(3357798..3398743)
FT                   /gene="Xpa"
FT                   /locus_tag="mCG_14151"
FT                   /note="gene_id=mCG14151.2"
FT   mRNA            complement(join(3357798..3358276,3385560..3385677,
FT                   3386730..3386895,3388033..3388138,3395512..3395619,
FT                   3398481..3398720))
FT                   /gene="Xpa"
FT                   /locus_tag="mCG_14151"
FT                   /product="xeroderma pigmentosum, complementation group A,
FT                   transcript variant mCT181758"
FT                   /note="gene_id=mCG14151.2 transcript_id=mCT181758.0 created
FT                   on 01-APR-2003"
FT   CDS             complement(join(3358107..3358276,3385560..3385677,
FT                   3386730..3386895,3388033..3388138,3395512..3395619,
FT                   3398481..3398652))
FT                   /codon_start=1
FT                   /gene="Xpa"
FT                   /locus_tag="mCG_14151"
FT                   /product="xeroderma pigmentosum, complementation group A,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG14151.2 transcript_id=mCT181758.0
FT                   protein_id=mCP104680.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8K2X7"
FT                   /db_xref="InterPro:IPR000465"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR022652"
FT                   /db_xref="InterPro:IPR022656"
FT                   /db_xref="InterPro:IPR022658"
FT                   /db_xref="MGI:MGI:99135"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K2X7"
FT                   /protein_id="EDL02378.1"
FT                   /translation="MATAEEKQTSPEPVAADEPAQLPAAVRASVERKRQRALMLRQARL
FT                   AARPYPAAAATGGVASVKAAPKMIDTKGGFILEEEEEKHEIGNIVHEPGPVMEFDYTIC
FT                   EECGKEFMDSYLMNHFDLPTCDSCRDADDKHKLITKTEAKQEYLLKDCDLEKREPALRF
FT                   LVKKNPRHSQWGDMKLYLKLQVVKRALEVWGSQEALEDAKEVRQENREKMKQKKFDKKV
FT                   KVGLDDAVKILLDDKPLHRMAPWHNRALEKRSSVLTRTTTKQISFIYSINTCDCCAK"
FT   mRNA            complement(join(3377676..3377852,3385560..3385677,
FT                   3386730..3386895,3388033..3388138,3395512..3395619,
FT                   3398481..3398743))
FT                   /gene="Xpa"
FT                   /locus_tag="mCG_14151"
FT                   /product="xeroderma pigmentosum, complementation group A,
FT                   transcript variant mCT13922"
FT                   /note="gene_id=mCG14151.2 transcript_id=mCT13922.0 created
FT                   on 01-APR-2003"
FT   CDS             complement(join(3377704..3377852,3385560..3385677,
FT                   3386730..3386895,3388033..3388138,3395512..3395619,
FT                   3398481..3398652))
FT                   /codon_start=1
FT                   /gene="Xpa"
FT                   /locus_tag="mCG_14151"
FT                   /product="xeroderma pigmentosum, complementation group A,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG14151.2 transcript_id=mCT13922.0
FT                   protein_id=mCP5775.1 isoform=CRA_b"
FT                   /protein_id="EDL02379.1"
FT                   /translation="MATAEEKQTSPEPVAADEPAQLPAAVRASVERKRQRALMLRQARL
FT                   AARPYPAAAATGGVASVKAAPKMIDTKGGFILEEEEEKHEIGNIVHEPGPVMEFDYTIC
FT                   EECGKEFMDSYLMNHFDLPTCDSCRDADDKHKLITKTEAKQEYLLKDCDLEKREPALRF
FT                   LVKKNPRHSQWGDMKLYLKLQVVKRALEVWGSQEALEDAKEVRQENREKMKQKKFDKKV
FT                   KELRRAIRSSVWKRETTTHQHEYGPEENLEDDMYRKTCTLCGHELTYEKM"
FT   assembly_gap    3418257..3418433
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    3421712..3422626
FT                   /estimated_length=915
FT                   /gap_type="unknown"
FT   assembly_gap    3440748..3440767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3445740..>3446613)
FT                   /locus_tag="mCG_52317"
FT                   /note="gene_id=mCG52317.2"
FT   mRNA            complement(3445740..>3446613)
FT                   /locus_tag="mCG_52317"
FT                   /product="mCG52317"
FT                   /note="gene_id=mCG52317.2 transcript_id=mCT52500.1 created
FT                   on 10-JUL-2002"
FT   CDS             complement(3445969..3446613)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52317"
FT                   /product="mCG52317"
FT                   /note="gene_id=mCG52317.2 transcript_id=mCT52500.1
FT                   protein_id=mCP28418.1"
FT                   /protein_id="EDL02377.1"
FT                   /translation="MDEVVAEELDDEEQLVRRHQKEKKELQAKIQGMKNAVPKNDKKRR
FT                   KQLTEDVAKLEREMEQKHREELEQLKQLTFKDSKTDSVAVNISNLVLENQPPRISKAQK
FT                   RWEKKAALEKEREERIAEAEIENLSGARHLESEKLAQILAARELEIKQIPSDGHCMYGA
FT                   LEDQLREQDCALTVASLRRQTAEYMQSHSDDFLPFLTNPSTVHTRRVWEVL"
FT   assembly_gap    3457120..3457397
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   gene            complement(3476332..3477344)
FT                   /pseudo
FT                   /locus_tag="mCG_1041296"
FT                   /note="gene_id=mCG1041296.1"
FT   mRNA            complement(3476332..3477344)
FT                   /pseudo
FT                   /locus_tag="mCG_1041296"
FT                   /note="gene_id=mCG1041296.1 transcript_id=mCT159000.1
FT                   created on 10-JUL-2002"
FT   assembly_gap    3476834..3476853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3494401..3494454
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    3501395..3501678
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    3503361..3503526
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    3513096..3513276
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    3526659..3526760
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   gene            3530065..3530727
FT                   /locus_tag="mCG_4432"
FT                   /note="gene_id=mCG4432.2"
FT   mRNA            3530065..3530727
FT                   /locus_tag="mCG_4432"
FT                   /product="mCG4432"
FT                   /note="gene_id=mCG4432.2 transcript_id=mCT2767.2 created on
FT                   10-JUL-2002"
FT   CDS             3530111..3530569
FT                   /codon_start=1
FT                   /locus_tag="mCG_4432"
FT                   /product="mCG4432"
FT                   /note="gene_id=mCG4432.2 transcript_id=mCT2767.2
FT                   protein_id=mCP5787.2"
FT                   /protein_id="EDL02376.1"
FT                   /translation="MAKSKNHTTHNQSHKWHRNGIKKPRSQRYESLKGVDPKFLRNMRL
FT                   AKKHNKKGLKKMQANNAKAVSARAEAIKALVKPKLPSPRCQRAPAANSAVWLSSFTPSL
FT                   GSRFEATWPRVRGSANRSLRSKPRQGPKLQLRPRLQLQPRLPKVPRPL"
FT   gene            complement(3531281..3548379)
FT                   /locus_tag="mCG_58495"
FT                   /note="gene_id=mCG58495.1"
FT   mRNA            complement(join(3531281..3531790,3532539..3532639,
FT                   3548275..3548379))
FT                   /locus_tag="mCG_58495"
FT                   /product="mCG58495"
FT                   /note="gene_id=mCG58495.1 transcript_id=mCT58678.1 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(3531663..3531790,3532539..3532578))
FT                   /codon_start=1
FT                   /locus_tag="mCG_58495"
FT                   /product="mCG58495"
FT                   /note="gene_id=mCG58495.1 transcript_id=mCT58678.1
FT                   protein_id=mCP28396.2"
FT                   /protein_id="EDL02374.1"
FT                   /translation="MAGVWAAAVCLCEGRTDIHTTPGAVWVGLKRWRTLVACSRSLCCI
FT                   LVERSVAPTC"
FT   assembly_gap    3546967..3547416
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   gene            <3547418..>3548170
FT                   /gene="Foxe1"
FT                   /locus_tag="mCG_61587"
FT                   /note="gene_id=mCG61587.2"
FT   mRNA            <3547418..>3548170
FT                   /gene="Foxe1"
FT                   /locus_tag="mCG_61587"
FT                   /product="forkhead box E1 (thyroid transcription factor 2)"
FT                   /note="gene_id=mCG61587.2 transcript_id=mCT61770.2 created
FT                   on 10-JUL-2002"
FT   CDS             <3547418..3548170
FT                   /codon_start=1
FT                   /gene="Foxe1"
FT                   /locus_tag="mCG_61587"
FT                   /product="forkhead box E1 (thyroid transcription factor 2)"
FT                   /note="gene_id=mCG61587.2 transcript_id=mCT61770.2
FT                   protein_id=mCP28397.2"
FT                   /protein_id="EDL02375.1"
FT                   /translation="RPGKGNYWALDPNAEDMFESGSFLRRRKRFKRSDLSTYPAYMHDA
FT                   AAAAAAAAAAIFPGAVPAARPAYPGAVYAGYAPPLAAPPPVYYPAASPGPCRVFGLVPE
FT                   RPLSPDLGPAPSAAGGSCAFAAAAGAAGTGSFQPAVCTGARPVNPAAYAAAYAGPDGAY
FT                   PQGASSALFAAAAGRLAGPASPPAGGGSGGVEATVDFYGRTSPGQFGAALGPCYNPGGQ
FT                   LGAGGGGAYHSRHATAYPGAVDRFVSAM"
FT   assembly_gap    3552242..3552452
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    3557457..3557777
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    3561984..3562003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3566310..3566357
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    3569348..3569703
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    3572834..3573351
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   gene            complement(3578821..3591753)
FT                   /locus_tag="mCG_4422"
FT                   /note="gene_id=mCG4422.3"
FT   mRNA            complement(join(3578821..3579564,3582306..3582631,
FT                   3584380..3585006,3588415..3588572,3589889..3590063,
FT                   3591641..>3591741))
FT                   /locus_tag="mCG_4422"
FT                   /product="mCG4422, transcript variant mCT189482"
FT                   /note="gene_id=mCG4422.3 transcript_id=mCT189482.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(3579295..3579564,3582414..3582631,
FT                   3584380..3585006,3588415..3588572,3589889..3590063,
FT                   3591637..3591737))
FT                   /locus_tag="mCG_4422"
FT                   /product="mCG4422, transcript variant mCT173161"
FT                   /note="gene_id=mCG4422.3 transcript_id=mCT173161.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(3579352..3579564,3582414..3582631,
FT                   3584380..3585006,3588415..3588572,3589889..3590063,
FT                   3591637..3591712))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4422"
FT                   /product="mCG4422, isoform CRA_a"
FT                   /note="gene_id=mCG4422.3 transcript_id=mCT173161.0
FT                   protein_id=mCP96080.0 isoform=CRA_a"
FT                   /protein_id="EDL02371.1"
FT                   /translation="MRGLEKQGSCATAAPCGCVQPALEAGNLLTEPIGYLESCFPAKIG
FT                   TPRQPSICSHSRACLKIRKNIFNNPEHSLMGLEEFSHVWILFVFHKNGHLNYKAKVQPP
FT                   RLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAVYLSGVDMIDGTPVLDIKPYIADY
FT                   DSPQNLSVHNDHHKLRAEAQVDGTANSCDQLLLSGRGKVQPRQSTKERPKCLEDRTSGE
FT                   NSQKSRDMSEIQHTLPEDRERALDLALEPSRGESMDMPENQLGPPELKSFLEEGTDRPR
FT                   KVEGALVLPGSSAETQWDASYRARTADRVPYSVVPSWVTEAPVAPLQVRFTPHAEMDLR
FT                   KLNSGDASQPSFKYFHSAEEAKRAIEAVLSADPRSVYRRKLCEDRLFFFTVDTAHVTCW
FT                   FGDGFAEVVRIKLASESVQTVLPPSPSPNGREEQSSVEEEVQQRAGPSRRAAPRAASML
FT                   LTPQSSSLATSALTHWAISLPPLPQGLVFS"
FT   mRNA            complement(join(3582251..3582631,3584380..3585006,
FT                   3588415..3588572,3589889..3590063,3591637..3591753))
FT                   /locus_tag="mCG_4422"
FT                   /product="mCG4422, transcript variant mCT2769"
FT                   /note="gene_id=mCG4422.3 transcript_id=mCT2769.2 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(3582372..3582631,3584380..3585006,
FT                   3588415..3588572,3589889..3590063,3591641..>3591740))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4422"
FT                   /product="mCG4422, isoform CRA_b"
FT                   /note="gene_id=mCG4422.3 transcript_id=mCT189482.0
FT                   protein_id=mCP110512.0 isoform=CRA_b"
FT                   /protein_id="EDL02372.1"
FT                   /translation="RADDSAACNHARLGEAGLVCYGGPMWVRSAGPGGNLLTEPIGYLE
FT                   SCFPAKIGTPRQPSICSHSRACLKIRKNIFNNPEHSLMGLEEFSHVWILFVFHKNGHLN
FT                   YKAKVQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAVYLSGVDMIDGTPVLD
FT                   IKPYIADYDSPQNLSVHNDHHKLRAEAQVDGTANSCDQLLLSGRGKVQPRQSTKERPKC
FT                   LEDRTSGENSQKSRDMSEIQHTLPEDRERALDLALEPSRGESMDMPENQLGPPELKSFL
FT                   EEGTDRPRKVEGALVLPGSSAETQWDASYRARTADRVPYSVVPSWVTEAPVAPLQVRFT
FT                   PHAEMDLRKLNSGDASQPSFKYFHSAEEAKRAIEAVLSADPRSVYRRKLCEDRLFFFTV
FT                   DTAHVTCWFGDGFAEVVRIKLASESVQVADPEESLAALGS"
FT   CDS             complement(join(3582372..3582631,3584380..3585006,
FT                   3588415..3588572,3589889..3590063,3591637..3591712))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4422"
FT                   /product="mCG4422, isoform CRA_c"
FT                   /note="gene_id=mCG4422.3 transcript_id=mCT2769.2
FT                   protein_id=mCP5801.2 isoform=CRA_c"
FT                   /protein_id="EDL02373.1"
FT                   /translation="MRGLEKQGSCATAAPCGCVQPALEAGNLLTEPIGYLESCFPAKIG
FT                   TPRQPSICSHSRACLKIRKNIFNNPEHSLMGLEEFSHVWILFVFHKNGHLNYKAKVQPP
FT                   RLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAVYLSGVDMIDGTPVLDIKPYIADY
FT                   DSPQNLSVHNDHHKLRAEAQVDGTANSCDQLLLSGRGKVQPRQSTKERPKCLEDRTSGE
FT                   NSQKSRDMSEIQHTLPEDRERALDLALEPSRGESMDMPENQLGPPELKSFLEEGTDRPR
FT                   KVEGALVLPGSSAETQWDASYRARTADRVPYSVVPSWVTEAPVAPLQVRFTPHAEMDLR
FT                   KLNSGDASQPSFKYFHSAEEAKRAIEAVLSADPRSVYRRKLCEDRLFFFTVDTAHVTCW
FT                   FGDGFAEVVRIKLASESVQVADPEESLAALGS"
FT   gene            complement(3596303..3615790)
FT                   /gene="Hemgn"
FT                   /locus_tag="mCG_4421"
FT                   /note="gene_id=mCG4421.2"
FT   mRNA            complement(join(3596303..3597028,3598154..3598942,
FT                   3606288..3606419,3615667..3615790))
FT                   /gene="Hemgn"
FT                   /locus_tag="mCG_4421"
FT                   /product="hemogen, transcript variant mCT2768"
FT                   /note="gene_id=mCG4421.2 transcript_id=mCT2768.2 created on
FT                   10-JUL-2002"
FT   mRNA            complement(join(3596807..3597028,3598154..3599373,
FT                   3603067..3603160,3606288..3606419,3615667..>3615782))
FT                   /gene="Hemgn"
FT                   /locus_tag="mCG_4421"
FT                   /product="hemogen, transcript variant mCT189530"
FT                   /note="gene_id=mCG4421.2 transcript_id=mCT189530.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(3596910..3597028,3598154..3599373,
FT                   3603067..3603160,3606288..3606419,3615667..>3615685))
FT                   /codon_start=1
FT                   /gene="Hemgn"
FT                   /locus_tag="mCG_4421"
FT                   /product="hemogen, isoform CRA_a"
FT                   /note="gene_id=mCG4421.2 transcript_id=mCT189530.0
FT                   protein_id=mCP110511.0 isoform=CRA_a"
FT                   /protein_id="EDL02369.1"
FT                   /translation="PYCLDQAFRLLVKSKPIPRRHRGKMDMGKGRPRLKLPQMPEAHPQ
FT                   KSCAPDIIGSWSLRNREQLRKRKAEAQGRQTSQWLLGEQKKRKYQRTGKGNKRGRKRQG
FT                   NVEQKAEPWSQTERERVQEVLVSAEEETEHPGNSATEALPLVPSPTKAVPADQCSEAHQ
FT                   ESIQCQERAIQNHSQTHLSPTTCQGIAVLQHSPKMCQDMAEPEVFSPNMCQETAVPQTY
FT                   PPKALEEMAAAEPLSPKMCQETTVSPNHSSKVPQDMAGPEALSPNMCQEPTVPQEHTLK
FT                   MCHDVARPEVLSPKTHQEMAVPKAFPCVTPGDAAGLEGCAPKALPQSDVAEGCPLDTTP
FT                   TSVTPEQTTSDPDLGMAVTEGFFSEARECTVSEGVSTKTHQEAVEPEFISHETYKEFTV
FT                   PIVSSQKTIQESPEPEQYSPETCQPIPGPENYSLETCHEMSGPEDLSIKTCQDREEPKH
FT                   SLPEGAQKVGGAQGQDADAQDSENAGAFSQDFTEMEEENKADQDPEAPASPQGSQETCP
FT                   ENGIYSSALF"
FT   CDS             complement(join(3596910..3597028,3598154..3598942,
FT                   3606288..3606366))
FT                   /codon_start=1
FT                   /gene="Hemgn"
FT                   /locus_tag="mCG_4421"
FT                   /product="hemogen, isoform CRA_b"
FT                   /note="gene_id=mCG4421.2 transcript_id=mCT2768.2
FT                   protein_id=mCP5793.2 isoform=CRA_b"
FT                   /protein_id="EDL02370.1"
FT                   /translation="MDMGKGRPRLKLPQMPEAHPQKSCAPALEEMAAAEPLSPKMCQET
FT                   TVSPNHSSKVPQDMAGPEALSPNMCQEPTVPQEHTLKMCHDVARPEVLSPKTHQEMAVP
FT                   KAFPCVTPGDAAGLEGCAPKALPQSDVAEGCPLDTTPTSVTPEQTTSDPDLGMAVTEGF
FT                   FSEARECTVSEGVSTKTHQEAVEPEFISHETYKEFTVPIVSSQKTIQESPEPEQYSPET
FT                   CQPIPGPENYSLETCHEMSGPEDLSIKTCQDREEPKHSLPEGAQKVGGAQGQDADAQDS
FT                   ENAGAFSQDFTEMEEENKADQDPEAPASPQGSQETCPENGIYSSALF"
FT   assembly_gap    3597605..3597694
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    3601780..3601925
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    3610210..3610235
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    3614708..3615127
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   gene            complement(3622192..3622656)
FT                   /pseudo
FT                   /locus_tag="mCG_51798"
FT                   /note="gene_id=mCG51798.2"
FT   mRNA            complement(3622192..3622656)
FT                   /pseudo
FT                   /locus_tag="mCG_51798"
FT                   /note="gene_id=mCG51798.2 transcript_id=mCT51981.2 created
FT                   on 10-JUL-2002"
FT   assembly_gap    3623810..3623829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3630311..3630619
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    3639469..3639488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3640880..3640899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3645873..3645892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3647881..3647900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3655800..3677822
FT                   /locus_tag="mCG_119320"
FT                   /note="gene_id=mCG119320.1"
FT   mRNA            join(3655800..3656277,3665252..3665401,3668969..3669091,
FT                   3673721..3673949,3677252..3677822)
FT                   /locus_tag="mCG_119320"
FT                   /product="mCG119320"
FT                   /note="gene_id=mCG119320.1 transcript_id=mCT120490.1
FT                   created on 10-JUL-2002"
FT   assembly_gap    3656278..3656459
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    3656946..3657621
FT                   /estimated_length=676
FT                   /gap_type="unknown"
FT   CDS             join(3665285..3665401,3668969..3669091,3673721..3673949,
FT                   3677252..3677319)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119320"
FT                   /product="mCG119320"
FT                   /note="gene_id=mCG119320.1 transcript_id=mCT120490.1
FT                   protein_id=mCP53640.1"
FT                   /protein_id="EDL02368.1"
FT                   /translation="MDGKIEGLTDEFVNLEFLSLISVGLFSVSDLPKLPKLKKLELSEN
FT                   RIFGGLDRLAEELPSLTHLNLSGNNLKDISTLEPLKRLDCLKSLDLFGCEVTNRSDYRE
FT                   TVFRLLPQLSYLDGYDREDQEAPDSDVEVDSVEEAPDSDGEVDGVDKEEEDEEEEESGK
FT                   GEKRKRETDDEGEDD"
FT   assembly_gap    3681864..3681883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3683280..3683309
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    3687942..3687983
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   gene            3694625..3709145
FT                   /gene="Nans"
FT                   /locus_tag="mCG_4426"
FT                   /note="gene_id=mCG4426.1"
FT   mRNA            join(3694625..3694841,3698057..3698272,3704394..3704493,
FT                   3705417..3705571,3706064..3706330,3707894..3708655,
FT                   3708759..3709145)
FT                   /gene="Nans"
FT                   /locus_tag="mCG_4426"
FT                   /product="N-acetylneuraminic acid synthase (sialic acid
FT                   synthase)"
FT                   /note="gene_id=mCG4426.1 transcript_id=mCT2761.1 created on
FT                   10-JUL-2002"
FT   CDS             join(3694710..3694841,3698057..3698272,3704394..3704493,
FT                   3705417..3705571,3706064..3706330,3707894..3708103)
FT                   /codon_start=1
FT                   /gene="Nans"
FT                   /locus_tag="mCG_4426"
FT                   /product="N-acetylneuraminic acid synthase (sialic acid
FT                   synthase)"
FT                   /note="gene_id=mCG4426.1 transcript_id=mCT2761.1
FT                   protein_id=mCP5808.1"
FT                   /db_xref="GOA:Q99J77"
FT                   /db_xref="InterPro:IPR006013"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="MGI:MGI:2149820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99J77"
FT                   /protein_id="EDL02367.1"
FT                   /translation="MPLELELCPGRWVGGKHPCFIIAEIGQNHQGDIDVAKRMIRTAKE
FT                   CGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYKELQSYAQE
FT                   IGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMD
FT                   TMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDANLRVISEYQKLFPDIPIGYSGHETGIA
FT                   ISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLL
FT                   PCEMACNEKLGKSVVAKVKIPAGTTLTLDMLTVKVGEPKGYPPEDIFNLAGKKVLVTIE
FT                   EDDTVMEESVESHSKKIKA"
FT   assembly_gap    3707170..3707306
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    3708662..3708754
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   gene            complement(3710042..>3735076)
FT                   /gene="Trim14"
FT                   /locus_tag="mCG_4434"
FT                   /note="gene_id=mCG4434.3"
FT   mRNA            complement(join(3710042..3712953,3720899..3721061,
FT                   3722424..3722657,3734813..3735048))
FT                   /gene="Trim14"
FT                   /locus_tag="mCG_4434"
FT                   /product="tripartite motif-containing 14, transcript
FT                   variant mCT2747"
FT                   /note="gene_id=mCG4434.3 transcript_id=mCT2747.2 created on
FT                   10-JUL-2002"
FT   mRNA            complement(join(3712373..3712953,3715892..3715984,
FT                   3720899..3721061,3722424..3722657,3732130..3732225,
FT                   3734813..>3735076))
FT                   /gene="Trim14"
FT                   /locus_tag="mCG_4434"
FT                   /product="tripartite motif-containing 14, transcript
FT                   variant mCT189512"
FT                   /note="gene_id=mCG4434.3 transcript_id=mCT189512.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(3712418..3712953,3715892..3715984,
FT                   3720899..3721061,3722424..3722657,3732130..3732225,
FT                   3734813..>3735076))
FT                   /codon_start=1
FT                   /gene="Trim14"
FT                   /locus_tag="mCG_4434"
FT                   /product="tripartite motif-containing 14, isoform CRA_a"
FT                   /note="gene_id=mCG4434.3 transcript_id=mCT189512.0
FT                   protein_id=mCP110515.0 isoform=CRA_a"
FT                   /protein_id="EDL02365.1"
FT                   /translation="FRFLHQPNPTTLHREQRLPLRMASETTEARAPFQPDGAYGWRCPE
FT                   HSERPAELFCRRCGRCVCALCPVLGAHRGHPVGLAEEEAVRVQKLIQDCLECLATKKRQ
FT                   HADNIAHLEDAGERLKVYADSSKAWLTQKFTELRLLLDEEEVLAKKFIDKSTQLTLQVY
FT                   REQAETCGKQIEVMDDFSTRVWGIGQEPNPVQLLQAYIATKTEMGQQMSPSELSHPVPL
FT                   SFEPVKNFFKEFVEAIGNTLQTPMDTRLKENINCQLSNSSSTKPGALLKTSPSPERALF
FT                   LKYARTPTLDPDTMHARLRLSPDGLTVRCSLLGRLGPRPAPRFDALRQVLGRDGFAAGR
FT                   HYWEVDVQEAGVGWWVGAAYPSLRRRGASAAARLGCNRESWCVKRYDLEYWAFHDGQRS
FT                   RLRPRRDPHRLGVFLDYEAGILAFYDVAGGMSHLHTFHAAFQEPLYPALRLWEGPISIP
FT                   RLP"
FT   CDS             complement(join(3712418..3712953,3720899..3721061,
FT                   3722424..3722657,3734813..3735013))
FT                   /codon_start=1
FT                   /gene="Trim14"
FT                   /locus_tag="mCG_4434"
FT                   /product="tripartite motif-containing 14, isoform CRA_b"
FT                   /note="gene_id=mCG4434.3 transcript_id=mCT2747.2
FT                   protein_id=mCP5788.2 isoform=CRA_b"
FT                   /protein_id="EDL02366.1"
FT                   /translation="MASETTEARAPFQPDGAYGWRCPEHSERPAELFCRRCGRCVCALC
FT                   PVLGAHRGHPVGLAEEEAVRVQVYADSSKAWLTQKFTELRLLLDEEEVLAKKFIDKSTQ
FT                   LTLQVYREQAETCGKQIEVMDDFSTRVWGIGQEPNPVQLLQAYIATKTEMGQQMSPSEL
FT                   SHPVPLSFEPVKNFFKEFVEAIGNTLQTPMDTRLKENARTPTLDPDTMHARLRLSPDGL
FT                   TVRCSLLGRLGPRPAPRFDALRQVLGRDGFAAGRHYWEVDVQEAGVGWWVGAAYPSLRR
FT                   RGASAAARLGCNRESWCVKRYDLEYWAFHDGQRSRLRPRRDPHRLGVFLDYEAGILAFY
FT                   DVAGGMSHLHTFHAAFQEPLYPALRLWEGPISIPRLP"
FT   assembly_gap    3713032..3713051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3724706..3724725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3726774..3726953
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   gene            complement(3738035..>3793532)
FT                   /gene="Coro2a"
FT                   /locus_tag="mCG_119325"
FT                   /note="gene_id=mCG119325.1"
FT   mRNA            complement(join(3738035..3738229,3739380..3739651,
FT                   3742324..3742420,3743039..3743143,3744562..3744678,
FT                   3745599..3745778,3747718..3747867,3750326..3750442,
FT                   3763664..3763873,3793513..3793532))
FT                   /gene="Coro2a"
FT                   /locus_tag="mCG_119325"
FT                   /product="coronin, actin binding protein 2A, transcript
FT                   variant mCT120495"
FT                   /note="gene_id=mCG119325.1 transcript_id=mCT120495.1
FT                   created on 21-NOV-2002"
FT   CDS             complement(join(3738098..3738229,3739380..3739651,
FT                   3742324..3742420,3743039..3743143,3744562..3744678,
FT                   3745599..3745778,3747718..3747867,3750326..3750442,
FT                   3763664..3763864))
FT                   /codon_start=1
FT                   /gene="Coro2a"
FT                   /locus_tag="mCG_119325"
FT                   /product="coronin, actin binding protein 2A, isoform CRA_a"
FT                   /note="gene_id=mCG119325.1 transcript_id=mCT120495.1
FT                   protein_id=mCP53644.1 isoform=CRA_a"
FT                   /protein_id="EDL02363.1"
FT                   /translation="MSWHPQYRSSKFRHVYGKPASKENCYDSVPITRSVHDNHFCAVNP
FT                   HFIAVVTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRGNVLDIKWNPFNDFEIASCSED
FT                   ATIKIWNIPKQLLTRNLTTYRKELIGHARRVGLVEWHPTTANILFSAGYDYKVMVWNLD
FT                   TKDSVIAGPVKTINCHQDVILSMSFNTNGSLLATTCKDRKIRIVDPRLGIVLQEASYKG
FT                   HRANKVLFLGSLKKLLSTGTSRWNNRQMALWDQENLSVPLTEEDLDGSSGVLFPFFDSD
FT                   TSMLYIVGKGDGNIRYYEVSMEKPHLTYLTEYRSYNPQKGIGPIMMSLRPGSELLDSQT
FT                   LPPERPLSNSMVQVSPQPLEPMKQPAEDGDQAPFSLLEEKLAKWTAEHHLGEKSCLTNG
FT                   FDVFECSPPKTENELLQMFYRQQEEIRRLRELLIQREVQTKQLELEIKNLRMALGQL"
FT   assembly_gap    3740660..3741465
FT                   /estimated_length=806
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3741977..3742420,3743039..3743143,
FT                   3744562..3744678,3745599..3745778,3747718..3747867,
FT                   3750326..3750442,3763664..3763864,3793501..>3793532))
FT                   /gene="Coro2a"
FT                   /locus_tag="mCG_119325"
FT                   /product="coronin, actin binding protein 2A, transcript
FT                   variant mCT189481"
FT                   /note="gene_id=mCG119325.1 transcript_id=mCT189481.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(3742277..3742420,3743039..3743143,
FT                   3744562..3744678,3745599..3745778,3747718..3747867,
FT                   3750326..3750442,3763664..3763864,3793501..>3793530))
FT                   /codon_start=1
FT                   /gene="Coro2a"
FT                   /locus_tag="mCG_119325"
FT                   /product="coronin, actin binding protein 2A, isoform CRA_b"
FT                   /note="gene_id=mCG119325.1 transcript_id=mCT189481.0
FT                   protein_id=mCP110474.0 isoform=CRA_b"
FT                   /protein_id="EDL02364.1"
FT                   /translation="AAATCAAANKMSWHPQYRSSKFRHVYGKPASKENCYDSVPITRSV
FT                   HDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRGNVLDIKWNPFN
FT                   DFEIASCSEDATIKIWNIPKQLLTRNLTTYRKELIGHARRVGLVEWHPTTANILFSAGY
FT                   DYKVMVWNLDTKDSVIAGPVKTINCHQDVILSMSFNTNGSLLATTCKDRKIRIVDPRLG
FT                   IVLQEASYKGHRANKVLFLGSLKKLLSTGTSRWNNRQMALWDQENLSVPLTEEDLDGSS
FT                   GVLFPFFDSDTSMLYIVGKGDGNIRYYEVSMEKPHLTYLTEYRSYNPQKGIGEWHAKAM
FT                   WGSGYQN"
FT   assembly_gap    3748522..3748541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3752806..3752825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3754460..3754479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3757443..3757776
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    3761298..3761317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3764054..3765303
FT                   /estimated_length=1250
FT                   /gap_type="unknown"
FT   assembly_gap    3776600..3776619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3783389..3783408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3785310..3785435
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    3793533..3793723
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   gene            complement(3796082..3838546)
FT                   /locus_tag="mCG_119311"
FT                   /note="gene_id=mCG119311.0"
FT   mRNA            complement(join(3796082..3797650,3798065..3798186,
FT                   3798652..3798837,3800666..3800786,3805742..3806218,
FT                   3806821..3807002,3808142..3808252,3812342..3812716,
FT                   3820228..3820427,3821848..3822043,3838123..3838546))
FT                   /locus_tag="mCG_119311"
FT                   /product="mCG119311"
FT                   /note="gene_id=mCG119311.0 transcript_id=mCT120481.0
FT                   created on 10-JUL-2002"
FT   CDS             complement(join(3797443..3797650,3798065..3798186,
FT                   3798652..3798837,3800666..3800786,3805742..3806218,
FT                   3806821..3807002,3808142..3808252,3812342..3812716,
FT                   3820228..3820427,3821848..3822043,3838123..3838488))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119311"
FT                   /product="mCG119311"
FT                   /note="gene_id=mCG119311.0 transcript_id=mCT120481.0
FT                   protein_id=mCP53472.1"
FT                   /protein_id="EDL02362.1"
FT                   /translation="MEDAPERTPSSSESTQPPGLAREPEVVSPGDSEGCARPLDTVPKK
FT                   LCGYLSKFGGKGPIKGWKCRWFFYDERKCHLYYSRTAQDANPLDSIDLSSAVFDCKADA
FT                   EEEGTFEIKTPSRVITLKSSAGSRKAETAGLTLLTCPFRNTMHNIRGNKQAQAAAHGPL
FT                   VEDLPQGGEPQSGEQPSISDPSLPAEKEPEDPAKSAPRSSVPSGPTQKPKRQSNTFPFF
FT                   SDGLARSRTAQEKVAALEQQVLMLTKELKSQKELVIILHKALEAAQQEKRASSAYLAAT
FT                   EDRDRLELVRHKVRQIAELNQRVEALEQGRERLAHEAGLREQQVQALQQHVQLLMDKNH
FT                   AKQQVICKLTQKLTEDLAQPADATNGDFLSQQERMEHLKDDMEAYRTQNRFLNSEIHQV
FT                   TKIWRKVAEKEKALLTKCAYLQARNCQVESKYLAGLRRLQEAAGAEAGDFPELLQQLIQ
FT                   EALQWEAGEADSVGLSPVSEYDDYGFLTVPDYEMEDLKLLAKIQALEVRSHHLLAHEAV
FT                   ERPLRDRWATLTELTPSAELKQLLRAGVPREHRPRVWRWLVHRRVRHLQAPGCYQELLA
FT                   RGRACEHPAARQIELDLNRTFPTNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLN
FT                   RLAAIALLVLEDEESAFWCLVAIVETILPAEYYSKTLTASQVDQRVLQDLLSEKLPRLT
FT                   AHLGQHRVDLSLITFNWFLVVFADSLISDILLRVWDAFLYEGTKVVFRYALAIFKYNEE
FT                   AILQLQDSLEIYQYLRFFTKTICDSRKLMSIAFNDMNPFPMKQLRQLRAAHRERLEAEL
FT                   RELELLKVEYLQRRASLGRAPPEGCVSEDEGEGDS"
FT   assembly_gap    3803808..3803981
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    3807134..3807337
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    3821139..3821278
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    3825001..3825020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3826026..3826045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3827832..3828139
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    3830034..3834777
FT                   /estimated_length=4744
FT                   /gap_type="unknown"
FT   assembly_gap    3836073..3836092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3846833..3847144
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    3849564..3854611
FT                   /estimated_length=5048
FT                   /gap_type="unknown"
FT   gene            complement(<3855828..>4183362)
FT                   /locus_tag="mCG_4430"
FT                   /note="gene_id=mCG4430.2"
FT   mRNA            complement(join(<3855828..3855945,3862771..3862900,
FT                   3865865..3866047,3869535..3869759,3872685..3872795,
FT                   3907360..3907482,3912858..3912965,3922622..3922754,
FT                   3924918..3925068,3928358..3928438,3938507..3938567,
FT                   3975938..3976174,3986986..3987186,3992568..3992633,
FT                   4004247..4004348,4034991..4035161,4064395..4064532,
FT                   4183260..>4183362))
FT                   /locus_tag="mCG_4430"
FT                   /product="mCG4430"
FT                   /note="gene_id=mCG4430.2 transcript_id=mCT2757.2 created on
FT                   18-APR-2003"
FT   CDS             complement(join(<3855828..3855945,3862771..3862900,
FT                   3865865..3866047,3869535..3869759,3872685..3872795,
FT                   3907360..3907482,3912858..3912965,3922622..3922754,
FT                   3924918..3925068,3928358..3928438,3938507..3938567,
FT                   3975938..3976174,3986986..3987186,3992568..3992633,
FT                   4004247..4004348,4034991..4035161,4064395..4064532,
FT                   4183260..>4183361))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4430"
FT                   /product="mCG4430"
FT                   /note="gene_id=mCG4430.2 transcript_id=mCT2757.2
FT                   protein_id=mCP5783.2"
FT                   /protein_id="EDL02361.1"
FT                   /translation="GRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFY
FT                   DAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVP
FT                   SDNAVNPAILKLLKHFRWRRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDP
FT                   CTSVKKLKGNDVRIILGQFDQNMAAKVFCCAFEESMFGSKYQWIIPGWYEPAWWEQVHV
FT                   EANSSRCLRRSLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNSKRSGVGPSKF
FT                   HGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTG
FT                   QVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILE
FT                   QLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSY
FT                   ASIFLFGLDGSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKK
FT                   IIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLEHCE
FT                   NTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAA
FT                   VSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQK
FT                   KEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYI
FT                   KQNHYQELNDILSLGNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSP
FT                   E"
FT   assembly_gap    3858543..3858562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3864892..3864969
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    3867045..3867077
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    3930821..3930840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3943688..3943707
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3962703..3962722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3965368..3965387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3994871..3994890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4002656..4002675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4034061..4034172
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    4037301..4037320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4082197..4082216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4105001..4105020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4106022..4106041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4121356..4121391
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    4139157..4139176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4140869..4140888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4152457..4152815
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    4162653..4162957
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    4166055..4166074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4167404..4167423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4177248..4178097
FT                   /estimated_length=850
FT                   /gap_type="unknown"
FT   assembly_gap    4183539..4184029
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    4194206..4194225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4198164..4198183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4200603..4203039)
FT                   /locus_tag="mCG_1041384"
FT                   /note="gene_id=mCG1041384.1"
FT   mRNA            complement(join(4200603..4200994,4202959..4203039))
FT                   /locus_tag="mCG_1041384"
FT                   /product="mCG1041384"
FT                   /note="gene_id=mCG1041384.1 transcript_id=mCT159088.1
FT                   created on 10-JUL-2002"
FT   CDS             complement(join(4200735..4200994,4202959..4202983))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041384"
FT                   /product="mCG1041384"
FT                   /note="gene_id=mCG1041384.1 transcript_id=mCT159088.1
FT                   protein_id=mCP53407.1"
FT                   /protein_id="EDL02360.1"
FT                   /translation="MTKQSQIFTLLFPAMVSLAMAMVSVVRREQSLWRRRVLNLGNRQR
FT                   ASTSQDTGSTQGRAGNLEGQASTSFPQFLPLREHSPGRYVDVTLGFVFV"
FT   gene            complement(<4209801..4249757)
FT                   /gene="Anks6"
FT                   /locus_tag="mCG_116612"
FT                   /note="gene_id=mCG116612.0"
FT   mRNA            complement(join(<4209801..4209897,4216021..4216137,
FT                   4217963..4218030,4219378..4219470,4223162..4223425,
FT                   4225690..4225843,4228289..4228492,4231487..4231536,
FT                   4232243..4232441,4233591..4233739,4236247..4236353,
FT                   4237532..4237736,4241808..4242310,4249586..4249757))
FT                   /gene="Anks6"
FT                   /locus_tag="mCG_116612"
FT                   /product="ankyrin repeat and sterile alpha motif domain
FT                   containing 6"
FT                   /note="gene_id=mCG116612.0 transcript_id=mCT117735.0
FT                   created on 10-JUL-2002"
FT   CDS             complement(join(<4209801..4209897,4216021..4216137,
FT                   4217963..4218030,4219378..4219470,4223162..4223425,
FT                   4225690..4225843,4228289..4228492,4231487..4231536,
FT                   4232243..4232441,4233591..4233739,4236247..4236353,
FT                   4237532..4237736,4241808..4242310,4249586..4249599))
FT                   /codon_start=1
FT                   /gene="Anks6"
FT                   /locus_tag="mCG_116612"
FT                   /product="ankyrin repeat and sterile alpha motif domain
FT                   containing 6"
FT                   /note="gene_id=mCG116612.0 transcript_id=mCT117735.0
FT                   protein_id=mCP53551.1"
FT                   /protein_id="EDL02359.1"
FT                   /translation="MQAARCGHVSVAHLLLDHGADVNAQNRLGASVLTVASRGGHLGVV
FT                   KLLLEAGAIVDHHTPSGESPATGGSGDELLGITALMAAVQHGHEAVVRLLMEWGADPNH
FT                   TARTVGWSPLMLAALLGKLNVAQQLVEKGANPDHLSVLEKTAFEVALDRKYRDLAEYLD
FT                   PLTTVRPKTGNFQLVKEIADEDPNHVNLVNGDGATPLMLAAVTGHLPLVQLLVEKHADM
FT                   DKQDSVHGWTALMQATYHGNKEIVKYLLNQGADVALRAKNGYTAFDLVMLLNDPDTELV
FT                   RLLASVCMQVNKDRGRPSHRPPLPHSKARQPWSIPVLPDDKGGLKSWWSRMSNRFRKLK
FT                   LMQTLPRGLAANQPLPFSDEPELALDSTMRAPPQDRTSHLGPPEAAHATKDSGPGNPRR
FT                   EKGDVLLTTMLRNGAPFPRLPSDKLKAVIPPFLPPSSFELWSSDRSHTCHNGKADPTKT
FT                   ALPPRASRAHPVGCVGTDGATSRPVKFPSISRSPASPASSGSFNHSPHSSGGASGIGGM
FT                   SRLGGELHSRSGGSVDSVLSQIAAQRKKAAGLCEQKPRQQSSPVGPATSSSPPELPASL
FT                   PSSGSGSSSGPSSSKVLVLWMPVTPVQCFPVTHVQSWDVRGHTAESSVSSSSSHRQSKS
FT                   SGGSSSGTITDEDELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLQELGIKTDGS
FT                   RQQILAAISELNAGKGRERQILQETIHNFHSSFESSASNTRAPGNGP"
FT   assembly_gap    4219682..4220090
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    4235192..4235615
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    4241744..4241763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4247064..4247168
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    4249761..4249999
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    4253867..4253886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4258555..4258574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4262227..4262367
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    4264557..4264576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4266943..4266962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4267158..4267559)
FT                   /pseudo
FT                   /locus_tag="mCG_48871"
FT                   /note="gene_id=mCG48871.2"
FT   mRNA            complement(4267158..4267559)
FT                   /pseudo
FT                   /locus_tag="mCG_48871"
FT                   /note="gene_id=mCG48871.2 transcript_id=mCT49054.2 created
FT                   on 10-JUL-2002"
FT   assembly_gap    4269039..4269058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4272146..4275382
FT                   /estimated_length=3237
FT                   /gap_type="unknown"
FT   gene            <4293677..4324615
FT                   /gene="Galnt12"
FT                   /locus_tag="mCG_4431"
FT                   /note="gene_id=mCG4431.3"
FT   mRNA            join(<4293677..4294098,4305948..4306077,4310173..4310362,
FT                   4313240..4313425,4314106..4314224,4315299..4315476,
FT                   4319476..4319607,4321087..4321200,4321934..4322080,
FT                   4324009..4324615)
FT                   /gene="Galnt12"
FT                   /locus_tag="mCG_4431"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 12, transcript variant
FT                   mCT2766"
FT                   /note="gene_id=mCG4431.3 transcript_id=mCT2766.3 created on
FT                   17-APR-2003"
FT   mRNA            join(<4293693..4294098,4310173..4310362,4313240..4313425,
FT                   4314106..4314224,4315299..4315476,4319476..4319607,
FT                   4321087..4321200,4321934..4322080,4324009..4324289)
FT                   /gene="Galnt12"
FT                   /locus_tag="mCG_4431"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 12, transcript variant
FT                   mCT182008"
FT                   /note="gene_id=mCG4431.3 transcript_id=mCT182008.0 created
FT                   on 17-APR-2003"
FT   assembly_gap    4305911..4305930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4309433..4309452
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<4314157..4314224,4315299..4315476,4319476..4319607,
FT                   4321087..4321200,4321934..4322080,4324009..4324149)
FT                   /codon_start=1
FT                   /gene="Galnt12"
FT                   /locus_tag="mCG_4431"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 12, isoform CRA_a"
FT                   /note="gene_id=mCG4431.3 transcript_id=mCT182008.0
FT                   protein_id=mCP104930.0 isoform=CRA_a"
FT                   /protein_id="EDL02357.1"
FT                   /translation="LSGVLRYRNGSSGEEKTLSSPLGSGSVVALWKRTRAPHVGHVFPK
FT                   QAPYSRSKALANSVRAAEVWMDEFKELYYHRNPQARLEPFGDVTERKKLRAKLQCKDFK
FT                   WFLDTVYPELHVPEDRPGFFGMLQNRGLRGYCLDYNPPNENHVEGHQVLLYLCHGMGQN
FT                   QFFEYTTRKEIRYNTRQPEACITVEDGKDTLVMDLCRETVPENQEFILQEDGTLVHKHS
FT                   RKCVEATEKVLDNGFAPYLRDCTNSDNQRWFFKERMS"
FT   assembly_gap    4314276..4314295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<4315342..4315476,4319476..4319607,4321087..4321200,
FT                   4321934..4322080,4324009..4324149)
FT                   /codon_start=1
FT                   /gene="Galnt12"
FT                   /locus_tag="mCG_4431"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 12, isoform CRA_b"
FT                   /note="gene_id=mCG4431.3 transcript_id=mCT2766.3
FT                   protein_id=mCP5800.3 isoform=CRA_b"
FT                   /protein_id="EDL02358.1"
FT                   /translation="HVGHVFPKQAPYSRSKALANSVRAAEVWMDEFKELYYHRNPQARL
FT                   EPFGDVTERKKLRAKLQCKDFKWFLDTVYPELHVPEDRPGFFGMLQNRGLRGYCLDYNP
FT                   PNENHVEGHQVLLYLCHGMGQNQFFEYTTRKEIRYNTRQPEACITVEDGKDTLVMDLCR
FT                   ETVPENQEFILQEDGTLVHKHSRKCVEATEKVLDNGFAPYLRDCTNSDNQRWFFKERMS
FT                   "
FT   assembly_gap    4326846..4327059
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    4363450..4363469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4366719..4367501
FT                   /estimated_length=783
FT                   /gap_type="unknown"
FT   assembly_gap    4373337..4373508
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    4382562..4382601
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    4384763..4384960
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    4387993..4388012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4410487..4516017
FT                   /gene="Col15a1"
FT                   /locus_tag="mCG_4428"
FT                   /note="gene_id=mCG4428.2"
FT   mRNA            join(4410487..4410829,4410913..4411001,4447846..4448393,
FT                   4449971..4450045,4451651..4451731,4456485..4456629,
FT                   4459655..4459764,4461165..4461299,4462347..4462475,
FT                   4464766..4465032,4465435..4465563,4471559..4471651,
FT                   4472748..4472873,4473408..4473470,4481900..4481935,
FT                   4482310..4482450,4482645..4482710,4483348..4483383,
FT                   4483483..4483566,4485119..4485184,4486973..4487008,
FT                   4489528..4489590,4491832..4491900,4492007..4492042,
FT                   4494818..4494871,4494968..4495027,4495678..4495746,
FT                   4495864..4495905,4498576..4498621,4501224..4501304,
FT                   4501777..4501826,4502263..4502355,4503019..4503163,
FT                   4506420..4506484,4509286..4509414,4509537..4509596,
FT                   4510321..4510380,4512993..4513178,4513347..4513462,
FT                   4514929..4516017)
FT                   /gene="Col15a1"
FT                   /locus_tag="mCG_4428"
FT                   /product="procollagen, type XV, transcript variant mCT2763"
FT                   /note="gene_id=mCG4428.2 transcript_id=mCT2763.4 created on
FT                   15-MAR-2004"
FT   CDS             join(4410819..4410829,4410913..4411001,4447846..4448393,
FT                   4449971..4450045,4451651..4451731,4456485..4456629,
FT                   4459655..4459764,4461165..4461299,4462347..4462475,
FT                   4464766..4465032,4465435..4465563,4471559..4471651,
FT                   4472748..4472873,4473408..4473470,4481900..4481935,
FT                   4482310..4482450,4482645..4482710,4483348..4483383,
FT                   4483483..4483566,4485119..4485184,4486973..4487008,
FT                   4489528..4489590,4491832..4491900,4492007..4492042,
FT                   4494818..4494871,4494968..4495027,4495678..4495746,
FT                   4495864..4495905,4498576..4498621,4501224..4501304,
FT                   4501777..4501826,4502263..4502355,4503019..4503163,
FT                   4506420..4506484,4509286..4509414,4509537..4509596,
FT                   4510321..4510380,4512993..4513178,4513347..4513462,
FT                   4514929..4515142)
FT                   /codon_start=1
FT                   /gene="Col15a1"
FT                   /locus_tag="mCG_4428"
FT                   /product="procollagen, type XV, isoform CRA_c"
FT                   /note="gene_id=mCG4428.2 transcript_id=mCT2763.4
FT                   protein_id=mCP5816.4 isoform=CRA_c"
FT                   /protein_id="EDL02356.1"
FT                   /translation="MTHRRTAQGRRPRWLLSIISALLSAVLQTRAATGSASQVHLDLTV
FT                   LIGVPLPSSVSFTTGYGGFPAYSFGPGANVGRPARTLIPPTFFRDFAIGVAVKPNSAQG
FT                   GVLFAITDAFQKVIYLGLRLSSVEDGRQRVILYYTEPGSHVSREAAVFSVPVMTNRWNR
FT                   FAVTVQGEEVALFMDCEEQSQVRFQRSSWPLTFEPSAGIFVGNAGAMGLERFTGSIQQL
FT                   TIYSDPRTPEELCEAQESSASGEASGFQEMDEVAEIMEAVTYTQAPPKESHVDPISVPP
FT                   TSSSPAEDSELSGEPVPEGTPETNLSIIGHSSPEQGSGEILNDTLEVHAMDGDPGTDDG
FT                   SGDGALLNVTDGQGLSATATGEASVPVTTVLEAENGSMPTGSPTLAMFTQSIREVDTPD
FT                   PENLTTTASGDGEVPTSTDGDTEADSSPTGGPTLKPREEATLGSHGEEWLTPAVSKMPL
FT                   KAFEEEEASGTAIDSLDVIFTPTVVLEQVSRRPTDIQATFTPTVVLEETSGAPTDTQDA
FT                   LTPTVAPEQMFTAEPTDGGDLVASTEEAEEEGSGSMPPSGPPLPTPTVTPKRQVTLVGV
FT                   EAEGSGPVGGLDEGSGSGDIVGNEDLLRGPPGPPGPPGSPGIPGKPGTDVFMGPPGSPG
FT                   EDGAPGEPGPQGPEGQPGLDGASGQQGMKGEKGARGPNGSAGEKGDPGNRGLPGPPGKN
FT                   GEVGTPGVMGPPGPPGPPGPPGPGCTTELGFEIEGSGDVRLLSKPTISGPTSPSGPKGE
FT                   KGEQGAKGERGADGTSTMGPPGPRGPPGHVEVLSSSLINITNGSMNFSDIPELMGPPGP
FT                   DGVPGLPGFPGPRGPKGDTGVPGFPGLKGEQGEKGEPGAILTGDVPLEMMKGRKGEPGI
FT                   HGAPGPMGPKGPPGHKGEFGLPGRPGRPGLNGLKGAKGDRGVTLPGPPGLPGPPGPPGP
FT                   PGAVVNIKGAVFPIPARPHCKTPVGTAHPGDPELVTFHGVKGEKGSWGLPGSKGEKGDQ
FT                   GAQGPPGPPVDPAYLRHFLNSLKGENEDASFRGESSNNLFVSGPPGLPGYPGLVGQKGE
FT                   AVVGPQGPPGIPGLPGPPGFGRPGVPGPPGPPGPPGPPAILGAAVALPGPPGPPGQPGL
FT                   PGSRNLVTALSDMGDMLQKAHLVIEGTFIYLRDSGEFFIRVRDGWKKLQLGELIPIPAD
FT                   SPPPPALSSNPYQPQPPLNPILSANYERPVLHLVALNTPVAGDIRADFQCFQQARAAGL
FT                   LSTFRAFLSSHLQDLSTVVRKAERFGLPIVNLKGQVLFNNWDSIFSGDGGQFNTHIPIY
FT                   SFDGRDVMTDPSWPQKVVWHGSNPHGVRLVDKYCEAWRTTDMAVTGFASPLSTGKILDQ
FT                   KAYSCANRLIVLCIENSFMTDTRK"
FT   assembly_gap    4412860..4412879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(4490555..4490697,4491832..4491900,4492007..4492042,
FT                   4494818..4494871,4494968..4495027,4495678..4495746,
FT                   4495864..4495905,4498576..4498621,4501224..4501304,
FT                   4501777..4501826,4502263..4502355,4503019..4503163,
FT                   4506420..4506484,4509286..4509414,4509537..4509596,
FT                   4510321..4510380,4512993..4513178,4513347..4513462,
FT                   4514929..4516017)
FT                   /gene="Col15a1"
FT                   /locus_tag="mCG_4428"
FT                   /product="procollagen, type XV, transcript variant
FT                   mCT189493"
FT                   /note="gene_id=mCG4428.2 transcript_id=mCT189493.1 created
FT                   on 15-MAR-2004"
FT   CDS             join(4490596..4490697,4491832..4491900,4492007..4492042,
FT                   4494818..4494871,4494968..4495027,4495678..4495746,
FT                   4495864..4495905,4498576..4498621,4501224..4501304,
FT                   4501777..4501826,4502263..4502355,4503019..4503163,
FT                   4506420..4506484,4509286..4509414,4509537..4509596,
FT                   4510321..4510380,4512993..4513178,4513347..4513462,
FT                   4514929..4515142)
FT                   /codon_start=1
FT                   /gene="Col15a1"
FT                   /locus_tag="mCG_4428"
FT                   /product="procollagen, type XV, isoform CRA_a"
FT                   /note="gene_id=mCG4428.2 transcript_id=mCT189493.1
FT                   protein_id=mCP110513.1 isoform=CRA_a"
FT                   /protein_id="EDL02354.1"
FT                   /translation="MHHIAPRTKKEAPETWSSTLGSRELSVLGQVWKHGEKGEPGAILT
FT                   GDVPLEMMKGRKGEPGIHGAPGPMGPKGPPGHKGEFGLPGRPGRPGLNGLKGAKGDRGV
FT                   TLPGPPGLPGPPGPPGPPGAVVNIKGAVFPIPARPHCKTPVGTAHPGDPELVTFHGVKG
FT                   EKGSWGLPGSKGEKGDQGAQGPPGPPVDPAYLRHFLNSLKGENEDASFRGESSNNLFVS
FT                   GPPGLPGYPGLVGQKGEAVVGPQGPPGIPGLPGPPGFGRPGVPGPPGPPGPPGPPAILG
FT                   AAVALPGPPGPPGQPGLPGSRNLVTALSDMGDMLQKAHLVIEGTFIYLRDSGEFFIRVR
FT                   DGWKKLQLGELIPIPADSPPPPALSSNPYQPQPPLNPILSANYERPVLHLVALNTPVAG
FT                   DIRADFQCFQQARAAGLLSTFRAFLSSHLQDLSTVVRKAERFGLPIVNLKGQVLFNNWD
FT                   SIFSGDGGQFNTHIPIYSFDGRDVMTDPSWPQKVVWHGSNPHGVRLVDKYCEAWRTTDM
FT                   AVTGFASPLSTGKILDQKAYSCANRLIVLCIENSFMTDTRK"
FT   mRNA            join(4490785..4491001,4491832..4491900,4492007..4492042,
FT                   4494818..4494871,4494968..4495027,4495678..4495746,
FT                   4495864..4495905,4498576..4498621,4501224..4501304,
FT                   4501777..4501826,4502263..4502355,4503019..4503163,
FT                   4506420..4506484,4509286..4509414,4509537..4509596,
FT                   4510321..4510380,4512993..4513178,4513347..4513462,
FT                   4514929..4516017)
FT                   /gene="Col15a1"
FT                   /locus_tag="mCG_4428"
FT                   /product="procollagen, type XV, transcript variant
FT                   mCT189494"
FT                   /note="gene_id=mCG4428.2 transcript_id=mCT189494.1 created
FT                   on 15-MAR-2004"
FT   CDS             join(4491883..4491900,4492007..4492042,4494818..4494871,
FT                   4494968..4495027,4495678..4495746,4495864..4495905,
FT                   4498576..4498621,4501224..4501304,4501777..4501826,
FT                   4502263..4502355,4503019..4503163,4506420..4506484,
FT                   4509286..4509414,4509537..4509596,4510321..4510380,
FT                   4512993..4513178,4513347..4513462,4514929..4515142)
FT                   /codon_start=1
FT                   /gene="Col15a1"
FT                   /locus_tag="mCG_4428"
FT                   /product="procollagen, type XV, isoform CRA_b"
FT                   /note="gene_id=mCG4428.2 transcript_id=mCT189494.1
FT                   protein_id=mCP110514.1 isoform=CRA_b"
FT                   /protein_id="EDL02355.1"
FT                   /translation="MMKGRKGEPGIHGAPGPMGPKGPPGHKGEFGLPGRPGRPGLNGLK
FT                   GAKGDRGVTLPGPPGLPGPPGPPGPPGAVVNIKGAVFPIPARPHCKTPVGTAHPGDPEL
FT                   VTFHGVKGEKGSWGLPGSKGEKGDQGAQGPPGPPVDPAYLRHFLNSLKGENEDASFRGE
FT                   SSNNLFVSGPPGLPGYPGLVGQKGEAVVGPQGPPGIPGLPGPPGFGRPGVPGPPGPPGP
FT                   PGPPAILGAAVALPGPPGPPGQPGLPGSRNLVTALSDMGDMLQKAHLVIEGTFIYLRDS
FT                   GEFFIRVRDGWKKLQLGELIPIPADSPPPPALSSNPYQPQPPLNPILSANYERPVLHLV
FT                   ALNTPVAGDIRADFQCFQQARAAGLLSTFRAFLSSHLQDLSTVVRKAERFGLPIVNLKG
FT                   QVLFNNWDSIFSGDGGQFNTHIPIYSFDGRDVMTDPSWPQKVVWHGSNPHGVRLVDKYC
FT                   EAWRTTDMAVTGFASPLSTGKILDQKAYSCANRLIVLCIENSFMTDTRK"
FT   assembly_gap    4499537..4499629
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    4508510..4508646
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    4514395..4514414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4522849..4522868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4524810..4524921
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    4534993..4535116
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    4543149..4543168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4546341..4546773
FT                   /estimated_length=433
FT                   /gap_type="unknown"
FT   gene            <4556072..4617680
FT                   /gene="Tgfbr1"
FT                   /locus_tag="mCG_7380"
FT                   /note="gene_id=mCG7380.2"
FT   mRNA            join(<4556072..4556156,4586518..4586763,4596018..4596260,
FT                   4599126..4599356,4605554..4605721,4606121..4606277,
FT                   4608280..4608404,4609673..4609803,4613403..4617680)
FT                   /gene="Tgfbr1"
FT                   /locus_tag="mCG_7380"
FT                   /product="transforming growth factor, beta receptor I"
FT                   /note="gene_id=mCG7380.2 transcript_id=mCT6226.2 created on
FT                   10-JUL-2002"
FT   CDS             join(4556072..4556156,4586518..4586763,4596018..4596260,
FT                   4599126..4599356,4605554..4605721,4606121..4606277,
FT                   4608280..4608404,4609673..4609803,4613403..4613528)
FT                   /codon_start=1
FT                   /gene="Tgfbr1"
FT                   /locus_tag="mCG_7380"
FT                   /product="transforming growth factor, beta receptor I"
FT                   /note="gene_id=mCG7380.2 transcript_id=mCT6226.2
FT                   protein_id=mCP5773.1"
FT                   /db_xref="GOA:Q4FJL1"
FT                   /db_xref="InterPro:IPR000333"
FT                   /db_xref="InterPro:IPR000472"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003605"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:98728"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJL1"
FT                   /protein_id="EDL02353.1"
FT                   /translation="MEAAAAAPRRPQLLIVLVAAATLLPGAKALQCFCHLCTKDNFTCE
FT                   TDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNK
FT                   IELPTTGPFSEKQSAGLGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEED
FT                   PSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRG
FT                   KWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSD
FT                   YHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNIL
FT                   VKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRA
FT                   DIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRW
FT                   QSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM"
FT   assembly_gap    4556237..4556333
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    4623536..4623863
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    4625301..4625767
FT                   /estimated_length=467
FT                   /gap_type="unknown"
FT   assembly_gap    4627046..4627342
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    4635110..4635146
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    4635904..4636254
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   gene            4656511..4658291
FT                   /locus_tag="mCG_7375"
FT                   /note="gene_id=mCG7375.1"
FT   mRNA            4656511..4658291
FT                   /locus_tag="mCG_7375"
FT                   /product="mCG7375"
FT                   /note="gene_id=mCG7375.1 transcript_id=mCT6230.1 created on
FT                   10-JUL-2002"
FT   CDS             4656523..4657665
FT                   /codon_start=1
FT                   /locus_tag="mCG_7375"
FT                   /product="mCG7375"
FT                   /note="gene_id=mCG7375.1 transcript_id=mCT6230.1
FT                   protein_id=mCP5806.2"
FT                   /protein_id="EDL02352.1"
FT                   /translation="MSVLSALTKQPPIQSTAGAVPVPVRKEKGEISMEKVKVKRYVSGK
FT                   RPDYAPMESSDEEDEEFQFIKKAKGQEAEPEEQEEDSSSDPRLRRLQNRISEDVEERLT
FT                   RHRKIVEPEVVGESDSEVEGDAWRLEREDSSKEEEEEIDDEEIERRRGMMRQRAQERKN
FT                   EEMEVMEVEDEGRSGEESESESEYEEYTDSEDEMEPRLKPVFIRKKDPVTVQEREAEAL
FT                   KEKELEQEAKCMAEERCKYTLKIVEEETKKELEENMRSLAALDALNTDDENDEEYEVWK
FT                   VRELKRIKREREDREALEKEKAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQ
FT                   KYCHRGAFFMDEDEEVYKRDFSAPLLRTISIKPFFLKSCR"
FT   gene            complement(4672771..>4677220)
FT                   /gene="Alg2"
FT                   /locus_tag="mCG_7379"
FT                   /note="gene_id=mCG7379.2"
FT   mRNA            complement(join(4672771..4673652,4674414..4675356,
FT                   4676824..>4677220))
FT                   /gene="Alg2"
FT                   /locus_tag="mCG_7379"
FT                   /product="asparagine-linked glycosylation 2 homolog (yeast,
FT                   alpha-1,3-mannosyltransferase), transcript variant mCT6229"
FT                   /note="gene_id=mCG7379.2 transcript_id=mCT6229.2 created on
FT                   10-JUL-2002"
FT   mRNA            complement(join(4672772..4675356,4676824..4677220))
FT                   /gene="Alg2"
FT                   /locus_tag="mCG_7379"
FT                   /product="asparagine-linked glycosylation 2 homolog (yeast,
FT                   alpha-1,3-mannosyltransferase), transcript variant
FT                   mCT170619"
FT                   /note="gene_id=mCG7379.2 transcript_id=mCT170619.0 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(4674457..4675356,4676824..>4677036))
FT                   /codon_start=1
FT                   /gene="Alg2"
FT                   /locus_tag="mCG_7379"
FT                   /product="asparagine-linked glycosylation 2 homolog (yeast,
FT                   alpha-1,3-mannosyltransferase), isoform CRA_b"
FT                   /note="gene_id=mCG7379.2 transcript_id=mCT6229.2
FT                   protein_id=mCP5772.1 isoform=CRA_b"
FT                   /protein_id="EDL02351.1"
FT                   /translation="CEDMDRALRPEPLLHRDPRALGAMRRGLAASQPGLGRPRRRHLLL
FT                   RAHGLSGALRAVSLRRGVRRGLVCDQVSACIPVFKLARRRKRVLFYCHFPDLLLTQRNS
FT                   ALKKFYRAPIDWIEEYTTGMADRILVNSQYTASVFKETFKTLSHRNPDVLYPSLNIGSF
FT                   DLAIPEKIDDLVPKGKQFLFLSINRYERKKNLPLALRSLVQLRNRLPSQEWDKVHLFMA
FT                   GGYDDRIPENVEHYKELKKMVQESDLERHVTFLRSFSDRQKISLLHGCLCVLYTPSNEH
FT                   FGIVPLEAMYMQCPVIAVNNGGPLESIVHKVTGFLCEPDPVHFSEAMEKFIHKPSLKAT
FT                   MGLAGKARVAEKFSADAFADQLYQYVTKLV"
FT   CDS             complement(join(4674457..4675356,4676824..4677027))
FT                   /codon_start=1
FT                   /gene="Alg2"
FT                   /locus_tag="mCG_7379"
FT                   /product="asparagine-linked glycosylation 2 homolog (yeast,
FT                   alpha-1,3-mannosyltransferase), isoform CRA_a"
FT                   /note="gene_id=mCG7379.2 transcript_id=mCT170619.0
FT                   protein_id=mCP93537.0 isoform=CRA_a"
FT                   /protein_id="EDL02350.1"
FT                   /translation="MDRALRPEPLLHRDPRALGAMRRGLAASQPGLGRPRRRHLLLRAH
FT                   GLSGALRAVSLRRGVRRGLVCDQVSACIPVFKLARRRKRVLFYCHFPDLLLTQRNSALK
FT                   KFYRAPIDWIEEYTTGMADRILVNSQYTASVFKETFKTLSHRNPDVLYPSLNIGSFDLA
FT                   IPEKIDDLVPKGKQFLFLSINRYERKKNLPLALRSLVQLRNRLPSQEWDKVHLFMAGGY
FT                   DDRIPENVEHYKELKKMVQESDLERHVTFLRSFSDRQKISLLHGCLCVLYTPSNEHFGI
FT                   VPLEAMYMQCPVIAVNNGGPLESIVHKVTGFLCEPDPVHFSEAMEKFIHKPSLKATMGL
FT                   AGKARVAEKFSADAFADQLYQYVTKLV"
FT   assembly_gap    4676771..4676790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4677547..4686120
FT                   /locus_tag="mCG_7378"
FT                   /note="gene_id=mCG7378.0"
FT   mRNA            join(4677547..4677640,4677799..4677896,4683018..4683119,
FT                   4685862..4686120)
FT                   /locus_tag="mCG_7378"
FT                   /product="mCG7378"
FT                   /note="gene_id=mCG7378.0 transcript_id=mCT6236.0 created on
FT                   19-JUN-2003"
FT   CDS             join(4677638..4677640,4677799..4677896,4683018..4683119,
FT                   4685862..4685949)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7378"
FT                   /product="mCG7378"
FT                   /note="gene_id=mCG7378.0 transcript_id=mCT6236.0
FT                   protein_id=mCP5824.1"
FT                   /protein_id="EDL02349.1"
FT                   /translation="MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAG
FT                   RTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIAAVFMLHIWGKYTRS"
FT   assembly_gap    4719977..4720176
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    4774661..4774814
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    4804448..4804602
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    4806450..4806469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4815918..4816295
FT                   /estimated_length=378
FT                   /gap_type="unknown"
FT   assembly_gap    4817477..4818025
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   assembly_gap    4864195..4864214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4876563..4876799
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    4888011..4888251
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    4893212..4893231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4895679..4895698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4913825..4913934
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    4953571..4956016
FT                   /estimated_length=2446
FT                   /gap_type="unknown"
FT   assembly_gap    4983017..4983036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4990894..4991102
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    5008286..5008305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5063747..5063871
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    5064820..5064859
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    5087657..5087676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5113085..5113104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5139716..5139735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5169362..5169442
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    5170971..5171074
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    5171842..5172310
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   assembly_gap    5176899..5177625
FT                   /estimated_length=727
FT                   /gap_type="unknown"
FT   assembly_gap    5194768..5194965
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    5208108..5208127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5238432..5238586
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    5242511..5242574
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   gene            <5247494..5252476
FT                   /locus_tag="mCG_144948"
FT                   /note="gene_id=mCG144948.0"
FT   mRNA            join(<5247494..5247979,5251269..5251445,5252251..5252476)
FT                   /locus_tag="mCG_144948"
FT                   /product="mCG144948"
FT                   /note="gene_id=mCG144948.0 transcript_id=mCT184372.0
FT                   created on 05-JUN-2003"
FT   CDS             <5247494..5247955
FT                   /codon_start=1
FT                   /locus_tag="mCG_144948"
FT                   /product="mCG144948"
FT                   /note="gene_id=mCG144948.0 transcript_id=mCT184372.0
FT                   protein_id=mCP105211.0"
FT                   /protein_id="EDL02348.1"
FT                   /translation="SACSSSAPHTQTRSHPLLHLHTQTDTRALTRSAHTLHSLPRAHTP
FT                   LTRLPRQCRAAPRRSRTPLQGSLCNADRARSVRGGGKRGDILPPGRSRRLDACGTSRRR
FT                   SPMSWDRSIPRQPLTASGSRWVCAPQPFRDSSCDSPPIQISGSLSRNSL"
FT   assembly_gap    5249669..5249688
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5253565..>5285718
FT                   /gene="Nr4a3"
FT                   /locus_tag="mCG_7377"
FT                   /note="gene_id=mCG7377.1"
FT   mRNA            join(<5253565..5254518,5258247..5258376,5258851..5259023,
FT                   5270020..5270219,5273351..5273529,5285471..>5285718)
FT                   /gene="Nr4a3"
FT                   /locus_tag="mCG_7377"
FT                   /product="nuclear receptor subfamily 4, group A, member 3"
FT                   /note="gene_id=mCG7377.1 transcript_id=mCT6228.0 created on
FT                   10-JUL-2002"
FT   CDS             join(5253565..5254518,5258247..5258376,5258851..5259023,
FT                   5270020..5270219,5273351..5273529,5285471..5285718)
FT                   /codon_start=1
FT                   /gene="Nr4a3"
FT                   /locus_tag="mCG_7377"
FT                   /product="nuclear receptor subfamily 4, group A, member 3"
FT                   /note="gene_id=mCG7377.1 transcript_id=mCT6228.0
FT                   protein_id=mCP5817.0"
FT                   /protein_id="EDL02347.1"
FT                   /translation="MPCVQAQYSPSPPGSTYATQTYGSEYTTEIMNPDYTKLTMDLGST
FT                   GIMATATTSLPSFSTFMEGYPSSCELKPSCLYQMPPSGPRPLIKMEEGREHGYHHHHHH
FT                   HHHHHHHQQQQPSIPPPSGPEDEVLPSTSMYFKQSPPSTPTTPGFPPQAGALWDDELPS
FT                   APGCIAPGPLLDPQMKAVPPMAAAARFPIFFKPSPPHPPAPSPAGGHHLGYDPTAAAAL
FT                   SLPLGAAAAAGSQAAALEGHPYGLPLAKRTATLTFPPLGLTASPTASSLLGESPSLPSP
FT                   PNRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKR
FT                   RRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICM
FT                   MNALVRALTDATPRDLDYSRYCPTDQATAGTDAEHVQQFYNLLTASIDVSRSWAEKIPG
FT                   FTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDS
FT                   IKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCTKITSSLKDHQRKGQA
FT                   LEPSEPKVLRALVELRKICTQGLQRIFYLKLEDLVPPPSVIDKLFLDTLPF"
FT   gene            5287653..5288814
FT                   /locus_tag="mCG_1041293"
FT                   /note="gene_id=mCG1041293.1"
FT   mRNA            5287653..5288814
FT                   /locus_tag="mCG_1041293"
FT                   /product="mCG1041293"
FT                   /note="gene_id=mCG1041293.1 transcript_id=mCT158997.1
FT                   created on 10-JUL-2002"
FT   CDS             5288299..5288460
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041293"
FT                   /product="mCG1041293"
FT                   /note="gene_id=mCG1041293.1 transcript_id=mCT158997.1
FT                   protein_id=mCP53574.1"
FT                   /protein_id="EDL02346.1"
FT                   /translation="MLFPLLSSHPQIEGKELSKHLSAGLKNDEAVLVKGQTLVLKEKTI
FT                   QPVFFCLP"
FT   assembly_gap    5300568..5300680
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   gene            <5326981..5387996
FT                   /gene="Stx17"
FT                   /locus_tag="mCG_7374"
FT                   /note="gene_id=mCG7374.2"
FT   mRNA            join(<5326981..5327158,5327208..5327639)
FT                   /gene="Stx17"
FT                   /locus_tag="mCG_7374"
FT                   /product="syntaxin 17, transcript variant mCT119618"
FT                   /note="gene_id=mCG7374.2 transcript_id=mCT119618.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(5326998..5327043,5333851..5334035,5360887..5361109,
FT                   5369022..5369137,5369300..5369350,5382755..5382841,
FT                   5383584..5383620,5384143..5384178,5384925..5385022,
FT                   5385500..5385561,5387165..5387996)
FT                   /gene="Stx17"
FT                   /locus_tag="mCG_7374"
FT                   /product="syntaxin 17, transcript variant mCT170380"
FT                   /note="gene_id=mCG7374.2 transcript_id=mCT170380.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(<5327009..5327043,5333851..5334035,5342496..5342561,
FT                   5360887..5361109,5369022..5369137,5369300..5369350,
FT                   5382755..5382841,5383584..>5383811)
FT                   /gene="Stx17"
FT                   /locus_tag="mCG_7374"
FT                   /product="syntaxin 17, transcript variant mCT189501"
FT                   /note="gene_id=mCG7374.2 transcript_id=mCT189501.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5327048..5327158,5327208..5327543)
FT                   /codon_start=1
FT                   /gene="Stx17"
FT                   /locus_tag="mCG_7374"
FT                   /product="syntaxin 17, isoform CRA_a"
FT                   /note="gene_id=mCG7374.2 transcript_id=mCT119618.0
FT                   protein_id=mCP53416.0 isoform=CRA_a"
FT                   /protein_id="EDL02343.1"
FT                   /translation="GAAGLPPRGRWAAMCHRGPGCGRKGEAPVTKPGLGVSFWSSCPCG
FT                   SGEAEAPLRYALPGRCEELLRALGRRASRAAGVVGVAWVRPGDSVRDDATPVPKQDAER
FT                   PQLRGPSQHLLSLYHPHAQGDAFPWEIVLSAVWDLFPGKGLFRF"
FT   CDS             join(<5333865..5334035,5342496..5342561,5360887..5361109,
FT                   5369022..5369137,5369300..5369350,5382755..5382841,
FT                   5383584..>5383811)
FT                   /codon_start=1
FT                   /gene="Stx17"
FT                   /locus_tag="mCG_7374"
FT                   /product="syntaxin 17, isoform CRA_c"
FT                   /note="gene_id=mCG7374.2 transcript_id=mCT189501.0
FT                   protein_id=mCP110516.0 isoform=CRA_c"
FT                   /protein_id="EDL02345.1"
FT                   /translation="EKRAAARGSSGSSGFRMSEDEEKVKLRRLEPAIQKFTKIVIPTDL
FT                   ERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREMEKLCLKVHKDDLVLLK
FT                   RMIDPVKEAAATATAEFLQLHLESVEELKKQVNDEELLQPSLTRSTTVDGVLHTGEAEA
FT                   ASQSLTQIYALPEIPQDQNAAESWETLEADLIELSHLVTDMSLLVSSQQEKIDSIADHV
FT                   NSAAVNVEEGTKNLQKAAKYKLAALPVAGALIGGVVGGPIGLLAGFKVAGIAAALGGGV
FT                   LGFTGGKLIQRRKQKMMEKLTSSCPDLPSQSDK"
FT   CDS             join(5333913..5334035,5360887..5361109,5369022..5369137,
FT                   5369300..5369350,5382755..5382841,5383584..5383620,
FT                   5384143..5384178,5384925..5385022,5385500..5385559)
FT                   /codon_start=1
FT                   /gene="Stx17"
FT                   /locus_tag="mCG_7374"
FT                   /product="syntaxin 17, isoform CRA_b"
FT                   /note="gene_id=mCG7374.2 transcript_id=mCT170380.0
FT                   protein_id=mCP93298.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D614"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR028676"
FT                   /db_xref="MGI:MGI:1914977"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D614"
FT                   /protein_id="EDL02344.1"
FT                   /translation="MSEDEEKVKLRRLEPAIQKFTKIVIPTDLERLRKHQINIEKQLRS
FT                   NIREMEKLCLKVHKDDLVLLKRMIDPVKEAAATATAEFLQLHLESVEELKKQVNDEELL
FT                   QPSLTRSTTVDGVLHTGEAEAASQSLTQIYALPEIPQDQNAAESWETLEADLIELSHLV
FT                   TDMSLLVSSQQEKIDSIADHVNSAAVNVEEGTKNLQKAAKYKLAALPVAGRNRIRVQES
FT                   LSERFEIQKKGIGRSHWSRNSHLFLRRVHQQPEHRTRLALNSEIHLSLPPECWD"
FT   assembly_gap    5339686..5339705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5371267..5371286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5393248..5394213
FT                   /locus_tag="mCG_1041380"
FT                   /note="gene_id=mCG1041380.0"
FT   mRNA            join(<5393248..5393602,5393897..5394213)
FT                   /locus_tag="mCG_1041380"
FT                   /product="mCG1041380"
FT                   /note="gene_id=mCG1041380.0 transcript_id=mCT159084.1
FT                   created on 28-JUN-2002"
FT   CDS             5393248..5393505
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041380"
FT                   /product="mCG1041380"
FT                   /note="gene_id=mCG1041380.0 transcript_id=mCT159084.1
FT                   protein_id=mCP53389.0"
FT                   /protein_id="EDL02342.1"
FT                   /translation="MSFYFWLSRQCRRKNSELLWFSRFINPFPIPFPWCIFLKEAKSAL
FT                   SLESILSIPISNTVFLFFFNVHLVFGLHVYLCKGIRSTGT"
FT   gene            complement(5395412..>5481541)
FT                   /gene="Txndc4"
FT                   /locus_tag="mCG_7376"
FT                   /note="gene_id=mCG7376.1"
FT   mRNA            complement(join(5395412..5396794,5398888..5398990,
FT                   5406228..5406369,5407202..5407313,5410763..5410897,
FT                   5413734..5413791,5420083..5420198,5421345..5421529,
FT                   5438875..5438990,5443298..5443337,5445478..5445550,
FT                   5481326..>5481541))
FT                   /gene="Txndc4"
FT                   /locus_tag="mCG_7376"
FT                   /product="thioredoxin domain containing 4 (endoplasmic
FT                   reticulum)"
FT                   /note="gene_id=mCG7376.1 transcript_id=mCT6227.2 created on
FT                   28-JUN-2002"
FT   CDS             complement(join(5396693..5396794,5398888..5398990,
FT                   5406228..5406369,5407202..5407313,5410763..5410897,
FT                   5413734..5413791,5420083..5420198,5421345..5421529,
FT                   5438875..5438990,5443298..5443337,5445478..5445550,
FT                   5481326..>5481538))
FT                   /codon_start=1
FT                   /gene="Txndc4"
FT                   /locus_tag="mCG_7376"
FT                   /product="thioredoxin domain containing 4 (endoplasmic
FT                   reticulum)"
FT                   /note="gene_id=mCG7376.1 transcript_id=mCT6227.2
FT                   protein_id=mCP5815.2"
FT                   /protein_id="EDL02341.1"
FT                   /translation="EASLEVVPGVRRWSSGSRGRGAAAAGPGAQPFSSPVQSQPPPPDP
FT                   AVDPVVTMNPAVFLSLADLRCSLLLLVTSIFTPITAEIASLDSENIDEILNNADVALVN
FT                   FYADWCRFSQMLHPIFEEASDVIKEEYPDKNQVVFARVDCDQHSDIAQRYRISKYPTLK
FT                   LFRNGMMMKREYRGQRSVKALADYIRQQKSNPVHEIQSLDEVTNLDRSKRNIIGYFEQK
FT                   DSENYRVFERVASILHDDCAFLSAFGDLSKPERYNGDNVIYKPPGRSAPDMVYLGSMTN
FT                   FDVTYNWIQDKCVPLVREITFENGEVWASPRELTEEGLPFLILFHMKDDTESLEIFQNE
FT                   VARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIP
FT                   GKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQDQDVASSPPESSFQKLAPSEYRYTLL
FT                   RDRDEL"
FT   assembly_gap    5415202..5415221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5449436..5449455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5476763..5476782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5481760..5635649
FT                   /gene="Invs"
FT                   /locus_tag="mCG_7381"
FT                   /note="gene_id=mCG7381.2"
FT   mRNA            join(5481760..5481917,5485168..5485297,5509521..5509687,
FT                   5583902..5584075,5586894..5587061,5591738..5591918,
FT                   5594363..5594472,5598014..5598185,5599284..5599439,
FT                   5599829..5600058,5605020..5605126,5609523..5609735,
FT                   5619638..5619930,5625139..5625841,5629691..5629920,
FT                   5630729..5630803,5633300..5633900,5633915..5635179,
FT                   5635196..5635644)
FT                   /gene="Invs"
FT                   /locus_tag="mCG_7381"
FT                   /product="inversin, transcript variant mCT6221"
FT                   /note="gene_id=mCG7381.2 transcript_id=mCT6221.1 created on
FT                   28-JUN-2002"
FT   mRNA            join(<5481761..5481917,5485168..5485297,5509521..5509687,
FT                   5583902..5584075,5586894..5587061,5591738..5591918,
FT                   5594363..5594472,5598014..5598185,5599284..5599439,
FT                   5599829..5600058,5605020..5605126,5609523..5609735,
FT                   5619638..5619930,5625139..5625841,5629691..5629920,
FT                   5630729..5630803,5633300..5635649)
FT                   /gene="Invs"
FT                   /locus_tag="mCG_7381"
FT                   /product="inversin, transcript variant mCT189522"
FT                   /note="gene_id=mCG7381.2 transcript_id=mCT189522.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<5481767..5481917,5485168..5485297,5509521..5509687,
FT                   5583902..5584075,5591738..5591918,5594363..5594472,
FT                   5598014..5598185,5599284..5599439,5599829..5600058,
FT                   5609523..5609735,5619638..5619930,5625139..5625841,
FT                   5629691..5629920,5630729..5631046)
FT                   /gene="Invs"
FT                   /locus_tag="mCG_7381"
FT                   /product="inversin, transcript variant mCT189523"
FT                   /note="gene_id=mCG7381.2 transcript_id=mCT189523.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5481855..5481917,5485168..5485297,5509521..5509687,
FT                   5583902..5584075,5586894..5587061,5591738..5591918,
FT                   5594363..5594472,5598014..5598185,5599284..5599439,
FT                   5599829..5600058,5605020..5605126,5609523..5609735,
FT                   5619638..5619930,5625139..5625841,5629691..5629920,
FT                   5630729..5630803,5633300..5633403)
FT                   /codon_start=1
FT                   /gene="Invs"
FT                   /locus_tag="mCG_7381"
FT                   /product="inversin, isoform CRA_a"
FT                   /note="gene_id=mCG7381.2 transcript_id=mCT189522.0
FT                   protein_id=mCP110517.0 isoform=CRA_a"
FT                   /protein_id="EDL02337.1"
FT                   /translation="GRPREGCASWGGPGTPFLESGVTRIVEKTMNISEDVLSTGSSLAS
FT                   QVHAAAVNGDKGALQRLIVGNSALRDKEDRFGRTPLMYCVLADRVDCADALLKAGADVN
FT                   KTDHSRRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEMTPLHLSTRHRSPKCLALLL
FT                   KFMAPGEVDTQDKNKQTALHWSAYYNNPEHAKLLIKHDSNIGIPDVEGKIPLHWAANHK
FT                   DPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNLTVVDVLTSYESCNITSYD
FT                   NLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAAQSNFAETVKVFLQH
FT                   PSVKDDSDLEGRTSFMWAAGKGNDDVLRTMLSLKSDIDINMSDKYGGTALHAAALSGHV
FT                   STVKLLLDNDAQVDATDVMKHTPLFRACEMGHRDVIQTLIKGGARVDLVDQDGHSLLHW
FT                   AALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLMENNADPNIQDKE
FT                   GRTALHWSCNNGYLDAIKLLLDFAAFPNQMENNEERYTPLDYALLGERHEVIQFMLEHG
FT                   ALSIAAIQDIAAFKIQAVYKGYKVRKAFRDRKNLLMKHEQLRKDAAAKKREEENKRKEA
FT                   EQQKGQLDTDPPRSHCSSSAPVLPCPPSPQNEASKQDATPSKQPPASHTVQSPDPEHSR
FT                   PPGRCPGRASQGDSSIDLQGTASRKPSETPIEHCRGPSACVHPRSWEGGNSSKNQGTSS
FT                   VEKRRGETNGKHRRCEEGPSSARQPLCTGSGRPAEKGEDSSPAVASASQQDHPRKPNKR
FT                   QDRAARPRGASQKRRTHQLRDRCSPAGSSRPGSAKGEVACADQSSLHRHTPRSKVTQDK
FT                   LIGGVSSGLPLSTEASRSGCKQLYEDICASPETGVAHGPPPGQCMNIHLLPVEQRLLII
FT                   QRERSRKELFRRKNKAAAVIQRAWRSYQLRKHLSRLLHLKQLGAREVLRCTQVCTALLL
FT                   QVWRKELELKFPKSISVSRTSKSPSKGSSATKYARHSVLRQIYGCSQEGKGHHPIKSSK
FT                   APAVLHLSSVNSLQSIHLDNSGRSKKFSYNLQPSSQSKNKPKL"
FT   CDS             join(5485192..5485297,5509521..5509687,5583902..5584075,
FT                   5586894..5587061,5591738..5591918,5594363..5594472,
FT                   5598014..5598185,5599284..5599439,5599829..5600058,
FT                   5605020..5605126,5609523..5609735,5619638..5619930,
FT                   5625139..5625841,5629691..5629920,5630729..5630803,
FT                   5633300..5633403)
FT                   /codon_start=1
FT                   /gene="Invs"
FT                   /locus_tag="mCG_7381"
FT                   /product="inversin, isoform CRA_c"
FT                   /note="gene_id=mCG7381.2 transcript_id=mCT6221.1
FT                   protein_id=mCP5784.2 isoform=CRA_c"
FT                   /db_xref="GOA:A2AM57"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1335082"
FT                   /db_xref="UniProtKB/TrEMBL:A2AM57"
FT                   /protein_id="EDL02339.1"
FT                   /translation="MNISEDVLSTGSSLASQVHAAAVNGDKGALQRLIVGNSALRDKED
FT                   RFGRTPLMYCVLADRVDCADALLKAGADVNKTDHSRRTALHLAAQKGNYRFMKLLLTRR
FT                   ANWMQKDLEEMTPLHLSTRHRSPKCLALLLKFMAPGEVDTQDKNKQTALHWSAYYNNPE
FT                   HAKLLIKHDSNIGIPDVEGKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGR
FT                   TPLHFAVADGNLTVVDVLTSYESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSG
FT                   TIPSDSQGATPLHYAAQSNFAETVKVFLQHPSVKDDSDLEGRTSFMWAAGKGNDDVLRT
FT                   MLSLKSDIDINMSDKYGGTALHAAALSGHVSTVKLLLDNDAQVDATDVMKHTPLFRACE
FT                   MGHRDVIQTLIKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRT
FT                   PLQCAAYGGYINCMAVLMENNADPNIQDKEGRTALHWSCNNGYLDAIKLLLDFAAFPNQ
FT                   MENNEERYTPLDYALLGERHEVIQFMLEHGALSIAAIQDIAAFKIQAVYKGYKVRKAFR
FT                   DRKNLLMKHEQLRKDAAAKKREEENKRKEAEQQKGQLDTDPPRSHCSSSAPVLPCPPSP
FT                   QNEASKQDATPSKQPPASHTVQSPDPEHSRPPGRCPGRASQGDSSIDLQGTASRKPSET
FT                   PIEHCRGPSACVHPRSWEGGNSSKNQGTSSVEKRRGETNGKHRRCEEGPSSARQPLCTG
FT                   SGRPAEKGEDSSPAVASASQQDHPRKPNKRQDRAARPRGASQKRRTHQLRDRCSPAGSS
FT                   RPGSAKGEVACADQSSLHRHTPRSKVTQDKLIGGVSSGLPLSTEASRSGCKQLYEDICA
FT                   SPETGVAHGPPPGQCMNIHLLPVEQRLLIIQRERSRKELFRRKNKAAAVIQRAWRSYQL
FT                   RKHLSRLLHLKQLGAREVLRCTQVCTALLLQVWRKELELKFPKSISVSRTSKSPSKGSS
FT                   ATKYARHSVLRQIYGCSQEGKGHHPIKSSKAPAVLHLSSVNSLQSIHLDNSGRSKKFSY
FT                   NLQPSSQSKNKPKL"
FT   assembly_gap    5502410..5502792
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    5503845..5503864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5545396..5547085)
FT                   /locus_tag="mCG_50680"
FT                   /note="gene_id=mCG50680.2"
FT   mRNA            complement(5545396..5547085)
FT                   /locus_tag="mCG_50680"
FT                   /product="mCG50680"
FT                   /note="gene_id=mCG50680.2 transcript_id=mCT50863.2 created
FT                   on 28-JUN-2002"
FT   CDS             complement(5546010..5547026)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50680"
FT                   /product="mCG50680"
FT                   /note="gene_id=mCG50680.2 transcript_id=mCT50863.2
FT                   protein_id=mCP28401.1"
FT                   /protein_id="EDL02340.1"
FT                   /translation="MGHRYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPFGC
FT                   TKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYI
FT                   EVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYIGIVKQAGLDRMRSGAYSAGY
FT                   GGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMRGLSYK
FT                   ATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRANMQHRYIE
FT                   LFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD"
FT   assembly_gap    5553283..5553620
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   CDS             join(<5599925..5600058,5609523..5609735,5619638..5619930,
FT                   5625139..5625841,5629691..5629920,5630729..5630871)
FT                   /codon_start=1
FT                   /gene="Invs"
FT                   /locus_tag="mCG_7381"
FT                   /product="inversin, isoform CRA_b"
FT                   /note="gene_id=mCG7381.2 transcript_id=mCT189523.0
FT                   protein_id=mCP110518.0 isoform=CRA_b"
FT                   /protein_id="EDL02338.1"
FT                   /translation="KIRSTQTCRIMQEEHRFSVLRTEGTSTVWLCSWRIMQTPTSKTKR
FT                   YTPLDYALLGERHEVIQFMLEHGALSIAAIQDIAAFKIQAVYKGYKVRKAFRDRKNLLM
FT                   KHEQLRKDAAAKKREEENKRKEAEQQKGQLDTDPPRSHCSSSAPVLPCPPSPQNEASKQ
FT                   DATPSKQPPASHTVQSPDPEHSRPPGRCPGRASQGDSSIDLQGTASRKPSETPIEHCRG
FT                   PSACVHPRSWEGGNSSKNQGTSSVEKRRGETNGKHRRCEEGPSSARQPLCTGSGRPAEK
FT                   GEDSSPAVASASQQDHPRKPNKRQDRAARPRGASQKRRTHQLRDRCSPAGSSRPGSAKG
FT                   EVACADQSSLHRHTPRSKVTQDKLIGGVSSGLPLSTEASRSGCKQLYEDICASPETGVA
FT                   HGPPPGQCMNIHLLPVEQRLLIIQRERSRKELFRRKNKAAAVIQRAWRSYQLRKHLSRL
FT                   LHLKQLGAREVLRCTQVCTALLLQVWRKELELKFPKSISVSRTSKSPSKGSSATKYARH
FT                   SVLRQIYGCSQEGKGHHPIKSSKAPAVLHLSSGKEATTVESRWGQHGMNFPMIL"
FT   assembly_gap    5600657..5601295
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   assembly_gap    5612917..5612936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5634096..5677160)
FT                   /locus_tag="mCG_2303"
FT                   /note="gene_id=mCG2303.2"
FT   mRNA            complement(join(5634096..5634778,5636803..5637013,
FT                   5638597..5638778,5640132..5640212,5655715..5655848,
FT                   5656682..5656770,5660523..5660700,5662327..5662502,
FT                   5663040..5663175,5663654..5663892,5666559..5666671,
FT                   5671454..5671694,5672071..5672783,5673674..5673862,
FT                   5677050..5677160))
FT                   /locus_tag="mCG_2303"
FT                   /product="mCG2303, transcript variant mCT1478"
FT                   /note="gene_id=mCG2303.2 transcript_id=mCT1478.2 created on
FT                   28-JUN-2002"
FT   mRNA            complement(join(5634555..5634778,5636803..5637013,
FT                   5638597..5638778,5640132..5640212,5655715..5655848,
FT                   5656682..5656770,5660523..5660700,5662327..5662502,
FT                   5663040..5663175,5663654..5663789,5666559..5666671,
FT                   5671454..5671694,5672071..>5672714))
FT                   /locus_tag="mCG_2303"
FT                   /product="mCG2303, transcript variant mCT189500"
FT                   /note="gene_id=mCG2303.2 transcript_id=mCT189500.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(5634665..5634778,5636803..5637013,
FT                   5638597..5638778,5640132..5640212,5655715..5655848,
FT                   5656682..5656770,5660523..5660700,5662327..5662502,
FT                   5663040..5663175,5663654..5663892,5666559..5666671,
FT                   5671454..5671694,5672071..5672783,5673674..5673853))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2303"
FT                   /product="mCG2303, isoform CRA_a"
FT                   /note="gene_id=mCG2303.2 transcript_id=mCT1478.2
FT                   protein_id=mCP5813.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3URQ0"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR024679"
FT                   /db_xref="MGI:MGI:1344413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3URQ0"
FT                   /protein_id="EDL02335.1"
FT                   /translation="MTKKRKRQDDFQKVKLKVGKKKPKLENATATNFKTKAIHLPEQLK
FT                   EDRTLPTNNRKLNIKDLLSQMHHYSGGVKQSALLGLKDLLSQYPFIIDAHLSNILSEVT
FT                   AVFTDRDANVRLAAVQLLQFLAPKIRTEHISPFFPLVSAHLSSAMTHITEGIQEDSLKV
FT                   LDILLEHYPALITGRSSILLKNFVELISHQQLSKGLVNRDRSQSWILSVNPNRRVTSQQ
FT                   WRLKVLARLSKFLQALADGSSRLRESEGLQEQKETPHATSNSIFINWKDHANDQQQIQV
FT                   YENGGSQPNVSSQFRLRCLGTLGTVDEDLSSPENLKGFIEIIIPLLIECWIEALPPQLA
FT                   ASVGSGVEREPLQVMQQVLNVISLLWKLSKQQDETHTLESWLRKNYLTDFKHHFMSHFP
FT                   YALKEITKQRKKDTNKSIKHCTVLSNNVDHLLLNLTLSDIMVSLANASTLQNDSSWIET
FT                   IRKFVTETLKGGTRLNSKQLNRLLGVSWRLIQMQPNRDATENLIKAVYTLYQQRGLLLP
FT                   VRTLLIKFFSKIYQKEELRSYRLRYRSKVLSRWLAGLPLQLSYLGSRNPELSTQLIDII
FT                   HTAASQANKDLLKNLQAAALRIYDPQEGAVVVLPAESQQRLVQLLYFLPTLPADLLSQL
FT                   SRCCIMGRLGSSLAVTLIGILYMRSSFSGWSHSVNDCLMTDVDYLSFLFSTLTGFSKEE
FT                   LTWLQNLRGVPHVVQTSLSPVLLYLTDLDQFLHHWDITEAVCHSLLVIPARSQSFDIMQ
FT                   SAISKHLVGLTVIPDSTAGCIFGVMCKLLDHTCVVNEALLPFLASCCYSLLYFLLTLEK
FT                   GDAEHLKKRDKLWEVCVSILALLPRVLRLMLQSLRVNRASPEELPVVGQLLRLLLQHVP
FT                   LRSHMLTNAILVQQIIKNITTLKSGSVQEQWLTDLHYCFSVYISGHPQGPSILNALY"
FT   CDS             complement(join(5634665..5634778,5636803..5637013,
FT                   5638597..5638778,5640132..5640212,5655715..5655848,
FT                   5656682..5656770,5660523..5660700,5662327..5662502,
FT                   5663040..5663175,5663654..5663789,5666559..>5666561))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2303"
FT                   /product="mCG2303, isoform CRA_b"
FT                   /note="gene_id=mCG2303.2 transcript_id=mCT189500.0
FT                   protein_id=mCP110504.0 isoform=CRA_b"
FT                   /protein_id="EDL02336.1"
FT                   /translation="KNDSSWIETIRKFVTETLKGGTRLNSKQLNRLLGVSWRLIQMQPN
FT                   RDATENLIKAVYTLYQQRGLLLPVRTLLIKFFSKIYQKEELRSYRLRYRSKVLSRWLAG
FT                   LPLQLSYLGSRNPELSTQLIDIIHTAASQANKDLLKNLQAAALRIYDPQEGAVVVLPAE
FT                   SQQRLVQLLYFLPTLPADLLSQLSRCCIMGRLGSSLAVTLIGILYMRSSFSGWSHSVND
FT                   CLMTDVDYLSFLFSTLTGFSKEELTWLQNLRGVPHVVQTSLSPVLLYLTDLDQFLHHWD
FT                   ITEAVCHSLLVIPARSQSFDIMQSAISKHLVGLTVIPDSTAGCIFGVMCKLLDHTCVVN
FT                   EALLPFLASCCYSLLYFLLTLEKGDAEHLKKRDKLWEVCVSILALLPRVLRLMLQSLRV
FT                   NRASPEELPVVGQLLRLLLQHVPLRSHMLTNAILVQQIIKNITTLKSGSVQEQWLTDLH
FT                   YCFSVYISGHPQGPSILNALY"
FT   assembly_gap    5726093..5726112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5732235..5732254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5741100..5741197
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   gene            5744780..5766602
FT                   /gene="5730528L13Rik"
FT                   /locus_tag="mCG_2304"
FT                   /note="gene_id=mCG2304.2"
FT   mRNA            join(5744780..5744844,5757061..5757511,5765527..5766602)
FT                   /gene="5730528L13Rik"
FT                   /locus_tag="mCG_2304"
FT                   /product="RIKEN cDNA 5730528L13, transcript variant
FT                   mCT1479"
FT                   /note="gene_id=mCG2304.2 transcript_id=mCT1479.2 created on
FT                   28-JUN-2002"
FT   mRNA            join(5744924..5745018,5757061..5757511,5765527..5766262)
FT                   /gene="5730528L13Rik"
FT                   /locus_tag="mCG_2304"
FT                   /product="RIKEN cDNA 5730528L13, transcript variant
FT                   mCT170379"
FT                   /note="gene_id=mCG2304.2 transcript_id=mCT170379.0 created
FT                   on 28-JUN-2002"
FT   assembly_gap    5745019..5745436
FT                   /estimated_length=418
FT                   /gap_type="unknown"
FT   assembly_gap    5753549..5753568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(5757094..5757511,5765527..5765936)
FT                   /codon_start=1
FT                   /gene="5730528L13Rik"
FT                   /locus_tag="mCG_2304"
FT                   /product="RIKEN cDNA 5730528L13, isoform CRA_a"
FT                   /note="gene_id=mCG2304.2 transcript_id=mCT1479.2
FT                   protein_id=mCP5820.2 isoform=CRA_a"
FT                   /protein_id="EDL02333.1"
FT                   /translation="MQNNEIIKPAKYFSELEKSILLALVEKYKYVLECKKSDARTIALK
FT                   QRTWQALAHEYNSQPSVSLRDFKQLKKCWENIKARTKKIMAHERREKVKRSGSPLLSSH
FT                   VLDKEKISSMLPEQLYFLQSPPEEEPEYHQDAAAQESFAVSNRELCEDEKEFGPFPVCE
FT                   GTSQPEPSCSAVRITANKNYRSKTPQEGALKKMHEEEHHQQMSILQLQLIQMNEVHVAK
FT                   IQQIERECEMAEEEHRIKMEVLNKKKMYWERKLQTFTKEWPVSSFNRPFPNSP"
FT   CDS             join(5757094..5757511,5765527..5765936)
FT                   /codon_start=1
FT                   /gene="5730528L13Rik"
FT                   /locus_tag="mCG_2304"
FT                   /product="RIKEN cDNA 5730528L13, isoform CRA_a"
FT                   /note="gene_id=mCG2304.2 transcript_id=mCT170379.0
FT                   protein_id=mCP93297.0 isoform=CRA_a"
FT                   /protein_id="EDL02334.1"
FT                   /translation="MQNNEIIKPAKYFSELEKSILLALVEKYKYVLECKKSDARTIALK
FT                   QRTWQALAHEYNSQPSVSLRDFKQLKKCWENIKARTKKIMAHERREKVKRSGSPLLSSH
FT                   VLDKEKISSMLPEQLYFLQSPPEEEPEYHQDAAAQESFAVSNRELCEDEKEFGPFPVCE
FT                   GTSQPEPSCSAVRITANKNYRSKTPQEGALKKMHEEEHHQQMSILQLQLIQMNEVHVAK
FT                   IQQIERECEMAEEEHRIKMEVLNKKKMYWERKLQTFTKEWPVSSFNRPFPNSP"
FT   gene            complement(5769999..>5770571)
FT                   /locus_tag="mCG_1041378"
FT                   /note="gene_id=mCG1041378.0"
FT   mRNA            complement(join(5769999..5770107,5770196..>5770571))
FT                   /locus_tag="mCG_1041378"
FT                   /product="mCG1041378"
FT                   /note="gene_id=mCG1041378.0 transcript_id=mCT159082.0
FT                   created on 28-JUN-2002"
FT   CDS             complement(join(5770093..5770107,5770196..>5770366))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041378"
FT                   /product="mCG1041378"
FT                   /note="gene_id=mCG1041378.0 transcript_id=mCT159082.0
FT                   protein_id=mCP53596.0"
FT                   /protein_id="EDL02332.1"
FT                   /translation="LLSPTNTKVDKGSYCSRELNQLICPEAAWGVEELPSENLQVEHPH
FT                   TFHLYHGRTKAIGREE"
FT   assembly_gap    5773037..5773056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5778041..5778259
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    5779583..5779602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5785145..5785164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5788213..5788577
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   gene            <5788578..5867097
FT                   /gene="Tmeff1"
FT                   /locus_tag="mCG_2306"
FT                   /note="gene_id=mCG2306.3"
FT   mRNA            join(<5788578..5788853,5808134..5808243,5814154..5814283,
FT                   5818698..5818724,5820976..5821072,5840762..5840910,
FT                   5842902..5842967,5854217..5854340,5862740..5862898,
FT                   5865968..5867097)
FT                   /gene="Tmeff1"
FT                   /locus_tag="mCG_2306"
FT                   /product="transmembrane protein with EGF-like and two
FT                   follistatin-like domains 1, transcript variant mCT189503"
FT                   /note="gene_id=mCG2306.3 transcript_id=mCT189503.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5788580..5788853,5808134..5808243,5814154..5814283,
FT                   5818698..5818724,5820976..5821072,5840762..5840910,
FT                   5842902..5842967,5854217..5854340,5862740..5862898,
FT                   5865968..5866052)
FT                   /codon_start=1
FT                   /gene="Tmeff1"
FT                   /locus_tag="mCG_2306"
FT                   /product="transmembrane protein with EGF-like and two
FT                   follistatin-like domains 1, isoform CRA_b"
FT                   /note="gene_id=mCG2306.3 transcript_id=mCT189503.0
FT                   protein_id=mCP110506.0 isoform=CRA_b"
FT                   /protein_id="EDL02330.1"
FT                   /translation="AGLPRAAARLLGGGAGPVCPACRSLSSPPCGRDSMGAQAPLRLPA
FT                   APPLAVCGYTSVLLLFAFCLPGSRASNQPAGGGGDCPGGRGKSNCSELNLRESDIRVCD
FT                   ESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNECFLRRAACKHQKDITV
FT                   VARGPCYSDNGSGSGEGEEEGSGAGAHRKHSKCGPCKYKAECDEDAENVGCVCNIDCSG
FT                   YSFNPVCASDGSSYNNPCFVREASCIKQEQIDIRHLGHCTDTDDVSLLGKKDDGLQYRP
FT                   DVKDAGDEREDVYIGSHMPCPENLNGYCIHGKCEFIYSTQKASCRCESGYTGQHCEKTD
FT                   FSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMCITRKCPKNNRGRRQKQNLGHFTS
FT                   DTSSRMV"
FT   mRNA            join(5788669..5788853,5808134..5808243,5814154..5814283,
FT                   5818698..5818724,5820973..5821072,5840762..5840910,
FT                   5842902..5842967,5854217..5854340,5862740..5862898,
FT                   5865968..5867095)
FT                   /gene="Tmeff1"
FT                   /locus_tag="mCG_2306"
FT                   /product="transmembrane protein with EGF-like and two
FT                   follistatin-like domains 1, transcript variant mCT1482"
FT                   /note="gene_id=mCG2306.3 transcript_id=mCT1482.2 created on
FT                   27-JUN-2002"
FT   CDS             join(5788682..5788853,5808134..5808243,5814154..5814283,
FT                   5818698..5818724,5820973..5821072,5840762..5840910,
FT                   5842902..5842967,5854217..5854340,5862740..5862898,
FT                   5865968..5866052)
FT                   /codon_start=1
FT                   /gene="Tmeff1"
FT                   /locus_tag="mCG_2306"
FT                   /product="transmembrane protein with EGF-like and two
FT                   follistatin-like domains 1, isoform CRA_c"
FT                   /note="gene_id=mCG2306.3 transcript_id=mCT1482.2
FT                   protein_id=mCP5781.2 isoform=CRA_c"
FT                   /protein_id="EDL02331.1"
FT                   /translation="MGAQAPLRLPAAPPLAVCGYTSVLLLFAFCLPGSRASNQPAGGGG
FT                   DCPGGRGKSNCSELNLRESDIRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCG
FT                   SNGDTYQNECFLRRAACKHQKDITVVARGPCYSDNGSGSGEGAEEEGSGAGAHRKHSKC
FT                   GPCKYKAECDEDAENVGCVCNIDCSGYSFNPVCASDGSSYNNPCFVREASCIKQEQIDI
FT                   RHLGHCTDTDDVSLLGKKDDGLQYRPDVKDAGDEREDVYIGSHMPCPENLNGYCIHGKC
FT                   EFIYSTQKASCRCESGYTGQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAI
FT                   VMCITRKCPKNNRGRRQKQNLGHFTSDTSSRMV"
FT   mRNA            join(<5788783..5788853,5808134..5808243,5814154..5814283,
FT                   5818698..5818724,5820973..5821072,5840762..5840910,
FT                   5842902..5842967,5854223..5854340,5862740..>5862878)
FT                   /gene="Tmeff1"
FT                   /locus_tag="mCG_2306"
FT                   /product="transmembrane protein with EGF-like and two
FT                   follistatin-like domains 1, transcript variant mCT189502"
FT                   /note="gene_id=mCG2306.3 transcript_id=mCT189502.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5788784..5788853,5808134..5808243,5814154..5814283,
FT                   5818698..5818724,5820973..5821072,5840762..5840910,
FT                   5842902..5842967,5854223..5854340,5862740..>5862878)
FT                   /codon_start=1
FT                   /gene="Tmeff1"
FT                   /locus_tag="mCG_2306"
FT                   /product="transmembrane protein with EGF-like and two
FT                   follistatin-like domains 1, isoform CRA_a"
FT                   /note="gene_id=mCG2306.3 transcript_id=mCT189502.0
FT                   protein_id=mCP110505.0 isoform=CRA_a"
FT                   /protein_id="EDL02329.1"
FT                   /translation="RASNQPAGGGGDCPGGRGKSNCSELNLRESDIRVCDESSCKYGGV
FT                   CKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNECFLRRAACKHQKDITVVARGPCYSD
FT                   NGSGSGEGAEEEGSGAGAHRKHSKCGPCKYKAECDEDAENVGCVCNIDCSGYSFNPVCA
FT                   SDGSSYNNPCFVREASCIKQEQIDIRHLGHCTDTDDVSLLGKKDDGLQYRPDVKGDERE
FT                   DVYIGSHMPCPENLNGYCIHGKCEFIYSTQKASCRCESGYTGQHCEKTDFSILYVVPSR
FT                   QKLTHVLIAAIIGAVQIAIIVA"
FT   assembly_gap    5791582..5791647
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    5805996..5806215
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    5813206..5813453
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    5835134..5835420
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    5861992..5862019
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            5867486..5877462
FT                   /gene="2310039E09Rik"
FT                   /locus_tag="mCG_2301"
FT                   /note="gene_id=mCG2301.2"
FT   mRNA            join(5867486..5867996,5875934..5877462)
FT                   /gene="2310039E09Rik"
FT                   /locus_tag="mCG_2301"
FT                   /product="RIKEN cDNA 2310039E09"
FT                   /note="gene_id=mCG2301.2 transcript_id=mCT1480.2 created on
FT                   27-JUN-2002"
FT   CDS             join(5867589..5867996,5875934..5876614)
FT                   /codon_start=1
FT                   /gene="2310039E09Rik"
FT                   /locus_tag="mCG_2301"
FT                   /product="RIKEN cDNA 2310039E09"
FT                   /note="gene_id=mCG2301.2 transcript_id=mCT1480.2
FT                   protein_id=mCP5798.1"
FT                   /db_xref="GOA:A2AMM0"
FT                   /db_xref="InterPro:IPR026752"
FT                   /db_xref="InterPro:IPR033299"
FT                   /db_xref="MGI:MGI:1915266"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2AMM0"
FT                   /protein_id="EDL02328.1"
FT                   /translation="MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVASVVD
FT                   SVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVK
FT                   ARVEKQQVRVTKVETKQEEIMKKNKFRVVIFQEDIPCPASLSVVKDRSLPENQEEAEEV
FT                   FDPPIELSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSRENMQKTRQTLDKKVSGIRT
FT                   RIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISSAAPSKEAFKIRSLRKAKDPKA
FT                   EGQEVDRGMGVDIISGSLALGPIHEFHSDEFSETEKEVTKGGYSPQEGGDPPTPEPLKV
FT                   TFKPQVRVEDDESLLLELKQSS"
FT   assembly_gap    5901800..5901884
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    5910256..5910275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5935351..5935711
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    5943243..5944031
FT                   /estimated_length=789
FT                   /gap_type="unknown"
FT   assembly_gap    5955093..5955112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5958069..5958088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5973266..5973293
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    5974596..5974685
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    5985880..5985899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5988809..5988828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5998853..6005834
FT                   /estimated_length=6982
FT                   /gap_type="unknown"
FT   assembly_gap    6050247..6050266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6051479..6051498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6056182..6056470
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    6057310..6057888
FT                   /estimated_length=579
FT                   /gap_type="unknown"
FT   assembly_gap    6060410..6061704
FT                   /estimated_length=1295
FT                   /gap_type="unknown"
FT   assembly_gap    6066120..6066346
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    6070368..6070632
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    6078403..6078422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6103828..6168614
FT                   /locus_tag="mCG_144530"
FT                   /note="gene_id=mCG144530.0"
FT   mRNA            join(<6103828..6103997,6119550..6119678,6148939..6149051,
FT                   6166065..6168614)
FT                   /locus_tag="mCG_144530"
FT                   /product="mCG144530"
FT                   /note="gene_id=mCG144530.0 transcript_id=mCT183954.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    6108344..6109109
FT                   /estimated_length=766
FT                   /gap_type="unknown"
FT   assembly_gap    6127832..6127851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <6167298..6167564
FT                   /codon_start=1
FT                   /locus_tag="mCG_144530"
FT                   /product="mCG144530"
FT                   /note="gene_id=mCG144530.0 transcript_id=mCT183954.0
FT                   protein_id=mCP105210.0"
FT                   /protein_id="EDL02327.1"
FT                   /translation="WSNREYYTPLIHLEGAVSCPCTVGTLAFNSHGLKGVMKLFEEKCI
FT                   VHIFSPKFPYIFAVNKEILVSFNLMTGWGLVSASGLCASSLLA"
FT   assembly_gap    6175478..6175537
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   gene            complement(6176154..6177422)
FT                   /locus_tag="mCG_147028"
FT                   /note="gene_id=mCG147028.0"
FT   mRNA            complement(6176154..6177422)
FT                   /locus_tag="mCG_147028"
FT                   /product="mCG147028"
FT                   /note="gene_id=mCG147028.0 transcript_id=mCT187291.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(6176772..6176918)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147028"
FT                   /product="mCG147028"
FT                   /note="gene_id=mCG147028.0 transcript_id=mCT187291.0
FT                   protein_id=mCP108161.0"
FT                   /protein_id="EDL02326.1"
FT                   /translation="MPFHWDTASSQSCVFPAPSVMGCPSTGIPPPLRAERFLGFRVPGY
FT                   PPI"
FT   assembly_gap    6196288..6196307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6214431..6214682
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    6216746..6216765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6242787..6242806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6245816..6245916
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   gene            6264733..6605635
FT                   /gene="E130309F12Rik"
FT                   /locus_tag="mCG_2305"
FT                   /note="gene_id=mCG2305.2"
FT   mRNA            join(6264733..6264888,6265011..6265096,6411437..6411544,
FT                   6494015..6494203,6512696..6512828,6547730..6548128,
FT                   6605494..6605635)
FT                   /gene="E130309F12Rik"
FT                   /locus_tag="mCG_2305"
FT                   /product="RIKEN cDNA E130309F12"
FT                   /note="gene_id=mCG2305.2 transcript_id=mCT1481.2 created on
FT                   02-APR-2003"
FT   assembly_gap    6269296..6269315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6300190..6300209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6312407..6312426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6317913..6318042
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    6327677..6327723
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    6335206..6335225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6341948..6342528
FT                   /estimated_length=581
FT                   /gap_type="unknown"
FT   assembly_gap    6344601..6344872
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    6346441..6346506
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   CDS             join(6411482..6411544,6494015..6494203,6512696..6512828,
FT                   6547730..6547767)
FT                   /codon_start=1
FT                   /gene="E130309F12Rik"
FT                   /locus_tag="mCG_2305"
FT                   /product="RIKEN cDNA E130309F12"
FT                   /note="gene_id=mCG2305.2 transcript_id=mCT1481.2
FT                   protein_id=mCP5777.2"
FT                   /protein_id="EDL02323.1"
FT                   /translation="MAVENNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHI
FT                   QGFFCQDGDLMKPYPGTEEESFISPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIA
FT                   EEKMILTGDCCYLSPLLRRIIRFIESLRLHDRSHLR"
FT   assembly_gap    6417437..6417456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6432368..6432798
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    6459842..6461764
FT                   /estimated_length=1923
FT                   /gap_type="unknown"
FT   assembly_gap    6466169..6466188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6471643..6477756
FT                   /estimated_length=6114
FT                   /gap_type="unknown"
FT   assembly_gap    6483286..6483305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6484396..6492336
FT                   /estimated_length=7941
FT                   /gap_type="unknown"
FT   assembly_gap    6493495..6493514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6527065..6527820
FT                   /estimated_length=756
FT                   /gap_type="unknown"
FT   assembly_gap    6529287..6529306
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6530575..6532768
FT                   /estimated_length=2194
FT                   /gap_type="unknown"
FT   assembly_gap    6540117..6546853
FT                   /estimated_length=6737
FT                   /gap_type="unknown"
FT   assembly_gap    6548277..6549576
FT                   /estimated_length=1300
FT                   /gap_type="unknown"
FT   assembly_gap    6582210..6582274
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            complement(6585331..6593696)
FT                   /locus_tag="mCG_14279"
FT                   /note="gene_id=mCG14279.1"
FT   mRNA            complement(join(6585331..6585456,6590547..6590627,
FT                   6591642..6591844,6593006..6593696))
FT                   /locus_tag="mCG_14279"
FT                   /product="mCG14279, transcript variant mCT12848"
FT                   /note="gene_id=mCG14279.1 transcript_id=mCT12848.1 created
FT                   on 26-JUN-2002"
FT   CDS             complement(join(6585376..6585456,6590547..6590627,
FT                   6591642..6591844,6593006..6593471))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14279"
FT                   /product="mCG14279, isoform CRA_a"
FT                   /note="gene_id=mCG14279.1 transcript_id=mCT12848.1
FT                   protein_id=mCP15254.2 isoform=CRA_a"
FT                   /protein_id="EDL02324.1"
FT                   /translation="MMIQLIATPSNALVDEPVSIRATGLPPSQIVTIKATVKDENDNVF
FT                   QSQAFYKTNEAGEVDLEKTPALGGDYVGVHPMGLFFSLKPKKAFHRLMKKDVMNSPLCI
FT                   CLDLYDSVNWLETVRIPSKASQRVQRWFVGPGVKREQIQEGRVRGALFLPPGKGPFPGI
FT                   IDLFGLIGGLVEFRASLLASHGFAVLALAYFAYEDLPEKPQEVDLEYFEEAANFLLSHP
FT                   KIQQPGIGVISTSKGAEIGLAMACYLKQALAACTLLLLLFFVIVSWYWHLQKTA"
FT   mRNA            complement(join(6589841..6590627,6591642..6591790,
FT                   6593006..6593496))
FT                   /locus_tag="mCG_14279"
FT                   /product="mCG14279, transcript variant mCT170424"
FT                   /note="gene_id=mCG14279.1 transcript_id=mCT170424.0 created
FT                   on 26-JUN-2002"
FT   CDS             complement(join(6590034..6590627,6591642..6591790,
FT                   6593006..6593471))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14279"
FT                   /product="mCG14279, isoform CRA_b"
FT                   /note="gene_id=mCG14279.1 transcript_id=mCT170424.0
FT                   protein_id=mCP93342.0 isoform=CRA_b"
FT                   /protein_id="EDL02325.1"
FT                   /translation="MMIQLIATPSNALVDEPVSIRATGLPPSQIVTIKATVKDENDNVF
FT                   QSQAFYKTNEAGEVDLEKTPALGGDYVGVHPMGLFFSLKPKKAFHRLMKKDVMNSPLCI
FT                   CLDLYDSVNWLETVRIPSKASQRVQRWFVGPGVKREQIQEGRVRGALFLPPVEFRASLL
FT                   ASHGFAVLALAYFAYEDLPEKPQEVDLEYFEEAANFLLSHPKIQQPGIGVISTSKGAEI
FT                   GLAMACYLKQVIATVCINGPTTITIFPLRYQDLVMTPIHPALERIQVHDSGALLFRYTT
FT                   QYLHNKLNSQNILPVEKAQGKILFIVGENDECLDSKLHAQKAMDRLQRHGRSSGRMLAY
FT                   PGAGHLIEPPYSPVCFVAWFPVLGQPMCFGGDLMAHAAAQEHSWREIQKFFRKHLLQSG
FT                   SKL"
FT   assembly_gap    6594573..6596176
FT                   /estimated_length=1604
FT                   /gap_type="unknown"
FT   assembly_gap    6603248..6604894
FT                   /estimated_length=1647
FT                   /gap_type="unknown"
FT   assembly_gap    6605933..6606368
FT                   /estimated_length=436
FT                   /gap_type="unknown"
FT   assembly_gap    6611500..6611519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6612730..6613778
FT                   /estimated_length=1049
FT                   /gap_type="unknown"
FT   assembly_gap    6614835..6615284
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    6617666..6618921
FT                   /estimated_length=1256
FT                   /gap_type="unknown"
FT   gene            <6621339..6621666
FT                   /locus_tag="mCG_50840"
FT                   /note="gene_id=mCG50840.2"
FT   mRNA            <6621339..6621666
FT                   /locus_tag="mCG_50840"
FT                   /product="mCG50840"
FT                   /note="gene_id=mCG50840.2 transcript_id=mCT51023.2 created
FT                   on 25-JUN-2002"
FT   CDS             6621339..6621662
FT                   /codon_start=1
FT                   /locus_tag="mCG_50840"
FT                   /product="mCG50840"
FT                   /note="gene_id=mCG50840.2 transcript_id=mCT51023.2
FT                   protein_id=mCP27990.1"
FT                   /protein_id="EDL02322.1"
FT                   /translation="MGASGSKARGLWPFASTLGDRDPEAAGSEQSLVWPRGRAVPPFVF
FT                   TRSGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNQIPQGIVKLDPPNPYGFPR
FT                   DPL"
FT   gene            6639276..6644528
FT                   /pseudo
FT                   /locus_tag="mCG_1041292"
FT                   /note="gene_id=mCG1041292.1"
FT   mRNA            join(6639276..6640012,6643757..6644528)
FT                   /pseudo
FT                   /locus_tag="mCG_1041292"
FT                   /note="gene_id=mCG1041292.1 transcript_id=mCT158996.1
FT                   created on 25-JUN-2002"
FT   gene            complement(6656320..6660164)
FT                   /locus_tag="mCG_14277"
FT                   /note="gene_id=mCG14277.1"
FT   mRNA            complement(join(6656320..6656939,6658125..6658327,
FT                   6659673..6660164))
FT                   /locus_tag="mCG_14277"
FT                   /product="mCG14277"
FT                   /note="gene_id=mCG14277.1 transcript_id=mCT12812.1 created
FT                   on 25-JUN-2002"
FT   CDS             complement(join(6656358..6656939,6658125..6658327,
FT                   6659673..6660138))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14277"
FT                   /product="mCG14277"
FT                   /note="gene_id=mCG14277.1 transcript_id=mCT12812.1
FT                   protein_id=mCP15246.2"
FT                   /protein_id="EDL02321.1"
FT                   /translation="MMIKLIATPSNALVDEPVSIRATGLPPSQIVTIKATVKDENDNVF
FT                   QSQAFYKTNEAGEVDLEKTPALGGDYVGVHPMGLFFSLKPKKAFHRLMKKDVMNSPFCI
FT                   CLDLYDSVNWLETVRIPSKASQRVQRWFVGPGVKREQIQEGRVRGALFLPPGKGPFPGI
FT                   IDLFGVIGGLVEFRASLLASHGFAVLALAYFAYKDLPEKLQEVDLEYFEEAANFLLSHP
FT                   KIQQPGIGVISTSKGAEIGLAMACYLKQVIATVCINGATTTTAVPLRYQDLVVTPIQQA
FT                   LERMEVHVSGAVCFRHTTQYLQNKNILPVEKAQGKILFIVGENDELLDSKLHAQRAMDR
FT                   LRRHGRSSGRMLAYPGAGHLIEPPYSPLCFASWQPVLGRPMCFGGDLMAHAAAQEHSWR
FT                   EIQKFFRKHLLQSGSKL"
FT   assembly_gap    6667528..6667547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6669398..6669469
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    6670562..6675374
FT                   /estimated_length=4813
FT                   /gap_type="unknown"
FT   gene            complement(6688329..6690508)
FT                   /locus_tag="mCG_147031"
FT                   /note="gene_id=mCG147031.0"
FT   mRNA            complement(join(6688329..6690247,6690435..6690508))
FT                   /locus_tag="mCG_147031"
FT                   /product="mCG147031"
FT                   /note="gene_id=mCG147031.0 transcript_id=mCT187294.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(6688540..6688728)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147031"
FT                   /product="mCG147031"
FT                   /note="gene_id=mCG147031.0 transcript_id=mCT187294.0
FT                   protein_id=mCP108164.0"
FT                   /protein_id="EDL02320.1"
FT                   /translation="MVCLRKFLKLASCLSREVYLKSLLSHKELFSSGEQLLLQKLFRGN
FT                   IFLILKVLVYFRRLCRK"
FT   gene            complement(6698890..6715836)
FT                   /gene="Baat"
FT                   /locus_tag="mCG_14282"
FT                   /note="gene_id=mCG14282.1"
FT   mRNA            complement(join(6698890..6699884,6709085..6709287,
FT                   6712104..6712620,6715699..6715836))
FT                   /gene="Baat"
FT                   /locus_tag="mCG_14282"
FT                   /product="bile acid-Coenzyme A: amino acid
FT                   N-acyltransferase"
FT                   /note="gene_id=mCG14282.1 transcript_id=mCT12849.1 created
FT                   on 25-JUN-2002"
FT   CDS             complement(join(6699291..6699884,6709085..6709287,
FT                   6712104..6712569))
FT                   /codon_start=1
FT                   /gene="Baat"
FT                   /locus_tag="mCG_14282"
FT                   /product="bile acid-Coenzyme A: amino acid
FT                   N-acyltransferase"
FT                   /note="gene_id=mCG14282.1 transcript_id=mCT12849.1
FT                   protein_id=mCP15228.2"
FT                   /db_xref="GOA:Q91X34"
FT                   /db_xref="InterPro:IPR006862"
FT                   /db_xref="InterPro:IPR014940"
FT                   /db_xref="InterPro:IPR016662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="MGI:MGI:106642"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91X34"
FT                   /protein_id="EDL02319.1"
FT                   /translation="MAKLTAVPLSALVDEPVHIQVTGLAPFQVVCLQASLKDEKGNLFS
FT                   SQAFYRASEVGEVDLEHDPSLGGDYMGVHPMGLFWSLKPEKLLGRLIKRDVMNSPYQIH
FT                   IKACHPYFPLQDIVVSPPLDSLTLERWYVAPGVKRIQVKESRIRGALFLPPGEGPFPGV
FT                   IDLFGGAGGLMEFRASLLASRGFATLALAYWNYDDLPSRLEKVDLEYFEEGVEFLLRHP
FT                   KVLGPGVGILSVCIGAEIGLSMAINLKQIRATVLINGPNFVSQSPHVYHGQVYPPVPSN
FT                   EEFVVTNALGLVEFYRTFQETADKDSKYCFPIEKAHGHFLFVVGEDDKNLNSKVHANQA
FT                   IAQLMKNGKKNWTLLSYPGAGHLIEPPYTPLCQASRMPILIPSLSWGGEVIPHAAAQEH
FT                   SWKEIQKFLKQHLLPDLSSQL"
FT   assembly_gap    6713991..6714010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6717241..6717266
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    6719172..6719191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6721066..6729637)
FT                   /gene="Mrpl50"
FT                   /locus_tag="mCG_14283"
FT                   /note="gene_id=mCG14283.1"
FT   mRNA            complement(join(6721066..6723133,6729518..6729637))
FT                   /gene="Mrpl50"
FT                   /locus_tag="mCG_14283"
FT                   /product="mitochondrial ribosomal protein L50"
FT                   /note="gene_id=mCG14283.1 transcript_id=mCT12850.1 created
FT                   on 25-JUN-2002"
FT   CDS             complement(join(6722746..6723133,6729518..6729609))
FT                   /codon_start=1
FT                   /gene="Mrpl50"
FT                   /locus_tag="mCG_14283"
FT                   /product="mitochondrial ribosomal protein L50"
FT                   /note="gene_id=mCG14283.1 transcript_id=mCT12850.1
FT                   protein_id=mCP15231.2"
FT                   /protein_id="EDL02318.1"
FT                   /translation="MAALIVSRLARRGWLWKLPLATRREFWSRSRKEKEPVVAETVEEV
FT                   KKEPVLVCPPLRSRAYTPPSDLQSRLESHIKEVLGSSLPNNWQDISLDDGHMKFRLLAG
FT                   LADGLGHAVPNSRLHQMCRVRDVLDFYNVPVQDKSKFDELVASNLPPNLKISWSY"
FT   gene            6729782..6740073
FT                   /gene="Zfp189"
FT                   /locus_tag="mCG_14278"
FT                   /note="gene_id=mCG14278.1"
FT   mRNA            join(6729782..6730151,6730954..6731038,6737572..6740073)
FT                   /gene="Zfp189"
FT                   /locus_tag="mCG_14278"
FT                   /product="zinc finger protein 189"
FT                   /note="gene_id=mCG14278.1 transcript_id=mCT12847.1 created
FT                   on 25-JUN-2002"
FT   CDS             join(6730119..6730151,6730954..6731038,6737572..6739280)
FT                   /codon_start=1
FT                   /gene="Zfp189"
FT                   /locus_tag="mCG_14278"
FT                   /product="zinc finger protein 189"
FT                   /note="gene_id=mCG14278.1 transcript_id=mCT12847.1
FT                   protein_id=mCP15247.2"
FT                   /db_xref="GOA:Q8BKP2"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:2444707"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BKP2"
FT                   /protein_id="EDL02317.1"
FT                   /translation="MASPSPPLEPKEEWGYLDPAPRSLYKDVMMDSYGKLVSLDVLNRN
FT                   KDEEPTVKEELEKDIEPQGVIVTRIKSEIDQDPVGSETFELVGRLDKQRGIFLWEIPRD
FT                   SLSEEQKLFRGHTNVRKRPTSEEKCHKCEECGKRFVRKAHFIQHQRVHTGEKPFQCNEC
FT                   GKSFSRSSFVIEHQRIHTGERPYECNYCGKTFSVSSTLIRHQRIHTGERPYQCNQCKQS
FT                   FSQRRSLVKHQRIHTGEKPHKCSDCGKAFSWKSHLIEHQRTHTGEKPYHCTKCKKSFSR
FT                   NSLLVEHQRIHTGERPHKCGECGKAFRLSTYLIQHQKIHTGEKPFLCIECGKSFSRSSF
FT                   LIEHQRIHTGERPYQCQECGKSFSQLCNLTRHQRIHTGDKPHKCEECGKAFSRSSGLIQ
FT                   HQRIHIREKTSPFSETKESFDPNCSLVIQQEVSPKEKSYKCDDCGKTFSVSAHLVQHQR
FT                   IHTGEKPYLCTVCGKSFSRSSFLIEHQRIHTGERPYLCRQCGKSFSQLCNLIRHQGVHT
FT                   GNKPHKCEECGKAFSRNSGLIQHQRIHTGEKPYRCGKCDKSFSQQRSLVNHQKIHAEVK
FT                   TQEIYECDACGEAFTCQISLIQHQKLHIMWMQ"
FT   gene            complement(6744981..6758149)
FT                   /gene="Aldob"
FT                   /locus_tag="mCG_14281"
FT                   /note="gene_id=mCG14281.2"
FT   mRNA            complement(join(6744981..6745444,6746684..6746883,
FT                   6747274..6747448,6748269..6748352,6749692..6749852,
FT                   6751416..6751470,6752279..6752490,6753419..6753540,
FT                   6758053..6758149))
FT                   /gene="Aldob"
FT                   /locus_tag="mCG_14281"
FT                   /product="aldolase 2, B isoform, transcript variant
FT                   mCT12815"
FT                   /note="gene_id=mCG14281.2 transcript_id=mCT12815.2 created
FT                   on 25-JUN-2002"
FT   mRNA            complement(join(6744981..6745422,6752307..6752490,
FT                   6753419..6753540,6758053..6758107))
FT                   /gene="Aldob"
FT                   /locus_tag="mCG_14281"
FT                   /product="aldolase 2, B isoform, transcript variant
FT                   mCT170378"
FT                   /note="gene_id=mCG14281.2 transcript_id=mCT170378.0 created
FT                   on 25-JUN-2002"
FT   mRNA            complement(join(6744981..6745444,6746684..6746707,
FT                   6751443..6751470,6752279..6752490,6753419..6753540,
FT                   6758053..6758107))
FT                   /gene="Aldob"
FT                   /locus_tag="mCG_14281"
FT                   /product="aldolase 2, B isoform, transcript variant
FT                   mCT170377"
FT                   /note="gene_id=mCG14281.2 transcript_id=mCT170377.0 created
FT                   on 25-JUN-2002"
FT   CDS             complement(join(6745296..6745422,6752307..6752490,
FT                   6753419..6753530))
FT                   /codon_start=1
FT                   /gene="Aldob"
FT                   /locus_tag="mCG_14281"
FT                   /product="aldolase 2, B isoform, isoform CRA_f"
FT                   /note="gene_id=mCG14281.2 transcript_id=mCT170378.0
FT                   protein_id=mCP93295.0 isoform=CRA_f"
FT                   /protein_id="EDL02316.1"
FT                   /translation="MAHRFPALTPEQKKELSEIAQRIVANGKGILAADESVGTMGNRLQ
FT                   RIKVENTEENRRQFRELLFSVDNSISQSIGGVILFHETLYQKDSQGNLFRNVLKTVRSH
FT                   RLFRCCCHPVALHSLLHLLDTVTTSQAPVLLNILET"
FT   CDS             complement(join(6745349..6745444,6746684..6746883,
FT                   6747274..6747448,6748269..6748352,6749692..6749852,
FT                   6751416..6751470,6752279..6752490,6753419..6753530))
FT                   /codon_start=1
FT                   /gene="Aldob"
FT                   /locus_tag="mCG_14281"
FT                   /product="aldolase 2, B isoform, isoform CRA_a"
FT                   /note="gene_id=mCG14281.2 transcript_id=mCT12815.2
FT                   protein_id=mCP15276.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UER1"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR029768"
FT                   /db_xref="MGI:MGI:87995"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UER1"
FT                   /protein_id="EDL02311.1"
FT                   /translation="MAHRFPALTPEQKKELSEIAQRIVANGKGILAADESVGTMGNRLQ
FT                   RIKVENTEENRRQFRELLFSVDNSISQSIGGVILFHETLYQKDSQGNLFRNVLKEKGIV
FT                   VGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLA
FT                   IQENANALARYASICQQNGLVPIVEPEVLPDGDHDLEHCQYVSEKVLAAVYKALNDHHV
FT                   YLEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDAT
FT                   LNLNAINRCPLPRPWKLSFSYGRALQASALAAWGGKAANKKATQEAFMKRAMANCQAAQ
FT                   GQYVHTGSSGAAATQSLFTASYTY"
FT   CDS             complement(join(6745440..6745444,6746684..6746707,
FT                   6751443..6751470,6752279..6752490,6753419..6753530))
FT                   /codon_start=1
FT                   /gene="Aldob"
FT                   /locus_tag="mCG_14281"
FT                   /product="aldolase 2, B isoform, isoform CRA_c"
FT                   /note="gene_id=mCG14281.2 transcript_id=mCT170377.0
FT                   protein_id=mCP93294.0 isoform=CRA_c"
FT                   /protein_id="EDL02313.1"
FT                   /translation="MAHRFPALTPEQKKELSEIAQRIVANGKGILAADESVGTMGNRLQ
FT                   RIKVENTEENRRQFRELLFSVDNSISQSIGGVILFHETLYQKDSQGNLFRNVLKEKGIV
FT                   VGIKLDQGGAPLAGSFHEAGYG"
FT   mRNA            complement(join(<6746681..6746883,6747274..6747448,
FT                   6748269..6748352,6749692..6749852,6751416..6751470,
FT                   6752279..6752421,6758072..>6758116))
FT                   /gene="Aldob"
FT                   /locus_tag="mCG_14281"
FT                   /product="aldolase 2, B isoform, transcript variant
FT                   mCT170376"
FT                   /note="gene_id=mCG14281.2 transcript_id=mCT170376.0 created
FT                   on 25-JUN-2002"
FT   CDS             complement(join(<6746681..6746883,6747274..6747448,
FT                   6748269..6748352,6749692..6749852,6751416..6751470,
FT                   6752279..6752421,6758072..>6758081))
FT                   /codon_start=1
FT                   /gene="Aldob"
FT                   /locus_tag="mCG_14281"
FT                   /product="aldolase 2, B isoform, isoform CRA_b"
FT                   /note="gene_id=mCG14281.2 transcript_id=mCT170376.0
FT                   protein_id=mCP93296.0 isoform=CRA_b"
FT                   /protein_id="EDL02312.1"
FT                   /translation="YLGELLFSVDNSISQSIGGVILFHETLYQKDSQGNLFRNVLKEKG
FT                   IVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSS
FT                   LAIQENANALARYASICQQNGLVPIVEPEVLPDGDHDLEHCQYVSEKVLAAVYKALNDH
FT                   HVYLEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEED
FT                   ATLNLNAINRCPLPRPWKLSFSYGRALQASALAAWGGKAANKKATQEAFMKRAMV"
FT   mRNA            complement(join(6747306..6747448,6748269..6748322,
FT                   6749760..6749852,6751416..6751470,6752279..6752490,
FT                   6753419..6753540,6758053..>6758114))
FT                   /gene="Aldob"
FT                   /locus_tag="mCG_14281"
FT                   /product="aldolase 2, B isoform, transcript variant
FT                   mCT189520"
FT                   /note="gene_id=mCG14281.2 transcript_id=mCT189520.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(6747351..6747448,6748269..6748322,
FT                   6749829..6749852,6751416..6751470,6752279..6752490,
FT                   6753419..6753540,6758053..>6758114))
FT                   /gene="Aldob"
FT                   /locus_tag="mCG_14281"
FT                   /product="aldolase 2, B isoform, transcript variant
FT                   mCT189521"
FT                   /note="gene_id=mCG14281.2 transcript_id=mCT189521.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(6748312..6748322,6749829..6749852,
FT                   6751416..6751470,6752279..6752490,6753419..6753540,
FT                   6758053..>6758081))
FT                   /codon_start=1
FT                   /gene="Aldob"
FT                   /locus_tag="mCG_14281"
FT                   /product="aldolase 2, B isoform, isoform CRA_e"
FT                   /note="gene_id=mCG14281.2 transcript_id=mCT189521.0
FT                   protein_id=mCP110484.0 isoform=CRA_e"
FT                   /protein_id="EDL02315.1"
FT                   /translation="YLGGLFPFAVPVIMAHRFPALTPEQKKELSEIAQRIVANGKGILA
FT                   ADESVGTMGNRLQRIKVENTEENRRQFRELLFSVDNSISQSIGGVILFHETLYQKDSQG
FT                   NLFRNVLKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAS"
FT   CDS             complement(join(6748312..6748322,6749760..6749852,
FT                   6751416..6751470,6752279..6752490,6753419..6753540,
FT                   6758053..>6758081))
FT                   /codon_start=1
FT                   /gene="Aldob"
FT                   /locus_tag="mCG_14281"
FT                   /product="aldolase 2, B isoform, isoform CRA_d"
FT                   /note="gene_id=mCG14281.2 transcript_id=mCT189520.0
FT                   protein_id=mCP110483.0 isoform=CRA_d"
FT                   /protein_id="EDL02314.1"
FT                   /translation="YLGGLFPFAVPVIMAHRFPALTPEQKKELSEIAQRIVANGKGILA
FT                   ADESVGTMGNRLQRIKVENTEENRRQFRELLFSVDNSISQSIGGVILFHETLYQKDSQG
FT                   NLFRNVLKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRA
FT                   VLRIADQCAS"
FT   assembly_gap    6750968..6750987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6764181..6764424
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   gene            complement(6793965..6806281)
FT                   /gene="2810432L12Rik"
FT                   /locus_tag="mCG_120728"
FT                   /note="gene_id=mCG120728.1"
FT   mRNA            complement(join(6793965..6795791,6806106..6806281))
FT                   /gene="2810432L12Rik"
FT                   /locus_tag="mCG_120728"
FT                   /product="RIKEN cDNA 2810432L12, transcript variant
FT                   mCT170373"
FT                   /note="gene_id=mCG120728.1 transcript_id=mCT170373.0
FT                   created on 25-JUN-2002"
FT   mRNA            complement(join(6793965..6795791,6805681..6805730))
FT                   /gene="2810432L12Rik"
FT                   /locus_tag="mCG_120728"
FT                   /product="RIKEN cDNA 2810432L12, transcript variant
FT                   mCT121920"
FT                   /note="gene_id=mCG120728.1 transcript_id=mCT121920.1
FT                   created on 25-JUN-2002"
FT   CDS             complement(6794505..6795716)
FT                   /codon_start=1
FT                   /gene="2810432L12Rik"
FT                   /locus_tag="mCG_120728"
FT                   /product="RIKEN cDNA 2810432L12, isoform CRA_b"
FT                   /note="gene_id=mCG120728.1 transcript_id=mCT170373.0
FT                   protein_id=mCP93291.0 isoform=CRA_b"
FT                   /protein_id="EDL02310.1"
FT                   /translation="MTTSTSPAAMLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHR
FT                   LLHSYFYLRHWHLNQMSQDFLQQSLKEGEAALHYFEELPSANGSVPIVWQATPRPWLVI
FT                   TIITVDRQPGFHYVLQVVSQFHRLLQQCGPQCEGHQLFLCNVERSVSHFDAKLLSKYVP
FT                   VANRYEGTEDDYGDDPSTNSFEKEKQDYVYCLESSLQTYNPDYVLMVEDDAIPEEQIFP
FT                   VLEHLLRARFSEPHLQDALYLKLYHPERLQHYINPEPMRILEWVGVGMLLGPVLTWIYM
FT                   RFACRPGFSWPVMLFFCLYSMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFP
FT                   APAARRTLTYLSQVYCHKGFGKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFH
FT                   PSLL"
FT   CDS             complement(6794505..6795689)
FT                   /codon_start=1
FT                   /gene="2810432L12Rik"
FT                   /locus_tag="mCG_120728"
FT                   /product="RIKEN cDNA 2810432L12, isoform CRA_a"
FT                   /note="gene_id=mCG120728.1 transcript_id=mCT121920.1
FT                   protein_id=mCP53461.1 isoform=CRA_a"
FT                   /protein_id="EDL02309.1"
FT                   /translation="MLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHRLLHSYFYLR
FT                   HWHLNQMSQDFLQQSLKEGEAALHYFEELPSANGSVPIVWQATPRPWLVITIITVDRQP
FT                   GFHYVLQVVSQFHRLLQQCGPQCEGHQLFLCNVERSVSHFDAKLLSKYVPVANRYEGTE
FT                   DDYGDDPSTNSFEKEKQDYVYCLESSLQTYNPDYVLMVEDDAIPEEQIFPVLEHLLRAR
FT                   FSEPHLQDALYLKLYHPERLQHYINPEPMRILEWVGVGMLLGPVLTWIYMRFACRPGFS
FT                   WPVMLFFCLYSMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLT
FT                   YLSQVYCHKGFGKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL"
FT   assembly_gap    6805222..6805458
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    6838125..6838144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6839552..6839571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6840700..6865851
FT                   /gene="Rnf20"
FT                   /locus_tag="mCG_14280"
FT                   /note="gene_id=mCG14280.1"
FT   mRNA            join(6840700..6841125,6841867..6842023,6846520..6846687,
FT                   6846801..6846939,6847239..6847421,6850671..6850789,
FT                   6853083..6853229,6854218..6854295,6854485..6854604,
FT                   6856885..6857064,6857869..6858004,6858325..6858446,
FT                   6858562..6858702,6858850..6858926,6860030..6860147,
FT                   6861121..6861270,6861664..6861876,6862790..6862915,
FT                   6863046..6863237,6864010..6864111,6864400..6865851)
FT                   /gene="Rnf20"
FT                   /locus_tag="mCG_14280"
FT                   /product="ring finger protein 20, transcript variant
FT                   mCT12814"
FT                   /note="gene_id=mCG14280.1 transcript_id=mCT12814.1 created
FT                   on 25-JUN-2002"
FT   mRNA            join(<6840734..6840824,6840978..6841125,6841867..6842023,
FT                   6846520..6846687,6846801..6846948,6847239..6847421,
FT                   6850671..6850789,6853083..6853229,6854218..6854295,
FT                   6854485..6854604,6856885..6857064,6857869..6858004,
FT                   6858325..6858446,6858562..6858926,6860030..6860147,
FT                   6861121..6861270,6861664..6861876,6862790..6862915,
FT                   6863046..6863186,6864010..6864111,6864400..6865485)
FT                   /gene="Rnf20"
FT                   /locus_tag="mCG_14280"
FT                   /product="ring finger protein 20, transcript variant
FT                   mCT189519"
FT                   /note="gene_id=mCG14280.1 transcript_id=mCT189519.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<6841877..6842023,6846520..6846687,6846801..6846948,
FT                   6847239..6847421,6850671..6850789,6853083..6853229,
FT                   6854218..6854295,6854485..6854604,6856885..6857064,
FT                   6857869..6858004,6858325..6858446,6858562..6858926,
FT                   6860030..6860147,6861121..6861270,6861664..6861876,
FT                   6862790..6862915,6863046..6863186,6864010..6864111,
FT                   6864400..6864576)
FT                   /codon_start=1
FT                   /gene="Rnf20"
FT                   /locus_tag="mCG_14280"
FT                   /product="ring finger protein 20, isoform CRA_b"
FT                   /note="gene_id=mCG14280.1 transcript_id=mCT189519.0
FT                   protein_id=mCP110482.0 isoform=CRA_b"
FT                   /protein_id="EDL02308.1"
FT                   /translation="LSSYTKMSGIGNKRAAGEPGTSMPPEKKTAVEDSGTTVETIKLGG
FT                   VSSTEELDIRTLQSKNRKLAEMLDQRQAIEDELREHIEKLERRQATDDASLLIVNRYWS
FT                   QFDENIRIILKRYDLDQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGDGQEPAFS
FT                   FLATLASSSSEEMESQLQERVESSRRAVSQIVTVYDKLQEKVDLLSRKLNSGDNLIVEE
FT                   AVQELNSFLAQENVRLQELTDLLQEKHHTMSQEFCKLQGKVETAESRVSVLESMIDDLQ
FT                   WDIDKIRKREQRLNRHLAEVLERVNSKGYKVYGAGSSLYGGTITINARKFEEMNAELEE
FT                   NKELAQNRHCELEKLRQDFEEVTTQNEKLKVELRSAVEEVVKETPEYRCMQSQFSVLYN
FT                   ESLQLKAHLDEARTLLHGTRGTHQRQVELIERDEVSLHKKLRTEVIQLEDTLAQVRKEY
FT                   EMLRIEFEQTLAANEQAGPINREMRHLISSLQNHNHQLKGEVLRYKRKLREAQSDLNKT
FT                   RLRSGSALLQSQSSTEDPKDEPTELKQDSEDLATHSSALKASQEDEVKSKRDEEERERE
FT                   RREKEREREREREKEKEREREKQKLKESEKERDSVKDKEKGKHDDGRKKEAEIIKQLKI
FT                   ELKKAQESQKEMKLLLDMYRSAPKEQRDKVQLMAAEKKSKAELEDLRQRLKDLEDKEKK
FT                   ENKKMADEDALRKIRAVEEQIEYLQKKLAMAKQEEEALLSEMDVTGQAFEDMQEQNIRL
FT                   MQQLREKDDANFKLMSERIKSNQIHKLLKEEKEELADQVLTLKTQVDAQLQVVRKLEEK
FT                   EHLLQSNIGTGEKELGLRTQALEMNKRKAMEAAQLADDLKAQLELAQKKLHDFQDEIVE
FT                   NSVTKEKDLFNFKRAQEDISRLRRKLETTKKPDNVPKCDEILMEEIKDYKARLTCPCCN
FT                   MRKKDAVLTKCFHVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYIG"
FT   CDS             join(6841895..6842023,6846520..6846687,6846801..6846939,
FT                   6847239..6847421,6850671..6850789,6853083..6853229,
FT                   6854218..6854295,6854485..6854604,6856885..6857064,
FT                   6857869..6858004,6858325..6858446,6858562..6858702,
FT                   6858850..6858926,6860030..6860147,6861121..6861270,
FT                   6861664..6861876,6862790..6862915,6863046..6863237,
FT                   6864010..6864111,6864400..6864576)
FT                   /codon_start=1
FT                   /gene="Rnf20"
FT                   /locus_tag="mCG_14280"
FT                   /product="ring finger protein 20, isoform CRA_a"
FT                   /note="gene_id=mCG14280.1 transcript_id=mCT12814.1
FT                   protein_id=mCP15256.1 isoform=CRA_a"
FT                   /protein_id="EDL02307.1"
FT                   /translation="MSGIGNKRAAGEPGTSMPPEKKTAVEDSGTTVETIKLGGVSSTEE
FT                   LDIRTLQSKNRKLAEMLDQRQAIEDELREHIEKLERRQATDDASLLIVNRYWSQFDENI
FT                   RIILKRYDLDQGLGDLLTERKALVVPEPEPDSDSNQERKDDRDGQEPAFSFLATLASSS
FT                   SEEMESQLQERVESSRRAVSQIVTVYDKLQEKVDLLSRKLNSGDNLIVEEAVQELNSFL
FT                   AQENVRLQELTDLLQEKHHTMSQEFCKLQGKVETAESRVSVLESMIDDLQWDIDKIRKR
FT                   EQRLNRHLAEVLERVNSKGYKVYGAGSSLYGGTITINARKFEEMNAELEENKELAQNRH
FT                   CELEKLRQDFEEVTTQNEKLKVELRSAVEEVVKETPEYRCMQSQFSVLYNESLQLKAHL
FT                   DEARTLLHGTRGTHQRQVELIERDEVSLHKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQ
FT                   TLAANEQAGPINREMRHLISSLQNHNHQLKGEVLRYKRKLREAQSDLNKTRLRSGSALL
FT                   QSQSSTEDPKDEPTELKQDSEDLATHSSALKASQEDEDKEKGKHDDGRKKEAEIIKQLK
FT                   IELKKAQESQKEMKLLLDMYRSAPKEQRDKVQLMAAEKKSKAELEDLRQRLKDLEDKEK
FT                   KENKKMADEDALRKIRAVEEQIEYLQKKLAMAKQEEEALLSEMDVTGQAFEDMQEQNIR
FT                   LMQQLREKDDANFKLMSERIKSNQIHKLLKEEKEELADQVLTLKTQVDAQLQVVRKLEE
FT                   KEHLLQSNIGTGEKELGLRTQALEMNKRKAMEAAQLADDLKAQLELAQKKLHDFQDEIV
FT                   ENSVTKEKDLFNFKRAQARAVVFGYIFTFFVRAVEDISRLRRKLETTKKPDNVPKCDEI
FT                   LMEEIKDYKARLTCPCCNMRKKDAVLTKCFHVFCFECVKTRYDTRQRKCPKCNAAFGAN
FT                   DFHRIYIG"
FT   gene            complement(6872687..>7054566)
FT                   /locus_tag="mCG_120729"
FT                   /note="gene_id=mCG120729.0"
FT   mRNA            complement(join(6872687..6874166,6878625..6878701,
FT                   6881074..6881238,6911323..6911474,6922737..6922852,
FT                   6927854..6927999,6978544..6979591,7002499..7003103,
FT                   7053868..>7054566))
FT                   /locus_tag="mCG_120729"
FT                   /product="mCG120729, transcript variant mCT121921"
FT                   /note="gene_id=mCG120729.0 transcript_id=mCT121921.1
FT                   created on 13-MAY-2003"
FT   mRNA            complement(join(6873804..6874226,6878625..6878701,
FT                   6881074..6881238,6911323..6911474,6922737..6922852,
FT                   6927854..6927999,6978544..6979591,7002499..7003103,
FT                   7053868..>7054566))
FT                   /locus_tag="mCG_120729"
FT                   /product="mCG120729, transcript variant mCT182135"
FT                   /note="gene_id=mCG120729.0 transcript_id=mCT182135.0
FT                   created on 13-MAY-2003"
FT   CDS             complement(join(6873827..6874166,6878625..6878701,
FT                   6881074..6881238,6911323..6911474,6922737..6922852,
FT                   6927854..6927999,6978544..6979591,7002499..7003103,
FT                   7053868..7054566))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120729"
FT                   /product="mCG120729, isoform CRA_a"
FT                   /note="gene_id=mCG120729.0 transcript_id=mCT121921.1
FT                   protein_id=mCP53463.1 isoform=CRA_a"
FT                   /protein_id="EDL02304.1"
FT                   /translation="MRRLSLWWLLSRVCLLLPPPCALVLAGVPSSSSHPQPCQILKRIG
FT                   HAVRVGAVHLQPWTTAPRAASRAQDGGRAGAQRDEPESGTWRPPAPSQGARWLGSALHG
FT                   RGPPGSRKLGEGAGTETLWPRDALLFAVENLNRVEGLLPYNLSLEVVMAIEAGLGDLPL
FT                   MPFSSPSSPWSSDPFSFLQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSSVLHIPVLS
FT                   IVRHEFPRESQNPLHLQLSLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLL
FT                   LTENNSKFHLESIINITANLSSTKDLLSFLQVQLENIRNSTPTMVMFGCDMGSIRQIFE
FT                   MSTQFGLSPPDLHWVLGDSQNVEELRTEGLPLGLIAHGKTTQSVFEYYVQDAMELVARA
FT                   VATATMIQPELALLPSTMNCMDVKTTNLTSGQYLSRFLANTTFRGLSGSIKVKGSTIVS
FT                   SENNFFIWNLQYDPMGKPMWTRLGSWQGGRIVMDSGIWPEQAQRHKTHFHHPNKLHLRV
FT                   VTLIEHPFVFTREVDDEGLCPAGQLCLDPMTNDSSILDSLFSSLHSSNDTVPIKFKKCC
FT                   YGYCIDLLEQLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGTANMAVTSFSIN
FT                   TARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTL
FT                   YEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFC
FT                   MFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPE
FT                   MHEYMRRYNVPATPDGVQYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIE
FT                   GYGIGLPPNSPLTSNISELISQYKSHGFMDVLHDKWYKVVPCGKRSFAVTETLQMGIKH
FT                   FSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQRFHRALNTSFVE
FT                   EKQPRSKTKRVEKRSNMGPQQLMVWNTSNLSHDNQRKYIFNDEEGQNQLGTQTHQDIPL
FT                   PPRRRELPASLTTNGKADSLNVARNSVMQELSELEKQIQVIRQELQLAVSRKTELEEYQ
FT                   RTNRTCES"
FT   CDS             complement(join(6873827..6874226,6878625..6878701,
FT                   6881074..6881238,6911323..6911474,6922737..6922852,
FT                   6927854..6927999,6978544..6979591,7002499..7003103,
FT                   7053868..7054566))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120729"
FT                   /product="mCG120729, isoform CRA_b"
FT                   /note="gene_id=mCG120729.0 transcript_id=mCT182135.0
FT                   protein_id=mCP105055.0 isoform=CRA_b"
FT                   /protein_id="EDL02305.1"
FT                   /translation="MRRLSLWWLLSRVCLLLPPPCALVLAGVPSSSSHPQPCQILKRIG
FT                   HAVRVGAVHLQPWTTAPRAASRAQDGGRAGAQRDEPESGTWRPPAPSQGARWLGSALHG
FT                   RGPPGSRKLGEGAGTETLWPRDALLFAVENLNRVEGLLPYNLSLEVVMAIEAGLGDLPL
FT                   MPFSSPSSPWSSDPFSFLQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSSVLHIPVLS
FT                   IVRHEFPRESQNPLHLQLSLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLL
FT                   LTENNSKFHLESIINITANLSSTKDLLSFLQVQLENIRNSTPTMVMFGCDMGSIRQIFE
FT                   MSTQFGLSPPDLHWVLGDSQNVEELRTEGLPLGLIAHGKTTQSVFEYYVQDAMELVARA
FT                   VATATMIQPELALLPSTMNCMDVKTTNLTSGQYLSRFLANTTFRGLSGSIKVKGSTIVS
FT                   SENNFFIWNLQYDPMGKPMWTRLGSWQGGRIVMDSGIWPEQAQRHKTHFHHPNKLHLRV
FT                   VTLIEHPFVFTREVDDEGLCPAGQLCLDPMTNDSSILDSLFSSLHSSNDTVPIKFKKCC
FT                   YGYCIDLLEQLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGTANMAVTSFSIN
FT                   TARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTL
FT                   YEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFC
FT                   MFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPE
FT                   MHEYMRRYNVPATPDGVQYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIE
FT                   GYGIGLPPNSPLTSNISELISQYKSHGFMDVLHDKWYKVVPCGKRSFAVTETLQMGIKH
FT                   FSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQRFHRALNTSFVE
FT                   EKQPRSKTKRVEKSRWRRWTCKTEGDSELSLFPRSNMGPQQLMVWNTSNLSHDNQRKYI
FT                   FNDEEGQNQLGTQTHQDIPLPPRRRELPASLTTNGKADSLNVARNSVMQELSELEKQIQ
FT                   VIRQELQLAVSRKTELEEYQRTNRTCES"
FT   gene            complement(6887350..6890587)
FT                   /gene="Ppp3r2"
FT                   /locus_tag="mCG_140623"
FT                   /note="gene_id=mCG140623.1"
FT   mRNA            complement(join(6887350..6889790,6890043..6890587))
FT                   /gene="Ppp3r2"
FT                   /locus_tag="mCG_140623"
FT                   /product="protein phosphatase 3, regulatory subunit B,
FT                   alpha isoform (calcineurin B, type II)"
FT                   /note="gene_id=mCG140623.1 transcript_id=mCT170372.1
FT                   created on 13-MAY-2003"
FT   CDS             complement(join(6889760..6889790,6890043..6890551))
FT                   /codon_start=1
FT                   /gene="Ppp3r2"
FT                   /locus_tag="mCG_140623"
FT                   /product="protein phosphatase 3, regulatory subunit B,
FT                   alpha isoform (calcineurin B, type II)"
FT                   /note="gene_id=mCG140623.1 transcript_id=mCT170372.1
FT                   protein_id=mCP93290.0"
FT                   /db_xref="GOA:Q497S1"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:107171"
FT                   /db_xref="UniProtKB/TrEMBL:Q497S1"
FT                   /protein_id="EDL02306.1"
FT                   /translation="MGNEASYQTELCNHFDQEEIRRLGKSFRKLDLDKSGSLSIEEFMR
FT                   LPELQQNPLVGRVIDIFDTDGNGEVDFHEFIVGTSQFSVKGDEEQKLRFAFRIYDMDND
FT                   GFISNGELFQVLKMMVGNNLKDWQLQQLVDKSILVLDKDGDGRISFEEFSDVVKTMEIH
FT                   KKLVVFVEHGQEDLKA"
FT   assembly_gap    6900054..6900073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6921960..6921979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6941548..6946247
FT                   /estimated_length=4700
FT                   /gap_type="unknown"
FT   assembly_gap    6947704..6947723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6948870..6948889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6954858..6955364)
FT                   /pseudo
FT                   /locus_tag="mCG_140622"
FT                   /note="gene_id=mCG140622.0"
FT   mRNA            complement(join(6954858..6955119,6955260..6955364))
FT                   /pseudo
FT                   /locus_tag="mCG_140622"
FT                   /note="gene_id=mCG140622.0 transcript_id=mCT170371.0
FT                   created on 25-JUN-2002"
FT   assembly_gap    6988325..6989151
FT                   /estimated_length=827
FT                   /gap_type="unknown"
FT   assembly_gap    6991540..6991559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6992705..6992724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6993796..6993815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7007634..7010961
FT                   /estimated_length=3328
FT                   /gap_type="unknown"
FT   assembly_gap    7037780..7038434
FT                   /estimated_length=655
FT                   /gap_type="unknown"
FT   assembly_gap    7044536..7044555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7121631..7122062
FT                   /estimated_length=432
FT                   /gap_type="unknown"
FT   assembly_gap    7182499..7182518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7193669..7193789
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    7212503..7212522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7260380..7260858)
FT                   /pseudo
FT                   /locus_tag="mCG_48815"
FT                   /note="gene_id=mCG48815.2"
FT   mRNA            complement(7260380..7260858)
FT                   /pseudo
FT                   /locus_tag="mCG_48815"
FT                   /note="gene_id=mCG48815.2 transcript_id=mCT48998.2 created
FT                   on 25-JUN-2002"
FT   assembly_gap    7268291..7271219
FT                   /estimated_length=2929
FT                   /gap_type="unknown"
FT   assembly_gap    7280173..7280192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7311388..7311616
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    7314845..7314864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7317576..7317595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7347966..7348070
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    7381817..7381836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7394105..7394204
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    7401947..7405760
FT                   /estimated_length=3814
FT                   /gap_type="unknown"
FT   assembly_gap    7419765..7420487
FT                   /estimated_length=723
FT                   /gap_type="unknown"
FT   assembly_gap    7447885..7447904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7473566..7473632
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    7483323..7483352
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    7523008..7523027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7528393..7528412
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7529421..7529440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7530991..7531187
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    7553286..7553305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7584699..7584945
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    7609844..7609863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7612934..7612953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7653555..7653772
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    7663317..7663336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7668982..7678939
FT                   /estimated_length=9958
FT                   /gap_type="unknown"
FT   assembly_gap    7723062..7725981
FT                   /estimated_length=2920
FT                   /gap_type="unknown"
FT   assembly_gap    7729534..7736432
FT                   /estimated_length=6899
FT                   /gap_type="unknown"
FT   assembly_gap    7756700..7756738
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    7764168..7764187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7767665..7767684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7818655..7818674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7826422..7829818
FT                   /estimated_length=3397
FT                   /gap_type="unknown"
FT   assembly_gap    7839774..7839793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7849341..7849360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7854961..7854980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7890072..7890719
FT                   /estimated_length=648
FT                   /gap_type="unknown"
FT   assembly_gap    7920221..7920240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7962904..7962923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7973599..7973618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8035566..8035752
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    8044451..8044470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8046407..8046426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8047651..8047670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8076868..8077345
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   assembly_gap    8096455..8097416
FT                   /estimated_length=962
FT                   /gap_type="unknown"
FT   assembly_gap    8109173..8109381
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    8160794..8160813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8168098..8168117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8170833..8170852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8172306..8172325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8182514..8182560
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    8186062..8186227
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    8201520..8205165
FT                   /estimated_length=3646
FT                   /gap_type="unknown"
FT   assembly_gap    8226369..8226388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8227982..8228001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8228765..8228784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8247037..8252585
FT                   /estimated_length=5549
FT                   /gap_type="unknown"
FT   assembly_gap    8275642..8275661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8365646..8366002
FT                   /pseudo
FT                   /locus_tag="mCG_140625"
FT                   /note="gene_id=mCG140625.0"
FT   mRNA            8365646..8366002
FT                   /pseudo
FT                   /locus_tag="mCG_140625"
FT                   /note="gene_id=mCG140625.0 transcript_id=mCT170382.0
FT                   created on 25-JUN-2002"
FT   gene            8392265..8404947
FT                   /locus_tag="mCG_7553"
FT                   /note="gene_id=mCG7553.2"
FT   mRNA            join(8392265..8392310,8397967..8398007,8400650..8400771,
FT                   8403361..8403827,8404556..8404947)
FT                   /locus_tag="mCG_7553"
FT                   /product="mCG7553"
FT                   /note="gene_id=mCG7553.2 transcript_id=mCT6471.1 created on
FT                   25-JUN-2002"
FT   CDS             join(8392294..8392310,8397967..8398007,8400650..8400771,
FT                   8403361..8403827,8404556..8404568)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7553"
FT                   /product="mCG7553"
FT                   /note="gene_id=mCG7553.2 transcript_id=mCT6471.1
FT                   protein_id=mCP15283.1"
FT                   /protein_id="EDL02303.1"
FT                   /translation="MSIPRFLKVTYGAYDNYIPVSELSKKSWNQQYFSLAFPKPPRPGK
FT                   KRRSLPSQLQNNTAPVIDEEKLGVHRPPLWMHRSLMRISERPSVYLAARKGLIPKPLHF
FT                   GKGESKSVGTHKSLASEKTKKEVKMKKDGFEAKEKTALKTDKEGSPKPAKKNIPRDSQK
FT                   DKGRVSSDSEGEKAGVKKGSKKVKNTPKGKDSASESEGEKAGSKKEAKVTKKGIQG"
FT   assembly_gap    8402888..8402907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8415116..8415649
FT                   /estimated_length=534
FT                   /gap_type="unknown"
FT   assembly_gap    8427710..8428227
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   assembly_gap    8434082..8434101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8472884..8472903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8488723..8488742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8489751..8497838
FT                   /estimated_length=8088
FT                   /gap_type="unknown"
FT   assembly_gap    8501375..8501394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8545102..8545121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8546318..8546337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8562489..8563961
FT                   /estimated_length=1473
FT                   /gap_type="unknown"
FT   assembly_gap    8616294..8616454
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    8618837..8618856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8662983..8663011
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    8744446..8744465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8767692..8767711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8768890..8768909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8772962..8772981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8779645..8779695
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    8784568..8784587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8789967..8789986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8816194..8816367
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    8823429..8828238
FT                   /estimated_length=4810
FT                   /gap_type="unknown"
FT   assembly_gap    8957576..8957595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8963904..8963923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8979499..8979518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8998463..8998572
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    9003264..9003283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9042005..9042024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9055875..9057347
FT                   /pseudo
FT                   /locus_tag="mCG_50758"
FT                   /note="gene_id=mCG50758.2"
FT   mRNA            9055875..9057347
FT                   /pseudo
FT                   /locus_tag="mCG_50758"
FT                   /note="gene_id=mCG50758.2 transcript_id=mCT50941.2 created
FT                   on 25-JUN-2002"
FT   assembly_gap    9058651..9058670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9059743..9059762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9069146..9069165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9085911..9086021
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    9102412..9102651
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    9116222..9116241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<9131404..9211290)
FT                   /locus_tag="mCG_140732"
FT                   /note="gene_id=mCG140732.0"
FT   mRNA            complement(join(<9131404..9131938,9195700..9195828,
FT                   9211187..9211290))
FT                   /locus_tag="mCG_140732"
FT                   /product="mCG140732"
FT                   /note="gene_id=mCG140732.0 transcript_id=mCT171112.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(<9131404..9131467)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140732"
FT                   /product="mCG140732"
FT                   /note="gene_id=mCG140732.0 transcript_id=mCT171112.0
FT                   protein_id=mCP94030.0"
FT                   /protein_id="EDL02302.1"
FT                   /translation="MDTYIHIYIHTYIYIYICVYI"
FT   assembly_gap    9135031..9135109
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    9136537..9136556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9175790..9175809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9188920..9189125
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    9225322..9227183
FT                   /estimated_length=1862
FT                   /gap_type="unknown"
FT   assembly_gap    9239303..9243550
FT                   /estimated_length=4248
FT                   /gap_type="unknown"
FT   assembly_gap    9263998..9264017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9284072..9284134
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    9342631..9342650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9366576..9366595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9382926..9382945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9388000..9388915
FT                   /estimated_length=916
FT                   /gap_type="unknown"
FT   gene            <9397501..9398134
FT                   /locus_tag="mCG_51838"
FT                   /note="gene_id=mCG51838.2"
FT   mRNA            <9397501..9398134
FT                   /locus_tag="mCG_51838"
FT                   /product="mCG51838"
FT                   /note="gene_id=mCG51838.2 transcript_id=mCT52021.2 created
FT                   on 25-JUN-2002"
FT   CDS             <9397503..9398129
FT                   /codon_start=1
FT                   /locus_tag="mCG_51838"
FT                   /product="mCG51838"
FT                   /note="gene_id=mCG51838.2 transcript_id=mCT52021.2
FT                   protein_id=mCP36152.2"
FT                   /protein_id="EDL02301.1"
FT                   /translation="GAQLEWHDPEAPLPQELAAASGYLVQPAGTQDLQVQGRAVKTPRH
FT                   ASSPIRPIVRCPTVRYHTKIRASRGFILEEFRVAGIHEKKACTIGISVDPRKRNKSTES
FT                   LQANVQHLKEYRSKLILFHRKPSASKKGDSSAEELKLATKLTGPVMPIRNVYKKEKARV
FT                   ITEEKKNIKAFASLQMARANAWLFGSKAKRAKEAAEQNVGKKKKK"
FT   gene            9398314..9398839
FT                   /pseudo
FT                   /locus_tag="mCG_1041289"
FT                   /note="gene_id=mCG1041289.1"
FT   mRNA            9398314..9398839
FT                   /pseudo
FT                   /locus_tag="mCG_1041289"
FT                   /note="gene_id=mCG1041289.1 transcript_id=mCT158993.1
FT                   created on 25-JUN-2002"
FT   assembly_gap    9400466..9400485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9409975..9409994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9438838..9438966
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    9446387..9448229
FT                   /estimated_length=1843
FT                   /gap_type="unknown"
FT   assembly_gap    9477777..9477796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9479023..9479675
FT                   /estimated_length=653
FT                   /gap_type="unknown"
FT   assembly_gap    9513068..9513087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9517639..9518984)
FT                   /pseudo
FT                   /locus_tag="mCG_50883"
FT                   /note="gene_id=mCG50883.1"
FT   mRNA            complement(9517639..9518984)
FT                   /pseudo
FT                   /locus_tag="mCG_50883"
FT                   /note="gene_id=mCG50883.1 transcript_id=mCT51066.2 created
FT                   on 25-JUN-2002"
FT   assembly_gap    9538713..9538732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9560466..9560485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9562709..9563456
FT                   /estimated_length=748
FT                   /gap_type="unknown"
FT   assembly_gap    9564190..9567227
FT                   /estimated_length=3038
FT                   /gap_type="unknown"
FT   assembly_gap    9586653..9586672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9587022..>9595628)
FT                   /locus_tag="mCG_1041367"
FT                   /note="gene_id=mCG1041367.1"
FT   mRNA            complement(join(9587022..9587323,9595341..>9595628))
FT                   /locus_tag="mCG_1041367"
FT                   /product="mCG1041367"
FT                   /note="gene_id=mCG1041367.1 transcript_id=mCT159071.1
FT                   created on 25-JUN-2002"
FT   assembly_gap    9588739..9588842
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   CDS             complement(9595351..>9595626)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041367"
FT                   /product="mCG1041367"
FT                   /note="gene_id=mCG1041367.1 transcript_id=mCT159071.1
FT                   protein_id=mCP53517.0"
FT                   /protein_id="EDL02300.1"
FT                   /translation="WLLSAGSAPSRSTLFAAGRGRGGPGRGRAGGPGTLRGYYRVETNT
FT                   SEKSPLRLHFLLIEEKGTGFENTNQNQFQFPEGTVGLQYVEFGGRC"
FT   gene            9595940..9644842
FT                   /gene="Smc2"
FT                   /locus_tag="mCG_5494"
FT                   /note="gene_id=mCG5494.2"
FT   mRNA            join(9595940..9596099,9596890..9597112,9598959..9599108,
FT                   9602655..9602777,9604416..9604454,9606024..9606134,
FT                   9606314..9606358,9607527..9607760,9607935..9608084,
FT                   9613864..9614097,9615017..9615176,9615623..9615740,
FT                   9616762..9616900,9617654..9617773,9619407..9619611,
FT                   9622537..9622672,9624394..9624518,9626376..9626569,
FT                   9627370..9627513,9631532..9631726,9633255..9633455,
FT                   9635007..9635123,9638255..9638415,9640625..9640772,
FT                   9643082..9644842)
FT                   /gene="Smc2"
FT                   /locus_tag="mCG_5494"
FT                   /product="structural maintenance of chromosomes 2"
FT                   /note="gene_id=mCG5494.2 transcript_id=mCT4693.2 created on
FT                   25-JUN-2002"
FT   CDS             join(9596945..9597112,9598959..9599108,9602655..9602777,
FT                   9604416..9604454,9606024..9606134,9606314..9606358,
FT                   9607527..9607760,9607935..9608084,9613864..9614097,
FT                   9615017..9615176,9615623..9615740,9616762..9616900,
FT                   9617654..9617773,9619407..9619611,9622537..9622672,
FT                   9624394..9624518,9626376..9626569,9627370..9627513,
FT                   9631532..9631726,9633255..9633455,9635007..9635123,
FT                   9638255..9638415,9640625..9640772,9643082..9643240)
FT                   /codon_start=1
FT                   /gene="Smc2"
FT                   /locus_tag="mCG_5494"
FT                   /product="structural maintenance of chromosomes 2"
FT                   /note="gene_id=mCG5494.2 transcript_id=mCT4693.2
FT                   protein_id=mCP15275.1"
FT                   /db_xref="GOA:Q8CG48"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027120"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:106067"
FT                   /db_xref="PDB:3L51"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CG48"
FT                   /protein_id="EDL02299.1"
FT                   /translation="MYVKSIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSI
FT                   CFLLGISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEAHDEITVT
FT                   RQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILS
FT                   MIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQK
FT                   VMREIEHLSRLYIAYQFLRAEDTKERSAGELKEMQDKIVNLQEVLSENEKKIKALNCEI
FT                   EELERRKDKETGGKLKSLEDACAEAQRVNTKSQSAFDLKKKNLASEETKRKELQNSMAE
FT                   DSKALAAKEKEVKKITDGLHGLQEASNKDAEALAAAQQHFNAVSAGLSSNEDGAEATLA
FT                   GQMIACKNDISKAQTEAKQAQMKLKHAQQELKSKQAEVKKMDSGYKKDQDAFEAVKKAK
FT                   EKLETEMKKLNYEENKEEKLLEKHRQLSRDINNLKGKHEALLAKFPNLQFAYKDPEKNW
FT                   NRNSVKGLVASLINVKDNSTATALEVVAGERLYNVVVDTEVTAKKLLEKGELKRRYTII
FT                   PLNKISARCIAPETLRVAQNLVGPDNVHVALSLVDYKPELQKGMEFVFGTTFVCNNMDN
FT                   AKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQEVKDVQDELRTKENE
FT                   LRALEEELAGLKNVAEKYRQLKQQWEMKTEEGDLLQTKLQQSSYHKQQEELDALKKTIE
FT                   ESEETLKSTKEIQKKAEEKYEALENKMKNAEAEREKELKDAQKKLDCAKTKADASSKKM
FT                   KEKQQEVEAITLELEELKREHASNEQQLDAVNEAIKAYEGQIEKMAAEVAKNKESVNKA
FT                   QDELMKQKQIITAQDNIIKDKCAEVAKHNLQNNESQLKIKELDHSISKHKREADDAAAK
FT                   VSKMLSDYDWINAEKHLFGQPNSAYDFKTNNPKEAGQRLQKLQEVKEKLGRNVNLRAMN
FT                   VLTEAEERYNDLMKKKRIVENDKSKILATIEDLDQKKNQALNIAWQKVNKDFGSIFSTL
FT                   LPGANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPA
FT                   PIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVS
FT                   TVARFTQSQAGKIPKEAKSRGKEPN"
FT   assembly_gap    9608799..9608818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9636195..9636214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9650765..9650848
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   gene            complement(9651793..9653851)
FT                   /locus_tag="mCG_49259"
FT                   /note="gene_id=mCG49259.1"
FT   mRNA            complement(9651793..9653851)
FT                   /locus_tag="mCG_49259"
FT                   /product="mCG49259"
FT                   /note="gene_id=mCG49259.1 transcript_id=mCT49442.2 created
FT                   on 19-JUN-2002"
FT   CDS             complement(9653471..9653776)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49259"
FT                   /product="mCG49259"
FT                   /note="gene_id=mCG49259.1 transcript_id=mCT49442.2
FT                   protein_id=mCP36172.1"
FT                   /protein_id="EDL02298.1"
FT                   /translation="MERLDKVALNALQPPEFRNENSLAATLKTLLFFTALMITVPIGLY
FT                   FTTKAYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYMAWNEGSRQWREGKQD"
FT   assembly_gap    9672130..9672452
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    9675180..9675199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9696822..9697182
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    9698132..9698759
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    9700320..9701430
FT                   /estimated_length=1111
FT                   /gap_type="unknown"
FT   assembly_gap    9707590..9707609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9730024..9732463
FT                   /estimated_length=2440
FT                   /gap_type="unknown"
FT   gene            9752098..9768287
FT                   /gene="4930547C10Rik"
FT                   /locus_tag="mCG_5669"
FT                   /note="gene_id=mCG5669.2"
FT   mRNA            join(9752098..9752161,9765686..9768287)
FT                   /gene="4930547C10Rik"
FT                   /locus_tag="mCG_5669"
FT                   /product="RIKEN cDNA 4930547C10, transcript variant
FT                   mCT4696"
FT                   /note="gene_id=mCG5669.2 transcript_id=mCT4696.2 created on
FT                   19-JUN-2002"
FT   assembly_gap    9756068..9757225
FT                   /estimated_length=1158
FT                   /gap_type="unknown"
FT   mRNA            join(9763092..9763200,9765698..9768287)
FT                   /gene="4930547C10Rik"
FT                   /locus_tag="mCG_5669"
FT                   /product="RIKEN cDNA 4930547C10, transcript variant
FT                   mCT170151"
FT                   /note="gene_id=mCG5669.2 transcript_id=mCT170151.0 created
FT                   on 19-JUN-2002"
FT   CDS             9765969..9768020
FT                   /codon_start=1
FT                   /gene="4930547C10Rik"
FT                   /locus_tag="mCG_5669"
FT                   /product="RIKEN cDNA 4930547C10, isoform CRA_a"
FT                   /note="gene_id=mCG5669.2 transcript_id=mCT170151.0
FT                   protein_id=mCP93093.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D2F8"
FT                   /db_xref="MGI:MGI:1915524"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D2F8"
FT                   /protein_id="EDL02296.1"
FT                   /translation="MAIELSSKCECPSCAEGSPSESDWNYSSGKRGDGASYSRLTKKST
FT                   ISPIMQRFLSQCCSNELGSTNKEDFTFLASEEESSVDFSQTQNLSQTSKKTRSLRELTI
FT                   QELLSKFGDNERLPPHSVSLSHFRDHVVVKFRRALYYSGIWVKYVQGSGLKRFFSAHYF
FT                   KRNPSSLHRLIPWLKRELTAICGDYGYTVKNILTAILHHMTKFNLNSEAFTHLLEPYLF
FT                   QYTQHFLHEFISFVDSSYNMETYDRNAIYQCPVSKSSKKKSTVSAPAFSFPQELSFMKS
FT                   QRGIKQSKKTWNKTGQSSDSGLKQFPKGHSSKNPQISTTHQKPANKRHVWTKDEWGSDD
FT                   FRGVVCTTNSLNWAYLRARRLDKEYYRNDNREKKSESTKLPPGHVQDLKSHETSPNIFR
FT                   ALVDSNQAPPKKYNIRETNVLDPGQQVHYQKKETERKKLEESSLKALQRLPKERILIKS
FT                   KSRESNHSCLCVSENSTSPTRNDKMLTSISKKMVRCSQSSQCVEVGSHHSRRTQRQYSP
FT                   RTPRSKSWCVRIRKQSMSRGQSNLSLRESHRSKHCALSKGSAHGCESTYRVASLSPVHH
FT                   DQVCLTAGKNCKCASMGEGESQTGGHCDSLSCLKTEKCHSPSKLGMKGKHLVGRVTRIR
FT                   THRRKKPKYQCVGTQTTAEFRDDLGDLEDKSQKGFLNSHPECVTSCRR"
FT   CDS             9765969..9768020
FT                   /codon_start=1
FT                   /gene="4930547C10Rik"
FT                   /locus_tag="mCG_5669"
FT                   /product="RIKEN cDNA 4930547C10, isoform CRA_a"
FT                   /note="gene_id=mCG5669.2 transcript_id=mCT4696.2
FT                   protein_id=mCP15274.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D2F8"
FT                   /db_xref="MGI:MGI:1915524"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D2F8"
FT                   /protein_id="EDL02297.1"
FT                   /translation="MAIELSSKCECPSCAEGSPSESDWNYSSGKRGDGASYSRLTKKST
FT                   ISPIMQRFLSQCCSNELGSTNKEDFTFLASEEESSVDFSQTQNLSQTSKKTRSLRELTI
FT                   QELLSKFGDNERLPPHSVSLSHFRDHVVVKFRRALYYSGIWVKYVQGSGLKRFFSAHYF
FT                   KRNPSSLHRLIPWLKRELTAICGDYGYTVKNILTAILHHMTKFNLNSEAFTHLLEPYLF
FT                   QYTQHFLHEFISFVDSSYNMETYDRNAIYQCPVSKSSKKKSTVSAPAFSFPQELSFMKS
FT                   QRGIKQSKKTWNKTGQSSDSGLKQFPKGHSSKNPQISTTHQKPANKRHVWTKDEWGSDD
FT                   FRGVVCTTNSLNWAYLRARRLDKEYYRNDNREKKSESTKLPPGHVQDLKSHETSPNIFR
FT                   ALVDSNQAPPKKYNIRETNVLDPGQQVHYQKKETERKKLEESSLKALQRLPKERILIKS
FT                   KSRESNHSCLCVSENSTSPTRNDKMLTSISKKMVRCSQSSQCVEVGSHHSRRTQRQYSP
FT                   RTPRSKSWCVRIRKQSMSRGQSNLSLRESHRSKHCALSKGSAHGCESTYRVASLSPVHH
FT                   DQVCLTAGKNCKCASMGEGESQTGGHCDSLSCLKTEKCHSPSKLGMKGKHLVGRVTRIR
FT                   THRRKKPKYQCVGTQTTAEFRDDLGDLEDKSQKGFLNSHPECVTSCRR"
FT   assembly_gap    9813569..9813588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9829993..9832936
FT                   /estimated_length=2944
FT                   /gap_type="unknown"
FT   assembly_gap    9834647..9835192
FT                   /estimated_length=546
FT                   /gap_type="unknown"
FT   assembly_gap    9837315..9837334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9912772..9912791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9936760..9936779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9961030..9961340
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    9971078..9971442
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   gene            <9972333..9986019
FT                   /locus_tag="mCG_140588"
FT                   /note="gene_id=mCG140588.0"
FT   mRNA            join(<9972333..9972462,9973095..9973157,9983410..9983512,
FT                   9985127..9986019)
FT                   /locus_tag="mCG_140588"
FT                   /product="mCG140588"
FT                   /note="gene_id=mCG140588.0 transcript_id=mCT170150.0
FT                   created on 18-JUN-2002"
FT   gene            9979203..9979864
FT                   /pseudo
FT                   /locus_tag="mCG_5320"
FT                   /note="gene_id=mCG5320.2"
FT   mRNA            9979203..9979864
FT                   /pseudo
FT                   /locus_tag="mCG_5320"
FT                   /note="gene_id=mCG5320.2 transcript_id=mCT4703.2 created on
FT                   18-JUN-2002"
FT   gene            <9983148..>9984107
FT                   /gene="Olfr275"
FT                   /locus_tag="mCG_140590"
FT                   /note="gene_id=mCG140590.0"
FT   mRNA            <9983148..>9984107
FT                   /gene="Olfr275"
FT                   /locus_tag="mCG_140590"
FT                   /product="olfactory receptor 275"
FT                   /note="gene_id=mCG140590.0 transcript_id=mCT170153.0
FT                   created on 18-JUN-2002"
FT   CDS             9983148..9984107
FT                   /codon_start=1
FT                   /gene="Olfr275"
FT                   /locus_tag="mCG_140590"
FT                   /product="olfactory receptor 275"
FT                   /note="gene_id=mCG140590.0 transcript_id=mCT170153.0
FT                   protein_id=mCP93097.0"
FT                   /db_xref="GOA:Q7TS18"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030109"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TS18"
FT                   /protein_id="EDL02295.1"
FT                   /translation="MVQGNWTSVTVFVFLGFSHYPRIEVTVFVLCLLMYLITLLGNTIL
FT                   ISITILDSHLHTPMYFFLSNLSFLDIWYTSSALTPMLANFVSGKNTISFSGCASQMYFS
FT                   LAMGSTECVLLSMMAYDRYVAICNPLRYPIIMNRRVCVQIAGSSWVTGCLTALVETGPV
FT                   IHLSLCGNSIINHFTCEILALLKLACGDTSMVQLIMLVISILLLPLPMLLICVSYASIL
FT                   SNILRISSMDGRSKAFSTCAAHLTVVVLFYGTALSMYLKPSSVNSQEIDKFMALIYTGL
FT                   TPMLNPIIYSLRNKEVKMAVKKLLMKNPFSAILTSVLK"
FT   CDS             <9985353..9985553
FT                   /codon_start=1
FT                   /locus_tag="mCG_140588"
FT                   /product="mCG140588"
FT                   /note="gene_id=mCG140588.0 transcript_id=mCT170150.0
FT                   protein_id=mCP93094.0"
FT                   /protein_id="EDL02294.1"
FT                   /translation="SHTEILTQNTEDLNKEKEEESNEGERERDRETEAGGRMRKGKGKG
FT                   KMKERSYYVRPIPEQDRTHKK"
FT   gene            complement(9999963..10000773)
FT                   /pseudo
FT                   /locus_tag="mCG_140589"
FT                   /note="gene_id=mCG140589.0"
FT   mRNA            complement(join(9999963..10000391,10000569..10000773))
FT                   /pseudo
FT                   /locus_tag="mCG_140589"
FT                   /note="gene_id=mCG140589.0 transcript_id=mCT170152.0
FT                   created on 18-JUN-2002"
FT   gene            complement(<10013298..>10014251)
FT                   /gene="Olfr273"
FT                   /locus_tag="mCG_54557"
FT                   /note="gene_id=mCG54557.2"
FT   mRNA            complement(<10013298..>10014251)
FT                   /gene="Olfr273"
FT                   /locus_tag="mCG_54557"
FT                   /product="olfactory receptor 273"
FT                   /note="gene_id=mCG54557.2 transcript_id=mCT54740.2 created
FT                   on 18-JUN-2002"
FT   CDS             complement(10013298..10014251)
FT                   /codon_start=1
FT                   /gene="Olfr273"
FT                   /locus_tag="mCG_54557"
FT                   /product="olfactory receptor 273"
FT                   /note="gene_id=mCG54557.2 transcript_id=mCT54740.2
FT                   protein_id=mCP36215.2"
FT                   /db_xref="GOA:Q8VG87"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030107"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VG87"
FT                   /protein_id="EDL02293.1"
FT                   /translation="MDKNNQTFVSEFLLLGLAGYPKTEIIYFVIVLVMYLVILTGNGVL
FT                   IIASIFDSRLHTPMYFFLGNLSFLDICYTTSSVPSTLVSLISKKRNISFSGCAVQMFFG
FT                   FAMGSTECLLLGMMAFDRYVAICNPLRYSIIMSKEVYVFMASASWFSGSINSVVQTSLA
FT                   MRLPFCGNNVINHFTCEVLAVLKLACADISLNIITMVISNMAFLVLPLLVIFFSYLFIL
FT                   HTILRMNSATGRRKAFSTCSAHLTVVIIFYGTIFSMYAKPKSQDLTGQDKFQTSDKIIS
FT                   LFYGVVTPMLNPIIYSLRNKDVKAAVKYILKQKYVP"
FT   assembly_gap    10037885..10037945
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    10038792..10039175
FT                   /estimated_length=384
FT                   /gap_type="unknown"
FT   assembly_gap    10040606..10040625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10046435..10046454
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10048061..10048080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10055602..10057684
FT                   /pseudo
FT                   /locus_tag="mCG_51759"
FT                   /note="gene_id=mCG51759.2"
FT   mRNA            join(10055602..10056201,10056653..10057684)
FT                   /pseudo
FT                   /locus_tag="mCG_51759"
FT                   /note="gene_id=mCG51759.2 transcript_id=mCT51942.2 created
FT                   on 18-JUN-2002"
FT   gene            complement(<10065837..>10066796)
FT                   /gene="Olfr272"
FT                   /locus_tag="mCG_56267"
FT                   /note="gene_id=mCG56267.2"
FT   mRNA            complement(<10065837..>10066796)
FT                   /gene="Olfr272"
FT                   /locus_tag="mCG_56267"
FT                   /product="olfactory receptor 272"
FT                   /note="gene_id=mCG56267.2 transcript_id=mCT56450.2 created
FT                   on 18-JUN-2002"
FT   CDS             complement(10065837..10066796)
FT                   /codon_start=1
FT                   /gene="Olfr272"
FT                   /locus_tag="mCG_56267"
FT                   /product="olfactory receptor 272"
FT                   /note="gene_id=mCG56267.2 transcript_id=mCT56450.2
FT                   protein_id=mCP36213.2"
FT                   /db_xref="GOA:Q8VGA0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030106"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGA0"
FT                   /protein_id="EDL02292.1"
FT                   /translation="MEMTNDSMLTEFLLVGLSDHPKLQTVLFVLVLCMYLMILLGNGVL
FT                   IAVVIHDIRLHTPMYFFLCNLSFLDICYTSSSVPLILSSFLTVRKRVSFSECMIQMFFS
FT                   FAMGATECVLLGTMALDRFMAICYPLRYPVIMSKDTYVPMAAGCWVAGLVDSVVQTSLA
FT                   VQLPFCTNNVIHHFVCEILGILELACADISINVISLTGSNLLFLAVPLLVIAVSYMFII
FT                   ATILRIPSAEGKRKAFSTCSAHLTVVIIFYGTIFSMYAKPKSKDTAGAGHQSVMEALIS
FT                   LFYGVMTPMLNPLIYSLRNKDVKAAVQNMLGRKTLSKM"
FT   assembly_gap    10070158..10070229
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   gene            complement(10090425..>10091407)
FT                   /locus_tag="mCG_56023"
FT                   /note="gene_id=mCG56023.3"
FT   mRNA            complement(10090425..>10091407)
FT                   /locus_tag="mCG_56023"
FT                   /product="mCG56023"
FT                   /note="gene_id=mCG56023.3 transcript_id=mCT56206.3 created
FT                   on 21-APR-2003"
FT   CDS             complement(10090456..>10091364)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56023"
FT                   /product="mCG56023"
FT                   /note="gene_id=mCG56023.3 transcript_id=mCT56206.3
FT                   protein_id=mCP36164.3"
FT                   /protein_id="EDL02291.1"
FT                   /translation="RGFLVTQALSISFFVVILMMYAVILVGNGTLIILSIFDSHLHTPM
FT                   YFFLGNLSFLDICFTTSSIPFTLVSFLSERKTISFLGCAVQMFLGLAMGTTECVLLGMM
FT                   AFDRYVAICNPLRYPLIMSKSSYVTMATGSWFSGVANSAVQTAFVMRLPFCGNVINHFL
FT                   CEILAVMKMACTDISGNEFIMLVATTLFTLMPLVLIVISYSLIISSILSIRSAEGRSKA
FT                   FSTCSAHFTVVIIFYGTILFMYMKPKSKDKFDADDLDATDKLISMFYGVMTPLMNPLIY
FT                   SLRNKDVKEAIKNLKGRLLGK"
FT   assembly_gap    10104389..10104476
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    10120125..10120838
FT                   /estimated_length=714
FT                   /gap_type="unknown"
FT   gene            <10125717..>10126640
FT                   /gene="Olfr270"
FT                   /locus_tag="mCG_54080"
FT                   /note="gene_id=mCG54080.2"
FT   mRNA            <10125717..>10126640
FT                   /gene="Olfr270"
FT                   /locus_tag="mCG_54080"
FT                   /product="olfactory receptor 270"
FT                   /note="gene_id=mCG54080.2 transcript_id=mCT54263.2 created
FT                   on 18-JUN-2002"
FT   CDS             10125717..>10126640
FT                   /codon_start=1
FT                   /gene="Olfr270"
FT                   /locus_tag="mCG_54080"
FT                   /product="olfactory receptor 270"
FT                   /note="gene_id=mCG54080.2 transcript_id=mCT54263.2
FT                   protein_id=mCP36165.1"
FT                   /protein_id="EDL02290.1"
FT                   /translation="MKMGNYSAVTEFFLVGLSQYPELQLFLFVLCLIMYLIILLGNSLL
FT                   IIISILDSRLHTPMYFFLGNLSFLDICYTSSSIPQMLIMFMSARKSISFLGCALQMVIS
FT                   LGLGSTECVLLAVMAYDRYAAICNPLRYPIIMNKVLYVHMAVWSWVIGCLNSLVQTVLT
FT                   MVLPFCGNNVIDHLTCEILALLKLVCSDITMNVLIMTVASIVLLMIPLMLIFVSYIFIL
FT                   SSILRINSAEGRKKAFSTCSAHLTVVILFYGSALFMYMKPKSKYTKASDEIIGLSYGVV
FT                   TPMLNPIIYSLRNKEVKEAVKKILSKR"
FT   gene            10144374..10158131
FT                   /locus_tag="mCG_117834"
FT                   /note="gene_id=mCG117834.1"
FT   mRNA            join(10144374..10144582,10149065..10149275,
FT                   10150909..10151067,10152247..10152396,10154543..10154629,
FT                   10157568..10157743,10158033..10158131)
FT                   /locus_tag="mCG_117834"
FT                   /product="mCG117834, transcript variant mCT118980"
FT                   /note="gene_id=mCG117834.1 transcript_id=mCT118980.1
FT                   created on 24-JUL-2002"
FT   mRNA            join(10144374..10144582,10149065..10149275,
FT                   10150909..10151067,10152247..10152396,10154543..10154629,
FT                   10154717..10154839)
FT                   /locus_tag="mCG_117834"
FT                   /product="mCG117834, transcript variant mCT119677"
FT                   /note="gene_id=mCG117834.1 transcript_id=mCT119677.1
FT                   created on 24-JUL-2002"
FT   CDS             join(10144529..10144582,10149065..10149275,
FT                   10150909..10151067,10152247..10152396,10154543..10154629,
FT                   10157568..10157644)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117834"
FT                   /product="mCG117834, isoform CRA_a"
FT                   /note="gene_id=mCG117834.1 transcript_id=mCT118980.1
FT                   protein_id=mCP53483.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3X8S9"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="MGI:MGI:1920648"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8S9"
FT                   /protein_id="EDL02288.1"
FT                   /translation="MLALRGSLRRLSQALVHQVCSPFTTGHRQQEGTFYEFCTYYLKPA
FT                   SVEEFLYNFKKNVHLRTAHSELVGYWTVGFGGRINTVFHIWKYDNFAHRAAVYKALAKD
FT                   EDWQEQFLIPNLPLIDKQESEITYLVPWCKIGKPPKEGVYELATFLMKPGGPALWGEAF
FT                   QRAVNAHADQGYIKLIGVFHAEYGLLNRVHVLWWCENADARAAGRRQAHEDPRVVSAVR
FT                   ESVNYLDVQQNMFLIPWSFSPLK"
FT   CDS             join(10144529..10144582,10149065..10149275,
FT                   10150909..10151067,10152247..10152396,10154543..10154629,
FT                   10154717..10154793)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117834"
FT                   /product="mCG117834, isoform CRA_b"
FT                   /note="gene_id=mCG117834.1 transcript_id=mCT119677.1
FT                   protein_id=mCP53374.1 isoform=CRA_b"
FT                   /db_xref="GOA:G3X8S9"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="MGI:MGI:1920648"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8S9"
FT                   /protein_id="EDL02289.1"
FT                   /translation="MLALRGSLRRLSQALVHQVCSPFTTGHRQQEGTFYEFCTYYLKPA
FT                   SVEEFLYNFKKNVHLRTAHSELVGYWTVGFGGRINTVFHIWKYDNFAHRAAVYKALAKD
FT                   EDWQEQFLIPNLPLIDKQESEITYLVPWCKIGKPPKEGVYELATFLMKPGGPALWGEAF
FT                   QRAVNAHADQGYIKLIGVFHAEYGLLNRVHVLWWCENADARAAGRRQAHEDPRVVSAVR
FT                   ESVNYLDVQQNMFLIPWSFSPLK"
FT   assembly_gap    10154874..10154893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10156632..10156651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10169206..10181159
FT                   /gene="Nipsnap3a"
FT                   /locus_tag="mCG_2744"
FT                   /note="gene_id=mCG2744.1"
FT   mRNA            join(10169206..10169329,10172294..10172504,
FT                   10176149..10176307,10179282..10179431,10180211..10180297,
FT                   10180384..10181159)
FT                   /gene="Nipsnap3a"
FT                   /locus_tag="mCG_2744"
FT                   /product="nipsnap homolog 3A (C. elegans)"
FT                   /note="gene_id=mCG2744.1 transcript_id=mCT1838.1 created on
FT                   18-JUN-2002"
FT   CDS             join(10169270..10169329,10172294..10172504,
FT                   10176149..10176307,10179282..10179431,10180211..10180297,
FT                   10180384..10180460)
FT                   /codon_start=1
FT                   /gene="Nipsnap3a"
FT                   /locus_tag="mCG_2744"
FT                   /product="nipsnap homolog 3A (C. elegans)"
FT                   /note="gene_id=mCG2744.1 transcript_id=mCT1838.1
FT                   protein_id=mCP15232.2"
FT                   /db_xref="GOA:Q9CQE1"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="MGI:MGI:1913786"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CQE1"
FT                   /protein_id="EDL02287.1"
FT                   /translation="MLALRSGLRTALAPRVLTPQVCSPFATGPRQSNGTFYEFRTYFLK
FT                   PSKTNEFLENFKNSVHLRTAHSEMIGYWTVEFGGRTNRVFHIWKYDNFAHRTAVRKALA
FT                   KDKEWQERFLIPNLAFIDKQEVEITYLVPWCKIGTPPKEGVYELATFQMKPGGPALWGN
FT                   AFKRAVNAHVELGYSTLVGVFHTEYGALNRVHVLWWNESADSRAAGRHWSHEDPRVVAA
FT                   VRESVSYLESQQNTFLIPTSFSPLK"
FT   assembly_gap    10172602..10174077
FT                   /estimated_length=1476
FT                   /gap_type="unknown"
FT   gene            complement(10192036..>10313306)
FT                   /gene="Abca1"
FT                   /locus_tag="mCG_2743"
FT                   /note="gene_id=mCG2743.2"
FT   mRNA            complement(join(10192036..10193183,10194437..10194680,
FT                   10195362..10195454,10195973..10196076,10197257..10197391,
FT                   10197719..10197860,10199819..10199925,10200639..10200701,
FT                   10201414..10201534,10201764..10201893,10204493..10204616,
FT                   10206153..10206297,10206408..10206523,10209334..10209511,
FT                   10210667..10210836,10211313..10211387,10212741..10212846,
FT                   10213817..10213849,10214971..10215065,10215874..10216063,
FT                   10219385..10219483,10220515..10220639,10222171..10222319,
FT                   10223276..10223389,10223560..10223608,10225307..10225509,
FT                   10226382..10226454,10227704..10227924,10228615..10228752,
FT                   10228931..10229073,10230375..10230506,10231427..10231598,
FT                   10233055..10233168,10234250..10234454,10235406..10235627,
FT                   10237201..10237423,10237868..10238044,10238580..10238785,
FT                   10239477..10239674,10243283..10243399,10243738..10243877,
FT                   10246213..10246453,10249069..10249161,10260488..10260664,
FT                   10262646..10262767,10281043..10281161,10282167..10282308,
FT                   10286368..10286461,10297345..10297493,10313086..10313306))
FT                   /gene="Abca1"
FT                   /locus_tag="mCG_2743"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   1, transcript variant mCT1837"
FT                   /note="gene_id=mCG2743.2 transcript_id=mCT1837.2 created on
FT                   18-JUN-2002"
FT   CDS             complement(join(10193043..10193183,10194437..10194680,
FT                   10195362..10195454,10195973..10196076,10197257..10197391,
FT                   10197719..10197860,10199819..10199925,10200639..10200701,
FT                   10201414..10201534,10201764..10201893,10204493..10204616,
FT                   10206153..10206297,10206408..10206523,10209334..10209511,
FT                   10210667..10210836,10211313..10211387,10212741..10212846,
FT                   10213817..10213849,10214971..10215065,10215874..10216063,
FT                   10219385..10219483,10220515..10220639,10222171..10222319,
FT                   10223276..10223389,10223560..10223608,10225307..10225509,
FT                   10226382..10226454,10227704..10227924,10228615..10228752,
FT                   10228931..10229073,10230375..10230506,10231427..10231598,
FT                   10233055..10233168,10234250..10234454,10235406..10235627,
FT                   10237201..10237423,10237868..10238044,10238580..10238785,
FT                   10239477..10239674,10243283..10243399,10243738..10243877,
FT                   10246213..10246453,10249069..10249161,10260488..10260664,
FT                   10262646..10262767,10281043..10281161,10282167..10282308,
FT                   10286368..10286461,10297345..10297410))
FT                   /codon_start=1
FT                   /gene="Abca1"
FT                   /locus_tag="mCG_2743"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG2743.2 transcript_id=mCT1837.2
FT                   protein_id=mCP15265.2 isoform=CRA_a"
FT                   /db_xref="GOA:P41233"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR026082"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:99607"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41233"
FT                   /protein_id="EDL02285.1"
FT                   /translation="MACWPQLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLS
FT                   YPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCFRYPTPGEAPGVVGNFNKSIVSR
FT                   LFSDAQRLLLYSQRDTSIKDMHKVLRMLRQIKHPNSNLKLQDFLVDNETFSGFLQHNLS
FT                   LPRSTVDSLLQANVGLQKVFLQGYQLHLASLCNGSKLEEIIQLGDAEVSALCGLPRKKL
FT                   DAAERVLRYNMDILKPVVTKLNSTSHLPTQHLAEATTVLLDSLGGLAQELFSTKSWSDM
FT                   RQEVMFLTNVNSSSSSTQIYQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNNTE
FT                   EDVDTFYDNSTTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEV
FT                   NKTFQELAVFHDLEGMWEELSPQIWTFMENSQEMDLVRTLLDSRGNDQFWEQKLDGLDW
FT                   TAQDIMAFLAKNPEDVQSPNGSVYTWREAFNETNQAIQTISRFMECVNLNKLEPIPTEV
FT                   RLINKSMELLDERKFWAGIVFTGITPDSVELPHHVKYKIRMDIDNVERTNKIKDGYWDP
FT                   GPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGSEKKTGVYVQQMPYPCYVDDIFLRV
FT                   MSRSMPLFMTLAWIYSVAVIIKSIVYEKEARLKETMRIMGLDNGILWFSWFVSSLIPLL
FT                   VSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAMVTILQCFLISTLFSRANLAAACGGII
FT                   YFTLYLPYVLCVAWQDYVGFSIKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFES
FT                   PVEEDGFNLTTAVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWFGEEID
FT                   EKSHPGSSQKGVSEICMEEEPTHLRLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITS
FT                   FLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSSIRQNLGVCPQHNVLFDMLT
FT                   VEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSKLKSKTSQLSGGMQRKLSVALAFV
FT                   GGSKVVILDEPTAGVDPYSRRGIWELLLKYRQGRTIILSTHHMDEADILGDRIAIISHG
FT                   KLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAG
FT                   LGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEI
FT                   DDRLSDLGISSYGISETTLEEIFLKVAEESGVDAETSDGTLPARRNRRAFGDKQSCLHP
FT                   FTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRS
FT                   RKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQYTFVSNDAPEDMGTQ
FT                   ELLNALTKDPGFGTRCMEGNPIPDTPCLAGEEDWTISPVPQSIVDLFQNGNWTMKNPSP
FT                   ACQCSSDKIKKMLPVCPPGAGGLPPPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKS
FT                   LKNKIWVNEFRYGGFSLGVSNSQALPPSHEVNDAIKQMKKLLKLTKDSSADRFLSSLGR
FT                   FMAGLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQKGENPSQYGITAFNHPLNL
FT                   TKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVI
FT                   YWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPA
FT                   SFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNNKLNDINDILKSVFLIFPHFCL
FT                   GRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRF
FT                   FIRPRPVKAKLPPLNDEDEDVRRERQRILDGGGQNDILEIKELTKIYRRKRKPAVDRIC
FT                   IGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSNIHEVHQNMGYCP
FT                   QFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYASNYSGGNKR
FT                   KLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGRSVVLTSHSMEECEAL
FT                   CTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQEFFGLAFPGSVLK
FT                   EKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQSDDD
FT                   HLKDLSLHKNQTVVDVAVLTSFLQDEKVKESYV"
FT   assembly_gap    10202539..10202558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10212556..10212575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(<10215876..10216063,10219385..10219483,
FT                   10220515..10220639,10222171..10222319,10223276..10223389,
FT                   10223560..10223608,10225307..10225509,10226382..10226454,
FT                   10227704..10227924,10228615..10228752,10228931..10229073,
FT                   10230375..10230506,10231427..10231598,10233055..10233168,
FT                   10234250..10234454,10235406..10235627,10237201..10237423,
FT                   10237868..10238044,10238580..10238785,10239477..10239674,
FT                   10243283..10243399,10243738..10243877,10246213..10246453,
FT                   10249069..10249161,10260488..10260664,10262646..10262767,
FT                   10281043..10281161,10282167..10282308,10286368..10286461,
FT                   10297345..10297510,10313086..>10313306))
FT                   /gene="Abca1"
FT                   /locus_tag="mCG_2743"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   1, transcript variant mCT189513"
FT                   /note="gene_id=mCG2743.2 transcript_id=mCT189513.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<10215876..10216063,10219385..10219483,
FT                   10220515..10220639,10222171..10222319,10223276..10223389,
FT                   10223560..10223608,10225307..10225509,10226382..10226454,
FT                   10227704..10227924,10228615..10228752,10228931..10229073,
FT                   10230375..10230506,10231427..10231598,10233055..10233168,
FT                   10234250..10234454,10235406..10235627,10237201..10237423,
FT                   10237868..10238044,10238580..10238785,10239477..10239674,
FT                   10243283..10243399,10243738..10243877,10246213..10246453,
FT                   10249069..10249161,10260488..10260664,10262646..10262767,
FT                   10281043..10281161,10282167..10282308,10286368..10286461,
FT                   10297345..>10297503))
FT                   /codon_start=1
FT                   /gene="Abca1"
FT                   /locus_tag="mCG_2743"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG2743.2 transcript_id=mCT189513.0
FT                   protein_id=mCP110510.0 isoform=CRA_b"
FT                   /protein_id="EDL02286.1"
FT                   /translation="PATESQLCALAAPSRALEPQTQVAVGAGCGDMACWPQLRLLLWKN
FT                   LTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGI
FT                   ICNANNPCFRYPTPGEAPGVVGNFNKSIVSRLFSDAQRLLLYSQRDTSIKDMHKVLRML
FT                   RQIKHPNSNLKLQDFLVDNETFSGFLQHNLSLPRSTVDSLLQANVGLQKVFLQGYQLHL
FT                   ASLCNGSKLEEIIQLGDAEVSALCGLPRKKLDAAERVLRYNMDILKPVVTKLNSTSHLP
FT                   TQHLAEATTVLLDSLGGLAQELFSTKSWSDMRQEVMFLTNVNSSSSSTQIYQAVSRIVC
FT                   GHPEGGGLKIKSLNWYEDNNYKALFGGNNTEEDVDTFYDNSTTPYCNDLMKNLESSPLS
FT                   RIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPQIWTFM
FT                   ENSQEMDLVRTLLDSRGNDQFWEQKLDGLDWTAQDIMAFLAKNPEDVQSPNGSVYTWRE
FT                   AFNETNQAIQTISRFMECVNLNKLEPIPTEVRLINKSMELLDERKFWAGIVFTGITPDS
FT                   VELPHHVKYKIRMDIDNVERTNKIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAI
FT                   IRVLTGSEKKTGVYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKSIVYEK
FT                   EARLKETMRIMGLDNGILWFSWFVSSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFL
FT                   SVFAMVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFSIKIFASL
FT                   LSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTAVSMMLFDTFLYGVMTW
FT                   YIEAVFPGQYGIPRPWYFPCTKSYWFGEEIDEKSHPGSSQKGVSEICMEEEPTHLRLGV
FT                   SIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAY
FT                   ILGKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMAL
FT                   DVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLL
FT                   KYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDV
FT                   ESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEA
FT                   RLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAE
FT                   ESGVDAETSDGTLPARRNRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMD
FT                   GKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPF
FT                   GKYPSLELQPWMYNEQYTFVSNDAPEDMGTQELLNALTKDPGFGTRCMEGNPIPDTPCL
FT                   AGEEDWTISPVPQSIVDLFQNGNWTMKNPSPACQCSSDKIKKMLPVCPPGAGGLPPP"
FT   assembly_gap    10269327..10269696
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    10317467..10317486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10354261..10354824
FT                   /estimated_length=564
FT                   /gap_type="unknown"
FT   gene            complement(10358479..10371315)
FT                   /locus_tag="mCG_118534"
FT                   /note="gene_id=mCG118534.1"
FT   mRNA            complement(join(10358479..10358712,10360380..10360594,
FT                   10360684..10360880,10362717..10362938,10368243..10368336,
FT                   10368414..10368446,10369253..10369289,10371104..10371315))
FT                   /locus_tag="mCG_118534"
FT                   /product="mCG118534"
FT                   /note="gene_id=mCG118534.1 transcript_id=mCT119679.1
FT                   created on 18-JUN-2002"
FT   CDS             complement(join(10360466..10360594,10360684..10360761))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118534"
FT                   /product="mCG118534"
FT                   /note="gene_id=mCG118534.1 transcript_id=mCT119679.1
FT                   protein_id=mCP53375.1"
FT                   /protein_id="EDL02284.1"
FT                   /translation="MQPFPGGSHWREPMMEGLGEAEQAAMSLMKMRKPGRNTDNTLKDM
FT                   LNLAQWIGRVNLYHHLLENAFDQ"
FT   assembly_gap    10364199..10364218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10368502..10368521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10380449..10380468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <10399829..10404756
FT                   /locus_tag="mCG_145868"
FT                   /note="gene_id=mCG145868.0"
FT   mRNA            join(<10399829..10400044,10401022..10401156,
FT                   10404659..10404756)
FT                   /locus_tag="mCG_145868"
FT                   /product="mCG145868"
FT                   /note="gene_id=mCG145868.0 transcript_id=mCT185976.0
FT                   created on 03-JUL-2003"
FT   CDS             join(<10399981..10400044,10401022..10401156,
FT                   10404659..10404690)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145868"
FT                   /product="mCG145868"
FT                   /note="gene_id=mCG145868.0 transcript_id=mCT185976.0
FT                   protein_id=mCP107304.0"
FT                   /protein_id="EDL02283.1"
FT                   /translation="KIMLNGVFSMSESVSASSWATAKDVLKRKQLNNSFSNNELWSNLK
FT                   SKTKERNHSSQRKGKGLQAIPGVMMVWPLLL"
FT   assembly_gap    10411827..10411875
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   gene            complement(<10416524..>10424045)
FT                   /locus_tag="mCG_1041362"
FT                   /note="gene_id=mCG1041362.1"
FT   mRNA            complement(join(<10416524..10416897,10423897..>10424045))
FT                   /locus_tag="mCG_1041362"
FT                   /product="mCG1041362"
FT                   /note="gene_id=mCG1041362.1 transcript_id=mCT159066.1
FT                   created on 18-JUN-2002"
FT   CDS             complement(<10416524..>10416807)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041362"
FT                   /product="mCG1041362"
FT                   /note="gene_id=mCG1041362.1 transcript_id=mCT159066.1
FT                   protein_id=mCP53370.1"
FT                   /protein_id="EDL02282.1"
FT                   /translation="NVEVSSASCLPGVSKAAVLTLWVETLRGVASQMISCSQRSCTSET
FT                   LHIRDPAHQRSCTSDILQSEILHIRDPAIRDPAIRDPAHQRSCNQRSCN"
FT   assembly_gap    10423005..10423222
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    10440484..10440851
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    10455951..10456002
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    10460637..10460797
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   gene            10462358..10462792
FT                   /pseudo
FT                   /locus_tag="mCG_1041283"
FT                   /note="gene_id=mCG1041283.1"
FT   mRNA            10462358..10462792
FT                   /pseudo
FT                   /locus_tag="mCG_1041283"
FT                   /note="gene_id=mCG1041283.1 transcript_id=mCT158987.1
FT                   created on 18-JUN-2002"
FT   assembly_gap    10476559..10476578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10478870..10479043
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    10483067..10483086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10486378..10487082
FT                   /estimated_length=705
FT                   /gap_type="unknown"
FT   assembly_gap    10488162..10488399
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    10514615..10514634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10517995..10518014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10522265..10522847
FT                   /estimated_length=583
FT                   /gap_type="unknown"
FT   assembly_gap    10531048..10531067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10533967..10539960
FT                   /estimated_length=5994
FT                   /gap_type="unknown"
FT   assembly_gap    10540798..10541076
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    10563201..10563220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10569443..10569462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10571481..10571500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10587700..10588190
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   gene            <10628686..10763696
FT                   /gene="Slc44a1"
FT                   /locus_tag="mCG_2739"
FT                   /note="gene_id=mCG2739.2"
FT   mRNA            join(<10628686..10628776,10638618..10638760,
FT                   10665117..10665253,10676228..10676321,10683897..10684066,
FT                   10685964..10686053,10688875..10689014,10689938..10690124,
FT                   10691115..10691280,10692114..10692270,10693259..10693342,
FT                   10701059..10701196,10708487..10708723,10710713..10710793,
FT                   10762813..10763696)
FT                   /gene="Slc44a1"
FT                   /locus_tag="mCG_2739"
FT                   /product="solute carrier family 44, member 1"
FT                   /note="gene_id=mCG2739.2 transcript_id=mCT1840.2 created on
FT                   20-AUG-2002"
FT   CDS             join(<10628687..10628776,10638618..10638760,
FT                   10665117..10665253,10676228..10676321,10683897..10684066,
FT                   10685964..10686053,10688875..10689014,10689938..10690124,
FT                   10691115..10691280,10692114..10692270,10693259..10693342,
FT                   10701059..10701196,10708487..10708723,10710713..10710793,
FT                   10762813..10762827)
FT                   /codon_start=1
FT                   /gene="Slc44a1"
FT                   /locus_tag="mCG_2739"
FT                   /product="solute carrier family 44, member 1"
FT                   /note="gene_id=mCG2739.2 transcript_id=mCT1840.2
FT                   protein_id=mCP15263.2"
FT                   /protein_id="EDL02281.1"
FT                   /translation="SSKREWKPLEDRSCTDIPWLLLFVLFCIGMGFICGFSVATGAAAR
FT                   LVSGYDSYGNICGQRNAKLEAIPNSGLDHTHRKYVFFLDPCNLDLINRKIKSIALCVAA
FT                   CPRQELKTLSDVQKFAEINGSALCSYNIKPSEYTLTSKSSGFCPKLPVPASAPIPFFHR
FT                   CAPVNISCYAKFAEALITFVSDNSVLHRLISGVMTSKEIILGLCLLSLVLSMILMVIIR
FT                   YISRVLVWILTVLVILGSLGGTGVLWWLYAKQRRSPKEAVIPEQLQIAEDNLRALLIYA
FT                   ISATVFTVILFLIMLVMRKRVALTIALFHVAGKVFIHLPLLVFQPFWTFFALVLFWAYW
FT                   IMTLLFLGTTGSAVQNEQGFVEYKISGPLQYMWWYHVVGLIWISEFILACQQMTVAGAV
FT                   VTYYFTRDKRNLPFTPILASVNRLIRYHLGTVAKGSFIITLVKIPRMVLMYIHSQLKGK
FT                   ENACARCMLKSCICCLWCLEKCLSYLNQNAYTATAINSTNFCTSAKDAFVILVENALRV
FT                   AAINTVGDFMLFLGKVLIVCSTGLAGIMLLNYQQDYTVWVLPLIIVCLFAFLVAHCFLS
FT                   IYEMVVDVLFLCFAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGAADAREL
FT                   KPMLRKR"
FT   assembly_gap    10641928..10641947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10652198..10652217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10747691..10748300
FT                   /estimated_length=610
FT                   /gap_type="unknown"
FT   assembly_gap    10749178..10749999
FT                   /estimated_length=822
FT                   /gap_type="unknown"
FT   assembly_gap    10753670..10753689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10772725..10800959
FT                   /locus_tag="mCG_142769"
FT                   /note="gene_id=mCG142769.0"
FT   mRNA            join(10772725..10772836,10788212..10788307,
FT                   10788895..10789026,10791017..10793013)
FT                   /locus_tag="mCG_142769"
FT                   /product="mCG142769, transcript variant mCT182143"
FT                   /note="gene_id=mCG142769.0 transcript_id=mCT182143.0
FT                   created on 13-MAY-2003"
FT   CDS             join(10772822..10772836,10788212..10788307,
FT                   10788895..10789026,10791017..10791169)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142769"
FT                   /product="mCG142769, isoform CRA_b"
FT                   /note="gene_id=mCG142769.0 transcript_id=mCT182143.0
FT                   protein_id=mCP105062.0 isoform=CRA_b"
FT                   /db_xref="GOA:A1L3T0"
FT                   /db_xref="InterPro:IPR003649"
FT                   /db_xref="MGI:MGI:2442443"
FT                   /db_xref="UniProtKB/TrEMBL:A1L3T0"
FT                   /protein_id="EDL02280.1"
FT                   /translation="MDSQKEALQRIISTLANKSDEIQNFIDTLNHTLKGVQENSSNILS
FT                   ELDEEFDSLYSILDDVKESMISTIKQEQVRKSQELQSQLSQCNNALENSEELLEFATRS
FT                   LDIKEPEEFSKVNKTKSKRTDKSKTQF"
FT   mRNA            join(<10772940..10773124,10788212..10788307,
FT                   10788895..10789026,10791017..10791118,10796964..10796986,
FT                   10800736..10800959)
FT                   /locus_tag="mCG_142769"
FT                   /product="mCG142769, transcript variant mCT182142"
FT                   /note="gene_id=mCG142769.0 transcript_id=mCT182142.0
FT                   created on 13-MAY-2003"
FT   CDS             join(<10772957..10773124,10788212..10788307,
FT                   10788895..10789026,10791017..10791118,10796964..10796986,
FT                   10800736..10800916)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142769"
FT                   /product="mCG142769, isoform CRA_a"
FT                   /note="gene_id=mCG142769.0 transcript_id=mCT182142.0
FT                   protein_id=mCP105061.0 isoform=CRA_a"
FT                   /protein_id="EDL02279.1"
FT                   /translation="EPAGSDGRARDPGRPLSCSWLREGTAGRKPRAAPGSLPPSAGARP
FT                   LSSRCPRRAPREALQRIISTLANKSDEIQNFIDTLNHTLKGVQENSSNILSELDEEFDS
FT                   LYSILDDVKESMISTIKQEQVRKSQELQSQLSQCNNALENSEELLEFATRSLDIKEPEE
FT                   FSKAARQIKDRVTMASAFRLSLKPKVSDNMTHLMVDFSQERQMLQTLKFLPGKCIVTWE
FT                   LSNKKSCKSFL"
FT   gene            10803632..10805111
FT                   /pseudo
FT                   /locus_tag="mCG_140591"
FT                   /note="gene_id=mCG140591.0"
FT   mRNA            10803632..10805111
FT                   /pseudo
FT                   /locus_tag="mCG_140591"
FT                   /note="gene_id=mCG140591.0 transcript_id=mCT170154.0
FT                   created on 13-MAY-2003"
FT   assembly_gap    10810291..10813155
FT                   /estimated_length=2865
FT                   /gap_type="unknown"
FT   gene            10819412..10838657
FT                   /locus_tag="mCG_142768"
FT                   /note="gene_id=mCG142768.0"
FT   mRNA            join(10819412..10819464,10823654..10823783,
FT                   10831250..10831350,10831874..10832125,10834156..10834244,
FT                   10838307..10838657)
FT                   /locus_tag="mCG_142768"
FT                   /product="mCG142768"
FT                   /note="gene_id=mCG142768.0 transcript_id=mCT182141.0
FT                   created on 13-MAY-2003"
FT   CDS             join(10834242..10834244,10838307..10838429)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142768"
FT                   /product="mCG142768"
FT                   /note="gene_id=mCG142768.0 transcript_id=mCT182141.0
FT                   protein_id=mCP105063.0"
FT                   /protein_id="EDL02278.1"
FT                   /translation="MVWCGGLSLSTGMQVPSAVRTLQKSENGMTGSTSSLNNVTQ"
FT   gene            complement(10843936..>10844278)
FT                   /locus_tag="mCG_1041282"
FT                   /note="gene_id=mCG1041282.1"
FT   mRNA            complement(join(10843936..10844096,10844140..>10844278))
FT                   /locus_tag="mCG_1041282"
FT                   /product="mCG1041282"
FT                   /note="gene_id=mCG1041282.1 transcript_id=mCT158986.1
FT                   created on 25-JUN-2002"
FT   CDS             complement(10844142..>10844276)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041282"
FT                   /product="mCG1041282"
FT                   /note="gene_id=mCG1041282.1 transcript_id=mCT158986.1
FT                   protein_id=mCP53398.1"
FT                   /protein_id="EDL02277.1"
FT                   /translation="RKQKKSLIFKRDNTGAFVKISSGTFHTEHTIISTYKLLHFEQPL"
FT   gene            complement(10846645..10847202)
FT                   /locus_tag="mCG_1041360"
FT                   /note="gene_id=mCG1041360.1"
FT   mRNA            complement(join(10846645..10847159,10847173..10847202))
FT                   /locus_tag="mCG_1041360"
FT                   /product="mCG1041360"
FT                   /note="gene_id=mCG1041360.1 transcript_id=mCT159064.1
FT                   created on 18-JUN-2002"
FT   CDS             complement(10846843..10847076)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041360"
FT                   /product="mCG1041360"
FT                   /note="gene_id=mCG1041360.1 transcript_id=mCT159064.1
FT                   protein_id=mCP53364.1"
FT                   /protein_id="EDL02276.1"
FT                   /translation="MDRLVYCYYSTLLELGTPQTGLEYVLTFCFLELILHKQQKMFTAE
FT                   SLCCFLLEGSEDQEGHLHLITTHYWEANELLK"
FT   gene            10851265..10900224
FT                   /gene="Fcmd"
FT                   /locus_tag="mCG_2740"
FT                   /note="gene_id=mCG2740.2"
FT   mRNA            join(10851265..10851462,10857275..10857477,
FT                   10867252..10867311,10868404..10868607,10872122..10872399,
FT                   10874799..10874931,10881891..10882020,10884281..10884414,
FT                   10885642..10885769,10898443..10900224)
FT                   /gene="Fcmd"
FT                   /locus_tag="mCG_2740"
FT                   /product="Fukuyama type congenital muscular dystrophy
FT                   homolog (human), transcript variant mCT1844"
FT                   /note="gene_id=mCG2740.2 transcript_id=mCT1844.2 created on
FT                   18-JUN-2002"
FT   mRNA            join(<10851429..10851462,10857275..10857477,
FT                   10861873..10862010,10867252..10867311,10868404..10868607,
FT                   10872122..10872399,10874799..10874931,10879768..10880042,
FT                   10881894..10882020,10884281..10884414,10885642..10885769,
FT                   10898443..10900056)
FT                   /gene="Fcmd"
FT                   /locus_tag="mCG_2740"
FT                   /product="Fukuyama type congenital muscular dystrophy
FT                   homolog (human), transcript variant mCT189510"
FT                   /note="gene_id=mCG2740.2 transcript_id=mCT189510.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(10857373..10857477,10867252..10867311,
FT                   10868404..10868607,10872122..10872399,10874799..10874931,
FT                   10881891..10882020,10884281..10884414,10885642..10885769,
FT                   10898443..10898656)
FT                   /codon_start=1
FT                   /gene="Fcmd"
FT                   /locus_tag="mCG_2740"
FT                   /product="Fukuyama type congenital muscular dystrophy
FT                   homolog (human), isoform CRA_a"
FT                   /note="gene_id=mCG2740.2 transcript_id=mCT1844.2
FT                   protein_id=mCP15248.2 isoform=CRA_a"
FT                   /protein_id="EDL02274.1"
FT                   /translation="MSRINKNVVLALLTLTSSAFLLFQLYYYKHYLSARNGPGSSKSKG
FT                   NRVGFDSTQWRAVKKFIMLTSSQNVPVFLIDPWILESINKNFEQVKNASQGPASECRFF
FT                   CVPRDFTAFALQYHLWKNEDGWFRIAENMGFQCLKTESKDPRLDGIDSLSGTEIPLHYV
FT                   CKLTTHAIHLVVFHERSGNYLWHGHLRLKGHMDRKFVPFRKLQFGRYPGAFDRPELQQV
FT                   TVDGLDMLIPKDPGRFLEEVPHSRFIECRYKEARAFLQQYIDDNTVDAMVFRKRAKELL
FT                   QLAAKTLKDLGVPFWLSSGTCLGWYRQCGIIPYSKDVDLGIFIQDYKPDIILAFQEAGL
FT                   PLKHKFGKVEDSLELSFQGKNDVKLDIFFFYEEADHLWNGGTQARTGKKFKYLFPKFTL
FT                   CWTEFVDIKVHVPCETVDYIEANYGKTWKIPIKTWDWKSSPPNVQPNGIWPISEWDEVI
FT                   QLY"
FT   CDS             join(<10862002..10862010,10867252..10867311,
FT                   10868404..10868607,10872122..10872399,10874799..10874931,
FT                   10879768..10879995)
FT                   /codon_start=1
FT                   /gene="Fcmd"
FT                   /locus_tag="mCG_2740"
FT                   /product="Fukuyama type congenital muscular dystrophy
FT                   homolog (human), isoform CRA_b"
FT                   /note="gene_id=mCG2740.2 transcript_id=mCT189510.0
FT                   protein_id=mCP110509.0 isoform=CRA_b"
FT                   /protein_id="EDL02275.1"
FT                   /translation="EEENGPGSSKSKGNRVGFDSTQWRAVKKFIMLTSSQNVPVFLIDP
FT                   WILESINKNFEQVKNASQGPASECRFFCVPRDFTAFALQYHLWKNEDGWFRIAENMGFQ
FT                   CLKTESKDPRLDGIDSLSGTEIPLHYVCKLTTHAIHLVVFHERSGNYLWHGHLRLKGHM
FT                   DRKFVPFRKLQFGRYPGAFDRPELQQVTVDGLDMLIPKDPGRFLEEVPHSRFIECRYKE
FT                   ARAFLQEHTTFQRYRFRGEKCGACSRVYSLTEETETKPTVTTKVRMNMRGQRDSSVVKS
FT                   AGSPPEDQSLMPSTHVAVHNHL"
FT   gene            10916959..10924128
FT                   /gene="Tal2"
FT                   /locus_tag="mCG_2742"
FT                   /note="gene_id=mCG2742.1"
FT   mRNA            join(10916959..10917029,10923054..10924128)
FT                   /gene="Tal2"
FT                   /locus_tag="mCG_2742"
FT                   /product="T-cell acute lymphocytic leukemia 2"
FT                   /note="gene_id=mCG2742.1 transcript_id=mCT1836.1 created on
FT                   18-JUN-2002"
FT   CDS             10923064..10923390
FT                   /codon_start=1
FT                   /gene="Tal2"
FT                   /locus_tag="mCG_2742"
FT                   /product="T-cell acute lymphocytic leukemia 2"
FT                   /note="gene_id=mCG2742.1 transcript_id=mCT1836.1
FT                   protein_id=mCP15264.0"
FT                   /db_xref="GOA:Q2TB09"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:99540"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TB09"
FT                   /protein_id="EDL02273.1"
FT                   /translation="MTRKIFTNTRERWRQQSVNNAFAKLRKLIPTHPPDKKLSKNETLR
FT                   LAMRYINFLVKVLGEQSLHQTGVAAQGNILGLFPPKTRLPDEDDRTLLNDYRVPSPGPS
FT                   HGAP"
FT   assembly_gap    10925199..10926137
FT                   /estimated_length=939
FT                   /gap_type="unknown"
FT   gene            complement(<10928243..>10928632)
FT                   /locus_tag="mCG_48814"
FT                   /note="gene_id=mCG48814.1"
FT   mRNA            complement(<10928243..>10928632)
FT                   /locus_tag="mCG_48814"
FT                   /product="mCG48814"
FT                   /note="gene_id=mCG48814.1 transcript_id=mCT48997.1 created
FT                   on 18-JUN-2002"
FT   CDS             complement(<10928243..10928632)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48814"
FT                   /product="mCG48814"
FT                   /note="gene_id=mCG48814.1 transcript_id=mCT48997.1
FT                   protein_id=mCP36147.1"
FT                   /protein_id="EDL02272.1"
FT                   /translation="MVEMNVLVDALKSTNSAEKGGKRQFPIRLCSKAIVRFLTVMMKHG
FT                   YISEFEIIDDHRAGKMVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPARQFGFIVL
FT                   TTLAGIMDREEGRQKHTGGEILGFFL"
FT   assembly_gap    10938282..10938301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10947830..10948139
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    10952264..10952283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10957446..10993425
FT                   /gene="Tmem38b"
FT                   /locus_tag="mCG_2737"
FT                   /note="gene_id=mCG2737.2"
FT   mRNA            join(10957446..10957604,10972066..10972222,
FT                   10980305..10980489,10981868..10981955,10985709..10985826,
FT                   10991279..10993425)
FT                   /gene="Tmem38b"
FT                   /locus_tag="mCG_2737"
FT                   /product="transmembrane protein 38B"
FT                   /note="gene_id=mCG2737.2 transcript_id=mCT1842.2 created on
FT                   10-JUN-2002"
FT   CDS             join(10957493..10957604,10972066..10972222,
FT                   10980305..10980489,10981868..10981955,10985709..10985826,
FT                   10991279..10991497)
FT                   /codon_start=1
FT                   /gene="Tmem38b"
FT                   /locus_tag="mCG_2737"
FT                   /product="transmembrane protein 38B"
FT                   /note="gene_id=mCG2737.2 transcript_id=mCT1842.2
FT                   protein_id=mCP15241.1"
FT                   /protein_id="EDL02271.1"
FT                   /translation="MEYPWDDLTLAFSRTSMFPFFDIAHYLVSVMALKQRPGAVAAAWN
FT                   NPLASWLSAMLHCFGGGILSCMLLAESPLKFLTNHTNILLASSIWYIVFFCPRDLVSQG
FT                   YSYQPIQFLAAGMKEVTRTWKIVGGVSDANSYYRNAWIVMIVVGWARGAGGAVVTACEQ
FT                   LLKGDWKPEGDEWLKMSFPCKITLLGSIMFTFQHTRHLAISKHDLMFLYTIFLVTIKVT
FT                   MMMTKDTAVTLTPFEDTLTRMLFGRRQQQQFSSSEKKTEVKPSSNGSASSASKRGAEPS
FT                   GGAKRHAKKED"
FT   assembly_gap    10964299..10964318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10968158..10968225
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    10981273..10981292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11006824..11007018
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   gene            <11009486..>11009887
FT                   /locus_tag="mCG_49228"
FT                   /note="gene_id=mCG49228.1"
FT   mRNA            <11009486..>11009887
FT                   /locus_tag="mCG_49228"
FT                   /product="mCG49228"
FT                   /note="gene_id=mCG49228.1 transcript_id=mCT49411.1 created
FT                   on 10-JUN-2002"
FT   CDS             <11009486..>11009887
FT                   /codon_start=1
FT                   /locus_tag="mCG_49228"
FT                   /product="mCG49228"
FT                   /note="gene_id=mCG49228.1 transcript_id=mCT49411.1
FT                   protein_id=mCP36183.1"
FT                   /protein_id="EDL02270.1"
FT                   /translation="LNTNIDGRRKIAFVITAIKDMGQRYTHVVLRKADIDLTKSVGELT
FT                   EEEVERVITIMQNPRQYKIPDWFLNRQKDGKYSQVLANSIDSKLRESLERLKKIQAHRG
FT                   LHHFWGLHVRSQHTKTTGCRGRTVGVSKKK"
FT   assembly_gap    11024662..11024782
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    11029370..11029601
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    11055894..11055974
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    11064965..11065345
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    11071117..11077017
FT                   /estimated_length=5901
FT                   /gap_type="unknown"
FT   assembly_gap    11080218..11081098
FT                   /estimated_length=881
FT                   /gap_type="unknown"
FT   assembly_gap    11120248..11120497
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    11126031..11126050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11144098..11144404
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    11145506..11145614
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    11147696..11147715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11148665..11148800
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    11162594..11162740
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    11168635..11168654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11200792..11201076
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    11236376..11236395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11238263..11238368
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    11261913..11261932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11279893..11280008
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    11299965..11300156
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    11342983..11343002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11344197..11344216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11345532..11345551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11359952..11360190
FT                   /locus_tag="mCG_1041280"
FT                   /note="gene_id=mCG1041280.1"
FT   mRNA            11359952..11360190
FT                   /locus_tag="mCG_1041280"
FT                   /product="mCG1041280"
FT                   /note="gene_id=mCG1041280.1 transcript_id=mCT158984.1
FT                   created on 10-JUN-2002"
FT   CDS             11359973..11360158
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041280"
FT                   /product="mCG1041280"
FT                   /note="gene_id=mCG1041280.1 transcript_id=mCT158984.1
FT                   protein_id=mCP53390.1"
FT                   /protein_id="EDL02269.1"
FT                   /translation="MLNSFLCREFLFLQFLLGYLFLLCNLLFWLWNDLFLLSEDHLSVA
FT                   GGAHVWVNPAMSSVGL"
FT   assembly_gap    11363868..11363887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11403003..11403324
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    11407752..11408259
FT                   /estimated_length=508
FT                   /gap_type="unknown"
FT   assembly_gap    11423505..11423524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11433538..11439554
FT                   /estimated_length=6017
FT                   /gap_type="unknown"
FT   assembly_gap    11450070..11450143
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    11478157..11478176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11492164..11492243
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    11524544..11528839
FT                   /estimated_length=4296
FT                   /gap_type="unknown"
FT   assembly_gap    11588479..11588498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11592057..11592130
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    11627932..11627951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11634913..11635348
FT                   /estimated_length=436
FT                   /gap_type="unknown"
FT   assembly_gap    11665923..11666148
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    11687112..11687131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11728991..11729157
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    11729480..11729570
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    11734888..11734907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11739038..11739057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11768376..11768395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11768398..11768958)
FT                   /pseudo
FT                   /locus_tag="mCG_54591"
FT                   /note="gene_id=mCG54591.2"
FT   mRNA            complement(11768398..11768958)
FT                   /pseudo
FT                   /locus_tag="mCG_54591"
FT                   /note="gene_id=mCG54591.2 transcript_id=mCT54774.2 created
FT                   on 25-JUN-2002"
FT   assembly_gap    11769635..11769654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11777203..11777756)
FT                   /pseudo
FT                   /locus_tag="mCG_140624"
FT                   /note="gene_id=mCG140624.0"
FT   mRNA            complement(11777203..11777756)
FT                   /pseudo
FT                   /locus_tag="mCG_140624"
FT                   /note="gene_id=mCG140624.0 transcript_id=mCT170381.0
FT                   created on 25-JUN-2002"
FT   assembly_gap    11777828..11777847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11800702..11802647
FT                   /estimated_length=1946
FT                   /gap_type="unknown"
FT   assembly_gap    11808231..11809401
FT                   /estimated_length=1171
FT                   /gap_type="unknown"
FT   assembly_gap    11812414..11812580
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    11814168..11814272
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    11815833..11816131
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    11842425..11842444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11873630..11873724
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    11903837..11903996
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    11908254..11911258
FT                   /estimated_length=3005
FT                   /gap_type="unknown"
FT   assembly_gap    11918700..11919298
FT                   /estimated_length=599
FT                   /gap_type="unknown"
FT   assembly_gap    11920452..11920471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11939886..11939905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11942075..11942227
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    11945385..11945483
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   gene            11951405..11953628
FT                   /pseudo
FT                   /locus_tag="mCG_51576"
FT                   /note="gene_id=mCG51576.1"
FT   mRNA            11951405..11953628
FT                   /pseudo
FT                   /locus_tag="mCG_51576"
FT                   /note="gene_id=mCG51576.1 transcript_id=mCT51759.2 created
FT                   on 10-JUN-2002"
FT   assembly_gap    11978575..11979076
FT                   /estimated_length=502
FT                   /gap_type="unknown"
FT   assembly_gap    11983952..11983971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11989435..11989824
FT                   /estimated_length=390
FT                   /gap_type="unknown"
FT   assembly_gap    12026178..12026242
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    12044588..12045700
FT                   /estimated_length=1113
FT                   /gap_type="unknown"
FT   assembly_gap    12058842..12059165
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    12070475..12074187
FT                   /estimated_length=3713
FT                   /gap_type="unknown"
FT   assembly_gap    12094831..12094850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12110855..12110904
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            12112236..12184372
FT                   /gene="Zfp462"
FT                   /locus_tag="mCG_142696"
FT                   /note="gene_id=mCG142696.0"
FT   mRNA            join(12112236..12115328,12116154..12116318,
FT                   12118290..12118573,12121548..12121666,12124862..12125053,
FT                   12151692..12151959,12152921..12153118,12153856..12153992,
FT                   12154170..12154280,12163028..12163251,12175739..12175871,
FT                   12182015..12182138,12183424..12184372)
FT                   /gene="Zfp462"
FT                   /locus_tag="mCG_142696"
FT                   /product="zinc finger protein 462"
FT                   /note="gene_id=mCG142696.0 transcript_id=mCT181746.0
FT                   created on 01-APR-2003"
FT   CDS             join(12112311..12115328,12116154..12116318,
FT                   12118290..12118573,12121548..12121666,12124862..12125053,
FT                   12151692..12151959,12152921..12153118,12153856..12153992,
FT                   12154170..12154280,12163028..12163251,12175739..12175871,
FT                   12182015..12182138,12183424..12183631)
FT                   /codon_start=1
FT                   /gene="Zfp462"
FT                   /locus_tag="mCG_142696"
FT                   /product="zinc finger protein 462"
FT                   /note="gene_id=mCG142696.0 transcript_id=mCT181746.0
FT                   protein_id=mCP104668.0"
FT                   /protein_id="EDL02268.1"
FT                   /translation="MPHYQRMHPTVKINNAMIFSSYVVEQQEGLNAESQTLREILNSAP
FT                   KSMATSTPVARGGGLPATFNKNTPPKTFTPECESQKDPSVNTVVVYDCDVCSFASPNMH
FT                   SVLVHYQKKHPEEKASYFRIQKTMRMVSVDRGSALSQLSFEVGAPMSPKMSNMGSPPPP
FT                   QPPPPDLSIELYYCKHCSYSNRSVVGVLVHYQKRHPEIKVTAKYIRQAPPTAAMMRGAE
FT                   GLQDSPRPPAPLQLNSSERDCPPVETEMFFCQHCDYGNRTVKGVLIHYQKKHRDFKANA
FT                   DVIRQHTATIRSLCDRNQKPASCVLLPASGMERDKTKLRALKCRQCSYTSPYFYALRKH
FT                   IKKDHPALKATVTSIMRWAFLDGLIEAGYHCEWCIYSHMEPSGLLLHYQRRHPEHYVDY
FT                   TYMATKLWAGPDPSSPTLTMSAEAKTYRCRDCVFEAVSIWDITNHYQAFHPWAMNGDES
FT                   VLLDIIKEKDGVDKALLAPEELIGPVNCENSMPNPLPEQEAECPEDARLSPEKSIHLAS
FT                   ANPAISSTPYQCTVCQSEYNNLHGLLTHYGKKHPGMKVKAADFAQDIDINPGAVYKCRH
FT                   CPYINTRIHGVLTHYQKRHPAIKVTAEDFVHDVEQSADISQNDVEETSRIFKQGYGAYR
FT                   CKLCPYTHGTLEKLKIHYEKYHNQPEFDVFSPSPPKLPVSLEPEITTEVSPSQVSVTEE
FT                   EVGEDPMSTAHFSTSHLVSHTVFRCQLCKYFCSTRKGIARHYRIKHNNVRAQPEGKNNL
FT                   FKCALCAYTNPIRKGLAAHYQKRHDIDAYYTHCLAASRTISDKPNKVIIPSPPKDDSPQ
FT                   LSEELRRAVEKKKCSLCSFQSFSKKGIVSHYMKRHPGVFPKKQHASKLGGYFTAVYADE
FT                   HEKPPLMEEEERSSFERAEAEGEAQDIEWLPFRCIKCFKLSFSTAELLCMHYTDHHSRD
FT                   LKRDFVILGSGPRFQNSTFQCKHCDSKLQSIAELTSHLNIHNEEFQKRAKRQERRKQLL
FT                   SKQKYADGAFADFKQERPFGHLEEVPKIKERKVVGYKCKFCVEVHPTLRAICNHLRKHV
FT                   QYGSVPAVSAAVKEAEDPSHLFLDGLEAARDASGTLVGRVDGGHCLLDAMLEDETRPGG
FT                   YHCSQCDRVLMSMQGLRSHERSHLALAMFTREDKYSCQYCSFVSAFRHNLDRHMQTHHG
FT                   HHKPFRCKLCSFKSSYNSRLKTHILKAHAGEHAYKCSWCSFSTMTISQLKEHSLKVHGK
FT                   ALTLPRPRIVSLLSSHAHPSSQKATPAEEVEDSNDSSYSEPPDVQQQLNHYQSAALARN
FT                   KSRVSPVPPSGTAAGTEQKAEAVLHCEFCEFSSGYIQSIRRHYRDKHGGKKLFKCKDCS
FT                   FYTGFKNKSRVSPVPPSGTAAGTEQKAEAVLHCEFCEFSSGYIQSIRRHYRDKHGGKKL
FT                   FKCKDCSFYTGFKSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHRA
FT                   GHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHREERVVPIEVCRSKLSKYLQGVVF
FT                   RCDKCTFTCSSDESLQQHIEKHNELKPYKCQLCYYETKHTEELDTHLRDEHKVSRNFEL
FT                   VGRVNLDQLEQMKEKIESSSSEDEDKDDEMSSKAEDRELMRFADRGPGVNTEKRFPCEF
FT                   CGRAFSQGSEWERHVLRHGMALHDTNQVSRNEIHTKEMVEESMQLPSIEAKEDDEPIGI
FT                   DFPLKSETVTICVVAADKSLLEDAEAKNE"
FT   assembly_gap    12152874..12152893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12154010..12154029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12169196..12169553
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    12190446..12190465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12207747..12208568
FT                   /estimated_length=822
FT                   /gap_type="unknown"
FT   assembly_gap    12259369..12259388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12271414..12271457
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    12309819..12309943
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   gene            12356485..12356941
FT                   /pseudo
FT                   /locus_tag="mCG_20051"
FT                   /note="gene_id=mCG20051.2"
FT   mRNA            12356485..12356941
FT                   /pseudo
FT                   /locus_tag="mCG_20051"
FT                   /note="gene_id=mCG20051.2 transcript_id=mCT18653.2 created
FT                   on 07-JUN-2002"
FT   assembly_gap    12383203..12383222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12384274..12384293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12391771..12391960
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    12409968..12410193
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    12420880..12421662
FT                   /estimated_length=783
FT                   /gap_type="unknown"
FT   assembly_gap    12426370..12426389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12430728..12431630
FT                   /locus_tag="mCG_1041353"
FT                   /note="gene_id=mCG1041353.0"
FT   mRNA            join(12430728..12431209,12431385..12431630)
FT                   /locus_tag="mCG_1041353"
FT                   /product="mCG1041353"
FT                   /note="gene_id=mCG1041353.0 transcript_id=mCT159057.0
FT                   created on 07-JUN-2002"
FT   CDS             12430803..12430922
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041353"
FT                   /product="mCG1041353"
FT                   /note="gene_id=mCG1041353.0 transcript_id=mCT159057.0
FT                   protein_id=mCP53535.1"
FT                   /protein_id="EDL02267.1"
FT                   /translation="MACQHLICCSPIASLLRPGMGSDLARIHSCTCAHCLFTS"
FT   assembly_gap    12435145..12435164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12436381..12436400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12438401..12438420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12440750..12441309
FT                   /estimated_length=560
FT                   /gap_type="unknown"
FT   gene            12441618..12484724
FT                   /gene="Rad23b"
FT                   /locus_tag="mCG_20056"
FT                   /note="gene_id=mCG20056.3"
FT   mRNA            join(12441618..12441995,12460313..12460394,
FT                   12461585..12461664,12463742..12464010,12471739..12471794,
FT                   12474480..12474607,12475976..12476111,12477083..12477210,
FT                   12478915..12479106,12483622..12484724)
FT                   /gene="Rad23b"
FT                   /locus_tag="mCG_20056"
FT                   /product="RAD23b homolog (S. cerevisiae), transcript
FT                   variant mCT18659"
FT                   /note="gene_id=mCG20056.3 transcript_id=mCT18659.2 created
FT                   on 16-JUN-2003"
FT   mRNA            join(12441618..12441995,12460313..12462114)
FT                   /gene="Rad23b"
FT                   /locus_tag="mCG_20056"
FT                   /product="RAD23b homolog (S. cerevisiae), transcript
FT                   variant mCT185791"
FT                   /note="gene_id=mCG20056.3 transcript_id=mCT185791.0 created
FT                   on 16-JUN-2003"
FT   mRNA            join(12441620..12441818,12460313..12460394,
FT                   12461585..12461664,12463742..12464010,12471739..12471794,
FT                   12474480..12474607,12475976..12476111,12477083..12477210,
FT                   12478915..12479106,12483622..12484606)
FT                   /gene="Rad23b"
FT                   /locus_tag="mCG_20056"
FT                   /product="RAD23b homolog (S. cerevisiae), transcript
FT                   variant mCT185793"
FT                   /note="gene_id=mCG20056.3 transcript_id=mCT185793.0 created
FT                   on 16-JUN-2003"
FT   CDS             join(12441930..12441995,12460313..12460394,
FT                   12461585..12461664,12463742..12464010,12471739..12471794,
FT                   12474480..12474607,12475976..12476111,12477083..12477210,
FT                   12478915..12479106,12483622..12483735)
FT                   /codon_start=1
FT                   /gene="Rad23b"
FT                   /locus_tag="mCG_20056"
FT                   /product="RAD23b homolog (S. cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG20056.3 transcript_id=mCT18659.2
FT                   protein_id=mCP15243.0 isoform=CRA_c partial"
FT                   /protein_id="EDL02266.1"
FT                   /translation="MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQK
FT                   LIYAGKILSDDTALKEYKIDEKNFVVVMVTKPKAVTTAVPATTQPSSTPSPTTVSSSPA
FT                   VAAAQAPAPTPALAPTSTPASTTPASTTASSEPAPAGATQPEKPAEKPAQTPVLTSPAP
FT                   ADSTPGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAV
FT                   EYLLMGIPGDRESQAVVDPPPQAVSTGTPQSPAVAAAAATTTATTTTTSGGHPLEFLRN
FT                   QPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGG
FT                   GGGGGGGGGGGGGGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEK
FT                   NENLAANFLLQQNFDED"
FT   CDS             join(12441930..12441995,12460313..12460417)
FT                   /codon_start=1
FT                   /gene="Rad23b"
FT                   /locus_tag="mCG_20056"
FT                   /product="RAD23b homolog (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG20056.3 transcript_id=mCT185791.0
FT                   protein_id=mCP107050.0 isoform=CRA_a"
FT                   /protein_id="EDL02263.1"
FT                   /translation="MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQK
FT                   LIYAGMNSILK"
FT   mRNA            join(12448080..12448107,12460313..12460394,
FT                   12461585..12461664,12463742..12464010,12471739..12471794,
FT                   12474480..12474607,12475976..12476111,12477083..12477210,
FT                   12478915..12479106,12483622..12484404)
FT                   /gene="Rad23b"
FT                   /locus_tag="mCG_20056"
FT                   /product="RAD23b homolog (S. cerevisiae), transcript
FT                   variant mCT185792"
FT                   /note="gene_id=mCG20056.3 transcript_id=mCT185792.0 created
FT                   on 16-JUN-2003"
FT   assembly_gap    12456367..12456386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12457518..12457537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12458914..12459055
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   CDS             join(12461653..12461664,12463742..12464010,
FT                   12471739..12471794,12474480..12474607,12475976..12476111,
FT                   12477083..12477210,12478915..12479106,12483622..12483735)
FT                   /codon_start=1
FT                   /gene="Rad23b"
FT                   /locus_tag="mCG_20056"
FT                   /product="RAD23b homolog (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG20056.3 transcript_id=mCT185792.0
FT                   protein_id=mCP107051.0 isoform=CRA_b"
FT                   /protein_id="EDL02264.1"
FT                   /translation="MVTKPKAVTTAVPATTQPSSTPSPTTVSSSPAVAAAQAPAPTPAL
FT                   APTSTPASTTPASTTASSEPAPAGATQPEKPAEKPAQTPVLTSPAPADSTPGDSSRSNL
FT                   FEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRES
FT                   QAVVDPPPQAVSTGTPQSPAVAAAAATTTATTTTTSGGHPLEFLRNQPQFQQMRQIIQQ
FT                   NPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGGGGGGGGG
FT                   GGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQN
FT                   FDED"
FT   CDS             join(12461653..12461664,12463742..12464010,
FT                   12471739..12471794,12474480..12474607,12475976..12476111,
FT                   12477083..12477210,12478915..12479106,12483622..12483735)
FT                   /codon_start=1
FT                   /gene="Rad23b"
FT                   /locus_tag="mCG_20056"
FT                   /product="RAD23b homolog (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG20056.3 transcript_id=mCT185793.0
FT                   protein_id=mCP107049.0 isoform=CRA_b"
FT                   /protein_id="EDL02265.1"
FT                   /translation="MVTKPKAVTTAVPATTQPSSTPSPTTVSSSPAVAAAQAPAPTPAL
FT                   APTSTPASTTPASTTASSEPAPAGATQPEKPAEKPAQTPVLTSPAPADSTPGDSSRSNL
FT                   FEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRES
FT                   QAVVDPPPQAVSTGTPQSPAVAAAAATTTATTTTTSGGHPLEFLRNQPQFQQMRQIIQQ
FT                   NPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGGGGGGGGG
FT                   GGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQN
FT                   FDED"
FT   assembly_gap    12481373..12481392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12482472..12482491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12484656..12484692
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            complement(12486152..12486560)
FT                   /pseudo
FT                   /locus_tag="mCG_50157"
FT                   /note="gene_id=mCG50157.2"
FT   mRNA            complement(12486152..12486560)
FT                   /pseudo
FT                   /locus_tag="mCG_50157"
FT                   /note="gene_id=mCG50157.2 transcript_id=mCT50340.2 created
FT                   on 25-JUN-2002"
FT   assembly_gap    12495256..12495415
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    12500467..12500486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12502730..12503426
FT                   /estimated_length=697
FT                   /gap_type="unknown"
FT   assembly_gap    12510115..12510134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12515294..12515313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12516521..12516540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12522936..12522955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12530663..12530870
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    12540822..12541831
FT                   /estimated_length=1010
FT                   /gap_type="unknown"
FT   assembly_gap    12543342..12543410
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    12550458..12551145
FT                   /estimated_length=688
FT                   /gap_type="unknown"
FT   assembly_gap    12558227..12558595
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    12581330..12581349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12588124..12588188
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    12596742..12596857
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    12604101..12604197
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    12609351..12609494
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    12610699..12610718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12611886..12611908
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    12619744..12619763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12619957..12624837)
FT                   /gene="Klf4"
FT                   /locus_tag="mCG_20055"
FT                   /note="gene_id=mCG20055.1"
FT   mRNA            complement(join(12619957..12620988,12622091..12622255,
FT                   12622372..12623356,12624003..12624123,12624240..12624837))
FT                   /gene="Klf4"
FT                   /locus_tag="mCG_20055"
FT                   /product="Kruppel-like factor 4 (gut)"
FT                   /note="gene_id=mCG20055.1 transcript_id=mCT18658.1 created
FT                   on 07-JUN-2002"
FT   CDS             complement(join(12620813..12620988,12622091..12622255,
FT                   12622372..12623356,12624003..12624123,12624240..12624244))
FT                   /codon_start=1
FT                   /gene="Klf4"
FT                   /locus_tag="mCG_20055"
FT                   /product="Kruppel-like factor 4 (gut)"
FT                   /note="gene_id=mCG20055.1 transcript_id=mCT18658.1
FT                   protein_id=mCP15240.1"
FT                   /db_xref="GOA:Q60793"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:1342287"
FT                   /db_xref="PDB:2WBS"
FT                   /db_xref="PDB:2WBU"
FT                   /db_xref="PDB:4M9E"
FT                   /db_xref="PDB:5KE6"
FT                   /db_xref="PDB:5KE7"
FT                   /db_xref="PDB:5KE8"
FT                   /db_xref="PDB:5KE9"
FT                   /db_xref="PDB:5KEA"
FT                   /db_xref="PDB:5KEB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60793"
FT                   /protein_id="EDL02262.1"
FT                   /translation="MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWR
FT                   EELSHMKRLPPLPGRPYDLAATVATDLESGGAGAACSSNNPALLARRETEEFNDLLDLD
FT                   FILSNSLTHQESVAATVTTSASASSSSSPASSGPASAPSTCSFSYPIRAGGDPGVAASN
FT                   TGGGLLYSRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGL
FT                   MGKFVLKASLTTPGSEYSSPSVISVSKGSPDGSHPVVVAPYSGGPPRMCPKIKQEAVPS
FT                   CTVSRSLEAHLSAGPQLSNGHRPNTHDFPLGRQLPTRTTPTLSPEELLNSRDCHPGLPL
FT                   PPGFHPHPGPNYPPFLPDQMQSQVPSLHYQELMPPGSCLPEEPKPKRGRRSWPRKRTAT
FT                   HTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHR
FT                   PFQCQKCDRAFSRSDHLALHMKRHF"
FT   assembly_gap    12637733..12637915
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    12653456..12655249
FT                   /estimated_length=1794
FT                   /gap_type="unknown"
FT   assembly_gap    12663680..12665245
FT                   /estimated_length=1566
FT                   /gap_type="unknown"
FT   assembly_gap    12666138..12666425
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    12669119..12669296
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    12675088..12675794
FT                   /estimated_length=707
FT                   /gap_type="unknown"
FT   assembly_gap    12679427..12679616
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    12682084..12682119
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    12682905..12683495
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    12715710..12716980
FT                   /estimated_length=1271
FT                   /gap_type="unknown"
FT   assembly_gap    12719124..12719143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12726869..12727786
FT                   /estimated_length=918
FT                   /gap_type="unknown"
FT   assembly_gap    12736506..12736525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12738507..12738526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12743009..12743028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12746149..12746326
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    12755803..12756112
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    12757325..12757344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12758911..12758930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12759978..12759997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12761488..12761507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12782957..12783645
FT                   /estimated_length=689
FT                   /gap_type="unknown"
FT   assembly_gap    12789616..12790052
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    12862005..12862137
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    12871283..12877775
FT                   /estimated_length=6493
FT                   /gap_type="unknown"
FT   assembly_gap    12882803..12883166
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    12895944..12895968
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    12947808..12947827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12955155..12959876
FT                   /estimated_length=4722
FT                   /gap_type="unknown"
FT   assembly_gap    12967626..12967645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12988217..12988236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12994128..12994147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12996869..12996888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13028326..13028345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13044206..13044382
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   gene            complement(13062903..>13087612)
FT                   /locus_tag="mCG_59407"
FT                   /note="gene_id=mCG59407.2"
FT   mRNA            complement(join(13062903..13062974,13063079..13063113,
FT                   13064537..13064652,13066805..13066992,13067538..13067611,
FT                   13068248..13068330,13087481..>13087612))
FT                   /locus_tag="mCG_59407"
FT                   /product="mCG59407"
FT                   /note="gene_id=mCG59407.2 transcript_id=mCT59590.2 created
FT                   on 07-JUN-2002"
FT   CDS             complement(join(13062922..13062974,13063079..13063113,
FT                   13064537..13064652,13066805..>13066978))
FT                   /codon_start=1
FT                   /locus_tag="mCG_59407"
FT                   /product="mCG59407"
FT                   /note="gene_id=mCG59407.2 transcript_id=mCT59590.2
FT                   protein_id=mCP36205.2"
FT                   /protein_id="EDL02261.1"
FT                   /translation="PHGKPWGEIAFKKEHGEEYPEYRVEAFALLFQLSKECLPARCPGQ
FT                   LPVFRINKCSDLQSLSQISFCWYQDFSGGLNKVLSMPEIPTMIEIPLFLPRGIQPTVRC
FT                   GIWTGSCLEFLLCLHFTIPRS"
FT   assembly_gap    13085022..13085041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13093342..13093386
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    13135768..13136054
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    13142190..13142209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13143332..13143575
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    13148551..13148596
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    13166333..13166352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13251920..13251961
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    13258584..13258603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13278458..13278477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13295517..13295536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13313552..>13317459)
FT                   /locus_tag="mCG_1041349"
FT                   /note="gene_id=mCG1041349.0"
FT   mRNA            complement(join(13313552..13313751,13316900..>13317459))
FT                   /locus_tag="mCG_1041349"
FT                   /product="mCG1041349"
FT                   /note="gene_id=mCG1041349.0 transcript_id=mCT159053.0
FT                   created on 07-JUN-2002"
FT   CDS             complement(13316932..>13317327)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041349"
FT                   /product="mCG1041349"
FT                   /note="gene_id=mCG1041349.0 transcript_id=mCT159053.0
FT                   protein_id=mCP53512.0"
FT                   /protein_id="EDL02260.1"
FT                   /translation="EKKFDSFSQVEKKTKQNDLVCPAAVLSYLKGSGGDSSVFNDLDLF
FT                   IAYFYCYNLAIQCLALRVTCGHNKNPSQRKYSQSTSLVTLHGNQLRRTKTLSLLFRPHW
FT                   GRVYFGIFLCGSLSGVLFLQDSTSMPC"
FT   assembly_gap    13320554..13320573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13327415..13327434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13346274..13346580
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    13376913..13377055
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    13386766..13387060
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    13427893..13427912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13437080..13437099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13482080..13482813
FT                   /pseudo
FT                   /locus_tag="mCG_1041276"
FT                   /note="gene_id=mCG1041276.1"
FT   mRNA            13482080..13482813
FT                   /pseudo
FT                   /locus_tag="mCG_1041276"
FT                   /note="gene_id=mCG1041276.1 transcript_id=mCT158980.1
FT                   created on 07-JUN-2002"
FT   assembly_gap    13488534..13490217
FT                   /estimated_length=1684
FT                   /gap_type="unknown"
FT   assembly_gap    13492253..13492574
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    13496242..13496261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13517548..13517567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13530037..13540482
FT                   /estimated_length=10446
FT                   /gap_type="unknown"
FT   assembly_gap    13544124..13544477
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    13588168..13588188
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    13594256..13594449
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    13597863..13599230
FT                   /estimated_length=1368
FT                   /gap_type="unknown"
FT   assembly_gap    13604038..13604057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13606550..13606569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13607638..13607657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13608894..13608913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13613492..13614445
FT                   /estimated_length=954
FT                   /gap_type="unknown"
FT   assembly_gap    13619452..13619602
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    13625393..13625646
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    13629455..13630147
FT                   /estimated_length=693
FT                   /gap_type="unknown"
FT   assembly_gap    13635006..13635025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13636170..13640712
FT                   /estimated_length=4543
FT                   /gap_type="unknown"
FT   assembly_gap    13657520..13659036
FT                   /estimated_length=1517
FT                   /gap_type="unknown"
FT   assembly_gap    13728700..13729282
FT                   /estimated_length=583
FT                   /gap_type="unknown"
FT   assembly_gap    13740587..13740606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13745175..13745559
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    13747831..13748350
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    13749967..13749986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13776380..13776414
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    13778904..13779090
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    13783584..13783603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13788566..13788585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13790441..13793114
FT                   /estimated_length=2674
FT                   /gap_type="unknown"
FT   assembly_gap    13794475..13798275
FT                   /estimated_length=3801
FT                   /gap_type="unknown"
FT   assembly_gap    13820160..13820755
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    13822524..13822543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13823963..13823982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13825193..13825212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13828199..13829604)
FT                   /gene="Actl7b"
FT                   /locus_tag="mCG_52415"
FT                   /note="gene_id=mCG52415.1"
FT   mRNA            complement(13828199..13829604)
FT                   /gene="Actl7b"
FT                   /locus_tag="mCG_52415"
FT                   /product="actin-like 7b"
FT                   /note="gene_id=mCG52415.1 transcript_id=mCT52598.1 created
FT                   on 07-JUN-2002"
FT   CDS             complement(13828292..13829548)
FT                   /codon_start=1
FT                   /gene="Actl7b"
FT                   /locus_tag="mCG_52415"
FT                   /product="actin-like 7b"
FT                   /note="gene_id=mCG52415.1 transcript_id=mCT52598.1
FT                   protein_id=mCP36150.0"
FT                   /db_xref="GOA:Q9QY83"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR027680"
FT                   /db_xref="MGI:MGI:1343053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QY83"
FT                   /protein_id="EDL02259.1"
FT                   /translation="MATKNSPSPKPMGTAQGDPGEAGTLPAPEAAGIRDTGSTQLKTKP
FT                   KKIRKIKALVIDLGSQYCKCGYAGEPRPTYFISSTVGKRSAEMAADAGDNFKETYVGHE
FT                   LLNMEASLKLVNPLKHGVVVDWDCIQNIWEYIFHTAMKIMPEEHAVLVSDPPLSPTSNR
FT                   EKYAELLFETFGIPAMHVTSQALLSIYSYGKTSGLVVESGHGVSHVVPISEGDLLPGLP
FT                   SRVDYAGCDLTNYLMQLLNEAGHKFSDDHLHIIEHIKKKCCYAALLPEEEMSLGLDELH
FT                   VDYELPDGKIITIGQERFRCSEMLFKPSLVGCTQPGLPELTATCLARCQGTGFKEEMAA
FT                   NVLLCGGCTMLDGFPERFQRELSLLCPGDSPTVAAAPERKTSVWTGGSILASLQAFQQL
FT                   WVSKEEFEERGCAAIYSKC"
FT   gene            13831651..13833130
FT                   /gene="Actl7a"
FT                   /locus_tag="mCG_7384"
FT                   /note="gene_id=mCG7384.1"
FT   mRNA            13831651..13833130
FT                   /gene="Actl7a"
FT                   /locus_tag="mCG_7384"
FT                   /product="actin-like 7a"
FT                   /note="gene_id=mCG7384.1 transcript_id=mCT6237.1 created on
FT                   07-JUN-2002"
FT   CDS             13831680..13833002
FT                   /codon_start=1
FT                   /gene="Actl7a"
FT                   /locus_tag="mCG_7384"
FT                   /product="actin-like 7a"
FT                   /note="gene_id=mCG7384.1 transcript_id=mCT6237.1
FT                   protein_id=mCP15277.1"
FT                   /db_xref="GOA:Q9QY84"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR027679"
FT                   /db_xref="InterPro:IPR031769"
FT                   /db_xref="MGI:MGI:1343051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QY84"
FT                   /protein_id="EDL02258.1"
FT                   /translation="MSLDGVWAPQTANIGDGPAKKASDQASMQTQVLQTASLKDGPAKR
FT                   AVWVRRDNAETEDPVKSTMSKDRPRLEVTKAVVVDLGTGFCKCGFAGLPKPTHKISTTV
FT                   GKPYMETAKTGDNRKETFVGHELFNPDIHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEM
FT                   KIAPEEHAVLVSDPPLSPHTNREKYAEMLFETFNTPAMHIAYQSRLSMYSYGRTSGLVV
FT                   EVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTTYLMNLMNNSGKHFSEDHLGIVEDIK
FT                   TRCCFVALDPIEEKKIPAPEHEIHYTLPDGKEIRLGQERFLCSEMFFKPSLIKSMQLGL
FT                   HTQTVSCLNKCDIALKRDLMGNILLCGGSTMLRGFPNRLQKELSSMCPNDTPQVNVLPE
FT                   RDTAVWTGGSILASLQGFQPLWVHRLEYEEHGPFFLYRRCF"
FT   gene            complement(13837886..13890530)
FT                   /gene="Ikbkap"
FT                   /locus_tag="mCG_7388"
FT                   /note="gene_id=mCG7388.1"
FT   mRNA            complement(join(13837886..13839924,13843515..13843590,
FT                   13845336..13845490,13846432..13846559,13847183..13847294,
FT                   13850484..13850544,13851056..13851118,13856054..13856115,
FT                   13857247..13857448,13859197..13859294,13859643..13859766,
FT                   13860591..13860739,13861227..13861312,13861410..13861547,
FT                   13862728..13862807,13862894..13862972,13863225..13863337,
FT                   13863633..13863748,13864900..13865005,13865095..13865148,
FT                   13867170..13867273,13867868..13867974,13872761..13872860,
FT                   13874804..13874968,13875957..13876187,13878328..13878421,
FT                   13879085..13879208,13880222..13880312,13883701..13883781,
FT                   13884697..13884778,13886854..13887006,13888171..13888333,
FT                   13890354..13890530))
FT                   /gene="Ikbkap"
FT                   /locus_tag="mCG_7388"
FT                   /product="inhibitor of kappa light polypeptide enhancer in
FT                   B-cells, kinase complex-associated protein, transcript
FT                   variant mCT6235"
FT                   /note="gene_id=mCG7388.1 transcript_id=mCT6235.1 created on
FT                   07-JUN-2002"
FT   mRNA            complement(join(13838979..13839924,13843515..13843590,
FT                   13845336..13845490,13846432..13846559,13847183..13847294,
FT                   13848007..13848120,13850484..13850544,13851056..13851118,
FT                   13856054..13856115,13857247..13857448,13859197..13859294,
FT                   13859643..13859766,13860591..13860739,13861227..13861312,
FT                   13861410..13861547,13862728..13862807,13862894..13862972,
FT                   13863225..13863298,13863633..13863748,13864900..13865005,
FT                   13865095..13865148,13867170..13867273,13867868..13867974,
FT                   13869236..13869427,13872761..13872860,13874804..13874968,
FT                   13875957..13876187,13878328..13878421,13879085..13879208,
FT                   13880222..13880312,13880580..13880676,13882285..13882370,
FT                   13883701..13883781,13884697..13884778,13886854..13887006,
FT                   13888171..13888333,13890354..>13890454))
FT                   /gene="Ikbkap"
FT                   /locus_tag="mCG_7388"
FT                   /product="inhibitor of kappa light polypeptide enhancer in
FT                   B-cells, kinase complex-associated protein, transcript
FT                   variant mCT189529"
FT                   /note="gene_id=mCG7388.1 transcript_id=mCT189529.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(13839857..13839924,13843515..13843590,
FT                   13845336..13845490,13846432..13846559,13847183..13847294,
FT                   13848007..13848120,13850484..13850544,13851056..13851118,
FT                   13856054..13856115,13857247..13857448,13859197..13859294,
FT                   13859643..13859766,13860591..13860739,13861227..13861312,
FT                   13861410..13861547,13862728..13862807,13862894..13862972,
FT                   13863225..13863298,13863633..13863748,13864900..13865005,
FT                   13865095..13865148,13867170..13867273,13867868..13867974,
FT                   13869236..13869427,13872761..13872860,13874804..13874968,
FT                   13875957..13876187,13878328..13878421,13879085..13879208,
FT                   13880222..13880312,13880580..13880676,13882285..13882370,
FT                   13883701..13883781,13884697..13884778,13886854..13887006,
FT                   13888171..13888333,13890354..>13890454))
FT                   /codon_start=1
FT                   /gene="Ikbkap"
FT                   /locus_tag="mCG_7388"
FT                   /product="inhibitor of kappa light polypeptide enhancer in
FT                   B-cells, kinase complex-associated protein, isoform CRA_a"
FT                   /note="gene_id=mCG7388.1 transcript_id=mCT189529.0
FT                   protein_id=mCP110519.0 isoform=CRA_a"
FT                   /protein_id="EDL02256.1"
FT                   /translation="PFSGSCFSSPVCIGGSFPNPVRREGSEPPRGRRRNCFIMRNLKLH
FT                   RTLEFRDIQAPGKPQCFCLRAEQGTVLIGSERGLTEVDPVRREVKTEISLVAEGFLPED
FT                   GSGCIVGIQDLLDQESVCVATASGDVIVCNLSTQQLECVGSVASGISVMSWSPDQELLL
FT                   LATAQQTLIMMTKDFEVIAEEQIHQDDFGEGKFVTVGWGSKQTQFHGSEGRPTAFPVQL
FT                   PENALPWDDRRPHITWRGDGQYFAVSVVCRQTEARKIRVWNREFALQSTSESVPGLGPA
FT                   LAWKPSGSLIASTQDKPNQQDVVFFEKNGLLHGHFTLPFLKDEVKVNDLLWNADSSVLA
FT                   IWLEDLPKEDSSTLKSYVQLWTVGNYHWYLKQSLPFSTTGKNQVVSLLWDPVTPCRLHV
FT                   LCTGWRYLCCDWHWTTDRSSGNSANDLANVAVIDGNRVLVTVFRQTVVPPPMCTYRLLI
FT                   PHPVNQVIFSAHLGNDLAVLDASNQISVYKCGDKPNMDSTVKLGAVGGNGFKVPLTTPH
FT                   LEKRYSIQFGNNEEEEEEEVNALQLSFLTWVEDDTFLAISYSHSSSQSIIHHLTVTHSE
FT                   VDEEQGQLDVSSSVTVDGVVIGLCCCSKTKSLAVQLADGQVLKYLWESPSLAVEPWKNS
FT                   EGIPVRFVHPCTQMEVATIGGEECVLGLTDRCRFFINDTEVASNITSFAVCDDFLLVTT
FT                   HSHTCQGFSLSGASLKMLQAALSGSHEASGEILRKVERGSRIVTVVPQDTKLILQMPRG
FT                   NLEVVHHRALVLAQIRKWLDKLMFKEAFECMRKLRINLNLIHDHNPKVFLENVETFVKQ
FT                   IDSVNHINLFFTELREEDVTKTMYPPPITKSVQVSTHPDGKKLDLICDAMRAAMEAINP
FT                   RKFCLSILTSHVKKTTPELEIVLQKVQELQGNLPFDPESVSVEEALKYLLLLVDVNELF
FT                   NHSLGTYDFNLVLMVAEKSQKDPKEYLPFLNTLKKMETNYQRFTIDKYLKRYEKALGHL
FT                   SKCGPEYFTECLNLIKDKNLYKEALKLYRPDSPQYQAVSMAYGEHLMQEHLYEPAGLVF
FT                   ARCGAQEKALEAFLACGSWQQALCVAAQLQMSKDKVAGLARTLAGKLVEQRKHSEAATV
FT                   LEQYAQDYEEAVLLLLEGSAWEEALRLVYKYDRVDIIETSIKPSILEAQKNYMDFLDSE
FT                   TATFIRHKNRLQVVRALRRQAPQVHVDHEVAHGPESDLFSETSSIMSGSEMSGRYSHSN
FT                   SRISARSSKNRRKAERKKHSLKEGSPLEGLALLEALSEVVQSVEKLKDEVRAILKVLFL
FT                   FEFEEQAKELQRAFESTLQLMERAVPEIWTPAGQQSSTTPVLGPSSTANSITASYQQQK
FT                   TCVPALDAGVYMPPKMDPRSQWKLSLLE"
FT   CDS             complement(join(13839857..13839924,13843515..13843590,
FT                   13845336..13845490,13846432..13846559,13847183..13847294,
FT                   13850484..13850544,13851056..13851118,13856054..13856115,
FT                   13857247..13857448,13859197..13859294,13859643..13859766,
FT                   13860591..13860739,13861227..13861312,13861410..13861547,
FT                   13862728..13862807,13862894..13862972,13863225..13863337,
FT                   13863633..13863748,13864900..13865005,13865095..13865148,
FT                   13867170..13867273,13867868..13867974,13872761..13872860,
FT                   13874804..13874968,13875957..13876187,13878328..13878421,
FT                   13879085..13879208,13880222..13880312,13883701..13883781,
FT                   13884697..13884778,13886854..13887006,13888171..13888320))
FT                   /codon_start=1
FT                   /gene="Ikbkap"
FT                   /locus_tag="mCG_7388"
FT                   /product="inhibitor of kappa light polypeptide enhancer in
FT                   B-cells, kinase complex-associated protein, isoform CRA_b"
FT                   /note="gene_id=mCG7388.1 transcript_id=mCT6235.1
FT                   protein_id=mCP15237.2 isoform=CRA_b"
FT                   /protein_id="EDL02257.1"
FT                   /translation="MRNLKLHRTLEFRDIQAPGKPQCFCLRAEQGTVLIGSERGLTEVD
FT                   PVRREVKTEISLVAEGFLPEDGSGCIVGIQDLLDQESVCVATASGDVIVCNLSTQQLEC
FT                   VGSVASGISVMSWSPDQELLLLATAQQTLIMMTKDFEVIAEEQIHQDDFGEEARKIRVW
FT                   NREFALQSTSESVPGLGPALAWKPSGSLIASTQDKPNQQDVVFFEKNGLLHGHFTLPFL
FT                   KDEVKVNDLLWNADSSVLAIWLEDLPKEDSSTLKSYVQLWTVGNYHWYLKQSLPFSTTG
FT                   KNQVVSLLWDPVTPCRLHVLCTGWRYLCCDWHWTTDRSSGNSANDLANVAVIDGNRVLV
FT                   TVFRQTVVPPPMCTYRLLIPHPVNQVIFSAHLGNDLAVLDASNQISVYKCGDKPNMDST
FT                   VKLGAVGGNGFKVPLTTPHLEKRYSSSVTVDGVVIGLCCCSKTKSLAVQLADGQVLKYL
FT                   WESPSLAVEPWKNSEGIPVRFVHPCTQMEVATIGGEECVLGLTDRCRFFINDTEVASNI
FT                   TSFAVCDDFLLVTTHSHTCQGFSLSGASLKMLQAALSGSHEASGEILRKVERGSRIVTV
FT                   VPQDTKLILQGLQLIKDAGFYFEMPRGNLEVVHHRALVLAQIRKWLDKLMFKEAFECMR
FT                   KLRINLNLIHDHNPKVFLENVETFVKQIDSVNHINLFFTELREEDVTKTMYPPPITKSV
FT                   QVSTHPDGKKLDLICDAMRAAMEAINPRKFCLSILTSHVKKTTPELEIVLQKVQELQGN
FT                   LPFDPESVSVEEALKYLLLLVDVNELFNHSLGTYDFNLVLMVAEKSQKDPKEYLPFLNT
FT                   LKKMETNYQRFTIDKYLKRYEKALGHLSKCGPEYFTECLNLIKDKNLYKEALKLYRPDS
FT                   PQYQAVSMAYGEHLMQEHLYEPAGLVFARCGAQEKALEAFLACGSWQQALCVAAQLQMS
FT                   KDKVAGLARTLAGKLVEQRKHSEAATVLEQYAQDYEEAVLLLLEGSAWEEALRLVYKYD
FT                   RVDIIETSIKPSILEDHEVAHGPESDLFSETSSIMSGSEMSGRYSHSNSRISARSSKNR
FT                   RKAERKKHSLKEGSPLEGLALLEALSEVVQSVEKLKDEVRAILKVLFLFEFEEQAKELQ
FT                   RAFESTLQLMERAVPEIWTPAGQQSSTTPVLGPSSTANSITASYQQQKTCVPALDAGVY
FT                   MPPKMDPRSQWKLSLLE"
FT   assembly_gap    13870774..13870856
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            13890546..13895167
FT                   /locus_tag="mCG_7387"
FT                   /note="gene_id=mCG7387.1"
FT   mRNA            join(13890546..13890921,13891791..13891842,
FT                   13892349..13892478,13893877..13893953,13894073..13894142,
FT                   13894229..13895167)
FT                   /locus_tag="mCG_7387"
FT                   /product="mCG7387"
FT                   /note="gene_id=mCG7387.1 transcript_id=mCT6240.1 created on
FT                   07-JUN-2002"
FT   CDS             join(13890807..13890921,13891791..13891842,
FT                   13892349..13892478,13893877..13893953,13894073..13894142,
FT                   13894229..13894366)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7387"
FT                   /product="mCG7387"
FT                   /note="gene_id=mCG7387.1 transcript_id=mCT6240.1
FT                   protein_id=mCP15236.2"
FT                   /protein_id="EDL02255.1"
FT                   /translation="MEELRCPEAKLAPPEVVIATEAPPPSLVDRYFTRWYKADVKGKPC
FT                   EDHCILQHSNRICVITLAGSHPVLQSGKAIQRISYQISNNCSRLENKVSGKFKRGAQFL
FT                   TELAPLCKIYCSDGEEYTISSCVRGRLMEVNENILHQPSLLQEKPSTEGYIAVVLPKFE
FT                   ESKSVTEGLLTQQQYEEVVVKRTNATATTP"
FT   gene            complement(13899122..13953246)
FT                   /gene="Ctnnal1"
FT                   /locus_tag="mCG_7383"
FT                   /note="gene_id=mCG7383.2"
FT   mRNA            complement(join(13899122..13900583,13900706..13900789,
FT                   13901373..13901486,13902024..13902080,13904374..13904422,
FT                   13905182..13905336,13905440..13905490,13910685..13910722,
FT                   13914433..13914583,13915411..13915503,13917647..13917805,
FT                   13921059..13921145,13923322..13923522,13925937..13926107,
FT                   13927171..13927260,13929817..13929936,13932950..13933137,
FT                   13936316..13936505,13953026..13953246))
FT                   /gene="Ctnnal1"
FT                   /locus_tag="mCG_7383"
FT                   /product="catenin (cadherin associated protein), alpha-like
FT                   1"
FT                   /note="gene_id=mCG7383.2 transcript_id=mCT6241.1 created on
FT                   07-JUN-2002"
FT   CDS             complement(join(13900524..13900583,13900706..13900789,
FT                   13901373..13901486,13902024..13902080,13904374..13904422,
FT                   13905182..13905336,13905440..13905490,13910685..13910722,
FT                   13914433..13914583,13915411..13915503,13917647..13917805,
FT                   13921059..13921145,13923322..13923522,13925937..13926107,
FT                   13927171..13927260,13929817..13929936,13932950..13933137,
FT                   13936316..13936505,13953026..13953163))
FT                   /codon_start=1
FT                   /gene="Ctnnal1"
FT                   /locus_tag="mCG_7383"
FT                   /product="catenin (cadherin associated protein), alpha-like
FT                   1"
FT                   /note="gene_id=mCG7383.2 transcript_id=mCT6241.1
FT                   protein_id=mCP15260.1"
FT                   /protein_id="EDL02254.1"
FT                   /translation="MAASPVPGGGGAGAVHSSNAAGFTFDSGLEIRTRSVEQTLLPLVS
FT                   QITTLINHKDNTKKSDKTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEINIACI
FT                   EAKQAGETIASLTDVTKRSHLESDGQVTILTDKTGVVQAARLLLSSVTKVLLLADRVVI
FT                   KQIVTSRNKILATMERLEKVNSFQEFVQIFSQFGNEMVEFAHLTGDRQNDLKDEKKKAR
FT                   MAVARAVLEKGTMMLLTASKTCLRHPSCESAHTNKEGVFDRMRVALEKVTEIVTDCRLS
FT                   GETDSSSVSIFTGIKELKVNIEALRENVCFESKENLSAALEAVLEHVEDFTDSAYTSHE
FT                   HRERILELSSQARTELQQLLSVWMQTQSRKTKSAAEELELTVLKISHSLDELRRELHCT
FT                   AMQLAADLLKFHADHVVLKALKVTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHISG
FT                   TEPLEITCIHAEETFQVTGQQIISAAETLTLHPSSKIAKENLDVFCEAWESQMSDMATL
FT                   LREISDVFEGRRGERCDHLSLPKPTKNSANLKSLKPDKPDSEEQAKIAKLGLKLGLLSS
FT                   DADCEIEKWEDEENEIVRHGRNMSRMAYSLYLFTRGEGPLKTSQDLIHFLEVFAAEGLK
FT                   LTSSVQSFSKQLKDDDKLMLLLEINKLIPLCHQLQTITKTSLQSKVFLKVDKCITKIRS
FT                   MMTLVVQLLSLCYKLLKKMENNRWGSATNKDTMDGQN"
FT   assembly_gap    13943948..13944064
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    13950816..13950835
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13966146..14036286)
FT                   /gene="D730040F13Rik"
FT                   /locus_tag="mCG_113494"
FT                   /note="gene_id=mCG113494.0"
FT   mRNA            complement(join(13966146..13966689,13967903..13968123,
FT                   13973865..13974059,13976383..13976557,13978664..13978764,
FT                   13987005..13987150,13987285..13987407,13992109..13992240,
FT                   13994406..13994504,13998346..13998436,14000265..14000347,
FT                   14005175..14005279,14011821..14011990,14014658..14014774,
FT                   14025158..14025259,14026651..14026768,14035705..14036286))
FT                   /gene="D730040F13Rik"
FT                   /locus_tag="mCG_113494"
FT                   /product="RIKEN cDNA D730040F13, transcript variant
FT                   mCT114578"
FT                   /note="gene_id=mCG113494.0 transcript_id=mCT114578.0
FT                   created on 07-JUN-2002"
FT   mRNA            complement(join(13967903..13968123,13973865..13974059,
FT                   13976383..13976557,13978664..13978764,13987005..13987150,
FT                   13987285..13987407,13991401..13991436,13992109..13992240,
FT                   13994406..13994504,13998346..13998436,14000265..14000347,
FT                   14005175..14005279,14011821..14011990,14013461..14013697,
FT                   14014658..14014774,14025158..14025259,14026651..14026768,
FT                   14035705..>14036033))
FT                   /gene="D730040F13Rik"
FT                   /locus_tag="mCG_113494"
FT                   /product="RIKEN cDNA D730040F13, transcript variant
FT                   mCT189526"
FT                   /note="gene_id=mCG113494.0 transcript_id=mCT189526.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(13968078..13968123,13973865..13974059,
FT                   13976383..13976557,13978664..13978764,13987005..13987150,
FT                   13987285..13987407,13992109..13992240,13994406..13994504,
FT                   13998346..13998436,14000265..14000347,14005175..14005279,
FT                   14011821..14011990,14014658..14014774,14025158..14025259,
FT                   14026651..14026768,14035705..14036271))
FT                   /codon_start=1
FT                   /gene="D730040F13Rik"
FT                   /locus_tag="mCG_113494"
FT                   /product="RIKEN cDNA D730040F13, isoform CRA_a"
FT                   /note="gene_id=mCG113494.0 transcript_id=mCT114578.0
FT                   protein_id=mCP53541.1 isoform=CRA_a"
FT                   /protein_id="EDL02251.1"
FT                   /translation="MADRGGPAEAPSPRGSPRPESRAPRTVGPGETPRTAALALRFDKP
FT                   IKQAFYNTGAVLFVCLCCGAAVLVYFILEAFLRPLLWAVLCGTFLHPFKSSLTRLGRLW
FT                   LRRLHRAHTPIVLAALLLPLCFADYGVEALGEQALRRRRLLLLLGAGGPLLYGLYCLGS
FT                   YLGVQVLLAHAGALICRGLDYFSSLWIWTLVVGYVLMVSFKWNASTQRYLRAVSIPVWM
FT                   ILLFHIASLAGSWRIPVFLVIVFLMSVGTLYEKQNEKESAGAELPGQVISMAASTLANL
FT                   AISITGYESSTEDQPSDPPTVWIIKKLVIHFGVVGFLEKRCRAWWQVIECFLKERQEAL
FT                   APWPIIGLGKFLLKVDSKMIIWLEKMLDKIISIFIIFLLVIGTLLLALLLTAKVHQESV
FT                   HMIEVTSSLINETLANHPEWANWLPEAQVVQRALNSAANNVYQYGREWITHKLHKILGD
FT                   KVNNTAVIEKQVLELWDRLYHSWFVKNVTHSGRHKGHKMHVSRQNSWLGDILDWQDIAS
FT                   FVHENIETFLSILESLWIVMSRNVSLLFTTVTTLLTILFYSGTALLNFVLSLIIFLTTL
FT                   FYLLSSSDEYYKPVKWVISLTPLSQPGPSSNIIGQSVEEAIRGVFDASLKMAGFYGLYT
FT                   WLTHTIFGINIVFIPSALAAILGAVPFLGTYWAAVPAVLDLWLTQGLGCKAILLLVFHL
FT                   LPTYFVDTAIYSDISGGGHPYLTGLAVAGGAYYLGLEGAIIGPILLCILVVASNIYSAM
FT                   LVSPTNSMPTPNQTPWPAQTQRTFRDISEDLKSSVD"
FT   CDS             complement(join(13968078..13968123,13973865..13974059,
FT                   13976383..13976557,13978664..13978764,13987005..13987150,
FT                   13987285..13987407,13991401..13991436,13992109..13992240,
FT                   13994406..13994504,13998346..13998436,14000265..14000347,
FT                   14005175..14005279,14011821..14011990,14013461..14013697,
FT                   14014658..14014774,14025158..14025259,14026651..14026768,
FT                   14035705..>14036031))
FT                   /codon_start=1
FT                   /gene="D730040F13Rik"
FT                   /locus_tag="mCG_113494"
FT                   /product="RIKEN cDNA D730040F13, isoform CRA_b"
FT                   /note="gene_id=mCG113494.0 transcript_id=mCT189526.0
FT                   protein_id=mCP110470.0 isoform=CRA_b"
FT                   /protein_id="EDL02252.1"
FT                   /translation="LWAVLCGTFLHPFKSSLTRLGRLWLRRLHRAHTPIVLAALLLPLC
FT                   FADYGVEALGEQALRRRRLLLLLGAGGPLLYGLYCLGSYLGVQVLLAHAGALICRGLDY
FT                   FSSLWIWTLVVGYVLMVSFKWNASTQRYLRAVSIPVWMILLFHIASLAGSWRIPVFLVI
FT                   VFLMSVGTLYEKQNEKESAGAELPGQVISMAASTLANLAISITGYESSTEDQPSDPPTE
FT                   PTDKGEPPPALSASSSSSSRSSPSSPSPTLGRQRPEMGTFLRKKKTSDIYFVSLVWAII
FT                   AVQLWLNLWIVQLLPVPVAVWIIKKLVIHFGVVGFLEKRCRAWWQVIECFLKERQEALA
FT                   PWPIIGLGKFLLKVDSKMIIWLEKMLDKIISIFIIFLLVIGTLLLALLLTAKVHQESVH
FT                   MIEVTSSLINETLANHPEWANWLPEAQVVQRALNSAANNVYQYGREWITHKLHKILGDK
FT                   VNNTAVIEKQVLELWDRLYHSWFVKNVTHSGRHKGHKMHVSRQNSWLGDILDWQDIASF
FT                   VHENIETFLSILSFGFQIWKMKILESLWIVMSRNVSLLFTTVTTLLTILFYSGTALLNF
FT                   VLSLIIFLTTLFYLLSSSDEYYKPVKWVISLTPLSQPGPSSNIIGQSVEEAIRGVFDAS
FT                   LKMAGFYGLYTWLTHTIFGINIVFIPSALAAILGAVPFLGTYWAAVPAVLDLWLTQGLG
FT                   CKAILLLVFHLLPTYFVDTAIYSDISGGGHPYLTGLAVAGGAYYLGLEGAIIGPILLCI
FT                   LVVASNIYSAMLVSPTNSMPTPNQTPWPAQTQRTFRDISEDLKSSVD"
FT   mRNA            complement(join(13973463..13974059,13976383..13976557,
FT                   13978664..13978764,13987005..13987150,13987285..13987407,
FT                   13991401..13991436,13991543..13992240,13994406..13994504,
FT                   13998346..13998436,14000265..14000347,14005175..14005279,
FT                   14011821..14011990,14013461..14013697,14014658..14014774,
FT                   14025158..14025259,14026651..14026768,14035705..>14036284))
FT                   /gene="D730040F13Rik"
FT                   /locus_tag="mCG_113494"
FT                   /product="RIKEN cDNA D730040F13, transcript variant
FT                   mCT189527"
FT                   /note="gene_id=mCG113494.0 transcript_id=mCT189527.0
FT                   created on 08-MAR-2004"
FT   assembly_gap    13982718..13982880
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    13986132..13986151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(13992076..13992240,13994406..13994504,
FT                   13998346..13998436,14000265..14000347,14005175..14005279,
FT                   14011821..14011990,14013461..14013697,14014658..14014774,
FT                   14025158..14025259,14026651..14026768,14035705..>14036283))
FT                   /codon_start=1
FT                   /gene="D730040F13Rik"
FT                   /locus_tag="mCG_113494"
FT                   /product="RIKEN cDNA D730040F13, isoform CRA_c"
FT                   /note="gene_id=mCG113494.0 transcript_id=mCT189527.0
FT                   protein_id=mCP110471.0 isoform=CRA_c"
FT                   /protein_id="EDL02253.1"
FT                   /translation="GRGAMADRGGPAEAPSPRGSPRPESRAPRTVGPGETPRTAALALR
FT                   FDKPIKQAFYNTGAVLFVCLCCGAAVLVYFILEAFLRPLLWAVLCGTFLHPFKSSLTRL
FT                   GRLWLRRLHRAHTPIVLAALLLPLCFADYGVEALGEQALRRRRLLLLLGAGGPLLYGLY
FT                   CLGSYLGVQVLLAHAGALICRGLDYFSSLWIWTLVVGYVLMVSFKWNASTQRYLRAVSI
FT                   PVWMILLFHIASLAGSWRIPVFLVIVFLMSVGTLYEKQNEKESAGAELPGQVISMAAST
FT                   LANLAISITGYESSTEDQPSDPPTEPTDKGEPPPALSASSSSSSRSSPSSPSPTLGRQR
FT                   PEMGTFLRKKKTSDIYFVSLVWAIIAVQLWLNLWIVQLLPVPVAVWIIKKLVIHFGVVG
FT                   FLEKRCRAWWQVIECFLKERQEALAPWPIIGLGKFLLKVDSKMIIWLEKMLDKIISIFI
FT                   IFLLVIGTLLLALLLTAKVHQESVHMIEVTSSLINETLANHPEWANWLPEAQVVQRALN
FT                   SAANNVYQYGREWITHKLHKILGDKVNNTAVIEKQVLELWDRLYHSWFVKNVTHSGRHK
FT                   GHKMHVSRQNSWLGDILDWQDIASFVHENIETFLSVRWSGYCWLT"
FT   assembly_gap    14000518..14000854
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    14011441..14011625
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    14023566..14024174
FT                   /estimated_length=609
FT                   /gap_type="unknown"
FT   assembly_gap    14038476..14038495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14042134..14042153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14052169..>14080744)
FT                   /locus_tag="mCG_7386"
FT                   /note="gene_id=mCG7386.2"
FT   mRNA            complement(join(14052169..14052463,14057757..14058003,
FT                   14061988..14062126,14067287..14067371,14080364..>14080744))
FT                   /locus_tag="mCG_7386"
FT                   /product="mCG7386"
FT                   /note="gene_id=mCG7386.2 transcript_id=mCT6239.2 created on
FT                   07-JUN-2002"
FT   CDS             complement(join(14062068..14062126,14067287..14067371,
FT                   14080364..14080744))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7386"
FT                   /product="mCG7386"
FT                   /note="gene_id=mCG7386.2 transcript_id=mCT6239.2
FT                   protein_id=mCP15224.2"
FT                   /protein_id="EDL02250.1"
FT                   /translation="MRRARQGGGGCGRSAAARRVLAAARSRPAPAGSPLRPERPGCGIR
FT                   AQRWRGNPCGARPGYHCSCDCCWRGSLPAMPAPRTTARARGAGDPGDAREGTRARTRQC
FT                   RATTPPTAPSPASSTTCATCQRRVTLSPLLLLWTHSPKSRWKTVEELRDASDTGSQAVM
FT                   QKPVTTSLATG"
FT   assembly_gap    14064728..14065810
FT                   /estimated_length=1083
FT                   /gap_type="unknown"
FT   gene            complement(<14086062..>14131414)
FT                   /locus_tag="mCG_113492"
FT                   /note="gene_id=mCG113492.0"
FT   mRNA            complement(join(<14086062..14086131,14089889..14090034,
FT                   14098095..14098141,14100215..14100368,14107054..14107131,
FT                   14109984..14110170,14114575..14114673,14117857..14117924,
FT                   14122341..14122466,14128751..14128914,14131206..>14131414))
FT                   /locus_tag="mCG_113492"
FT                   /product="mCG113492"
FT                   /note="gene_id=mCG113492.0 transcript_id=mCT114576.1
FT                   created on 07-JUN-2002"
FT   CDS             complement(join(14086062..14086131,14089889..14090034,
FT                   14098095..14098141,14100215..14100368,14107054..14107131,
FT                   14109984..14110170,14114575..14114673,14117857..14117924,
FT                   14122341..14122466,14128751..14128914,14131206..>14131413))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113492"
FT                   /product="mCG113492"
FT                   /note="gene_id=mCG113492.0 transcript_id=mCT114576.1
FT                   protein_id=mCP53526.1"
FT                   /protein_id="EDL02249.1"
FT                   /translation="YPLPSPALSPTERLPFSLEENGGTPFAPKTSGRHHHQHQHQHHSN
FT                   YGLSLTLENKEAPLRSPNSSKALTTAFERLLFPFPAHTVELSPGTPALYSEAAAHLKKL
FT                   ELETVKAVAPWPALHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRV
FT                   NAQIGKEEPSFVNINKKSNLQDTNVRSPIPIRVEAAQPAVEKPEIKPPRVRRLTRQYSF
FT                   DEDDLPPDLAEAVGATTATTTTTTTTTMSATQVSVSLASPKIQKVSSPQKSEVKSPLSP
FT                   GAKSPSDHGGSLTLGPGDLLMDFTEATPLAEPASSPHCAHSRCSPPLSLPMKEETTGVC
FT                   MYRPIKTRLVGTLAGWGPAGTVMNPFPDPFTTGPQFPADFRENKLQCCPGQSSPLIPTV
FT                   TLRPLTETVATVQTIYTSRKPVSLATSAETLRQELEREKMMKRLLMTEL"
FT   assembly_gap    14097006..14097063
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    14129620..14129739
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   gene            complement(14152105..>14233461)
FT                   /locus_tag="mCG_3043"
FT                   /note="gene_id=mCG3043.1"
FT   mRNA            complement(join(14152105..14153647,14155172..14155236,
FT                   14158679..14158712,14161429..14161459,14163644..14163753,
FT                   14166619..14166788,14166862..14166931,14167242..14167330,
FT                   14167492..14167579,14169202..14169322,14174315..14174367,
FT                   14176312..14176356,14178329..14178407,14179145..14179187,
FT                   14193751..14193855,14233344..>14233461))
FT                   /locus_tag="mCG_3043"
FT                   /product="mCG3043"
FT                   /note="gene_id=mCG3043.1 transcript_id=mCT2186.1 created on
FT                   07-JUN-2002"
FT   CDS             complement(join(14153473..14153647,14155172..14155236,
FT                   14158679..14158712,14161429..14161459,14163644..14163753,
FT                   14166619..14166788,14166862..14166931,14167242..14167330,
FT                   14167492..14167579,14169202..14169322,14174315..14174367,
FT                   14176312..14176356,14178329..14178407,14179145..14179187,
FT                   14193751..14193855,14233344..>14233460))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3043"
FT                   /product="mCG3043"
FT                   /note="gene_id=mCG3043.1 transcript_id=mCT2186.1
FT                   protein_id=mCP15235.1"
FT                   /protein_id="EDL02248.1"
FT                   /translation="GPCSPAARLCTSPPREAAKATLYCRVFLLDGTEVSVDLPKHAKGQ
FT                   DLFDQIVYHLDLVETDYFGLQFLDSAQVTHWLDHAKPIKKQMKVGPAYALHFRVKYYSS
FT                   EPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELV
FT                   SEFRFIPNQTEAMEFDIFQRWKEYRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGRDGC
FT                   EYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFR
FT                   LDSARTCKHLWKCAVEHHAFFRLRTPSNSKSARSDFIRLGSRFRFSGRTEYQATHGSRL
FT                   RRTSTFERKPSKRYPSRRHSTFKASNPIIAAQLCSKANPEVHNYQPQYHPDVHPSQPRW
FT                   RPHSPNVSNHSICKQNKPCFQDDRPHWKTSASGDGSHFDYVQDQNQRNLGGAYSVTYRD
FT                   KLMTAL"
FT   assembly_gap    14195634..14195872
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    14214527..14214618
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    14218580..14218599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14233463..14234330
FT                   /estimated_length=868
FT                   /gap_type="unknown"
FT   assembly_gap    14243779..14243843
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    14245403..14245422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14254531..14254596
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   gene            <14262620..14267146
FT                   /locus_tag="mCG_144946"
FT                   /note="gene_id=mCG144946.0"
FT   mRNA            join(<14262620..14262734,14263790..14263904,
FT                   14265048..14265303,14265545..14265672,14266001..14267146)
FT                   /locus_tag="mCG_144946"
FT                   /product="mCG144946"
FT                   /note="gene_id=mCG144946.0 transcript_id=mCT184370.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    14263700..14263719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<14265635..14265672,14266001..14266439)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144946"
FT                   /product="mCG144946"
FT                   /note="gene_id=mCG144946.0 transcript_id=mCT184370.0
FT                   protein_id=mCP105212.0"
FT                   /protein_id="EDL02247.1"
FT                   /translation="LHCLEPGTLKSDSHEDCESELEKHWSELFALPFLFDFCETASCQV
FT                   QLACVTSGPADAAYKRTQDNRKLSGPSDHSFRAQPPSVSFTSPHPLITAKGLPNPSAQE
FT                   AQDSRIPHRPVSICVNVLTRVFSLPETRAGALLLCCCSTWKPLGLPWLFKLNNI"
FT   assembly_gap    14265785..14265812
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    14272513..14272621
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   gene            complement(14282845..>14360818)
FT                   /locus_tag="mCG_113949"
FT                   /note="gene_id=mCG113949.1"
FT   mRNA            complement(join(14282845..14284919,14286259..14286394,
FT                   14286908..14287053,14288063..14288191,14295458..14295604,
FT                   14296436..14296497,14296765..14296855,14309062..14309222,
FT                   14312451..14312607,14314172..14314228,14316055..14316132,
FT                   14316263..14316449,14322878..14323054,14325718..14325852,
FT                   14330023..14330195,14331281..14331344,14335454..14335542,
FT                   14339128..14339215,14340410..14340530,14345419..14345471,
FT                   14348489..14348533,14353081..14353159,14355519..14355561,
FT                   14355636..14355743,14360681..>14360818))
FT                   /locus_tag="mCG_113949"
FT                   /product="mCG113949"
FT                   /note="gene_id=mCG113949.1 transcript_id=mCT115038.1
FT                   created on 07-JUN-2002"
FT   CDS             complement(join(14284842..14284919,14286259..14286394,
FT                   14286908..14287053,14288063..14288191,14295458..14295604,
FT                   14296436..14296497,14296765..14296855,14309062..14309222,
FT                   14312451..14312607,14314172..14314228,14316055..14316132,
FT                   14316263..14316449,14322878..14323054,14325718..14325852,
FT                   14330023..14330195,14331281..14331344,14335454..14335542,
FT                   14339128..14339215,14340410..14340530,14345419..14345471,
FT                   14348489..14348533,14353081..14353159,14355519..14355561,
FT                   14355636..14355743,14360681..14360818))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113949"
FT                   /product="mCG113949"
FT                   /note="gene_id=mCG113949.1 transcript_id=mCT115038.1
FT                   protein_id=mCP53371.1"
FT                   /protein_id="EDL02246.1"
FT                   /translation="MTSRLRALGGRINNTRTSELPKEKTRSEVICSIRFLDGLVQTFKV
FT                   NKQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSPRWLEASKPLRKQLKGGFPCTLH
FT                   FRVRYFIPDPNTLQQEQTRHLYFLQLKMDVCEGRLTCPLNSAVVLASYAVQSHFGDFNS
FT                   SIHHPGYLADSQFIPDQNDDFLSKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELH
FT                   GGRDLHNLDLMIGIASAGIAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESRE
FT                   HIVAFNMLNYRSCKNLWKSCVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKKSVNNQY
FT                   CKKVIGGMVWNPVMRRSLSVERLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNL
FT                   ANEMTYITETEDVFYTYKGPLSPKDSDSEVSQNHSPHRESLSENNPAQSCLTQKSSSSV
FT                   SPSSNAPGSCSPDGVDQRFLEDYHKVTKGGFVEDASQYYCDKSDDGDGYLVLIRITPDE
FT                   EGRFGFNLKGGVDQKMPLVVSRINPESPADTCMPKLNEGDQIVLINGRDISEHTHDQVV
FT                   MFIKASRESHSRELALVIRRKAVRSLAEIRSEDELSQLFPEAMFPACPEGGDSLEGSME
FT                   LLKKGLESGTVLIQFEQLYRKKPGLAVSFAKLPQNLDKNRYKDVLPYDTTRVLLQGNED
FT                   YINASYVNMEMPAANLVNKYIATQGPLPNTCAQFWQVVWDQKLSLVVMLTTLTERGRTK
FT                   CHQYWPDPPDIMDHGIFHIQCQTEDCTIAYVSREMLVTNTETGEEHTVTHLQYVAWPDH
FT                   GVPDDSSDFLEFVKYVRSLRVDGEPALVHCSAGIGRTGVLVTMETAMCLIERNLPVYPL
FT                   DIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQRLDPS"
FT   assembly_gap    14320207..14320333
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    14340322..14340352
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    14350118..14350256
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    14361444..14361470
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    14363035..14363268
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   gene            complement(<14366663..>14371507)
FT                   /locus_tag="mCG_1041342"
FT                   /note="gene_id=mCG1041342.0"
FT   mRNA            complement(join(<14366663..14366807,14370794..>14371507))
FT                   /locus_tag="mCG_1041342"
FT                   /product="mCG1041342"
FT                   /note="gene_id=mCG1041342.0 transcript_id=mCT159046.0
FT                   created on 07-JUN-2002"
FT   CDS             complement(join(<14366663..14366807,14370794..>14370977))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041342"
FT                   /product="mCG1041342"
FT                   /note="gene_id=mCG1041342.0 transcript_id=mCT159046.0
FT                   protein_id=mCP53487.0"
FT                   /protein_id="EDL02245.1"
FT                   /translation="VSVVCARVRVVRLTTCLWRSESKRVLLTLGILPCWRSGSLFCIPL
FT                   LCTVFQVNWPLSFWKFCWLCLPSAGMKGMCHHARFMLPGFYVGAGIRTPILQSSGWMLS
FT                   ALSTDS"
FT   assembly_gap    14368580..14368599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14382595..14382698
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    14391175..14391286
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    14420073..14420192
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    14433636..14433693
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    14447947..14448017
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            14451272..14451692
FT                   /locus_tag="mCG_1041341"
FT                   /note="gene_id=mCG1041341.1"
FT   mRNA            14451272..14451692
FT                   /locus_tag="mCG_1041341"
FT                   /product="mCG1041341"
FT                   /note="gene_id=mCG1041341.1 transcript_id=mCT159045.1
FT                   created on 07-JUN-2002"
FT   CDS             14451376..14451543
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041341"
FT                   /product="mCG1041341"
FT                   /note="gene_id=mCG1041341.1 transcript_id=mCT159045.1
FT                   protein_id=mCP53485.1"
FT                   /protein_id="EDL02244.1"
FT                   /translation="MCPLETSCLTLRGQTYKKGGTWLLLCRFYVRKRGDTGLDSQVAGL
FT                   YSMDLGMHTQ"
FT   assembly_gap    14452754..14452773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14456653..14456684
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   gene            complement(14461766..14463063)
FT                   /pseudo
FT                   /locus_tag="mCG_113945"
FT                   /note="gene_id=mCG113945.2"
FT   mRNA            complement(14461766..14463063)
FT                   /pseudo
FT                   /locus_tag="mCG_113945"
FT                   /note="gene_id=mCG113945.2 transcript_id=mCT115034.2
FT                   created on 23-MAY-2003"
FT   assembly_gap    14469800..14470268
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   assembly_gap    14475836..14475855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14477395..14477472
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   gene            complement(14503208..>14505135)
FT                   /locus_tag="mCG_2709"
FT                   /note="gene_id=mCG2709.2"
FT   mRNA            complement(14503208..>14505135)
FT                   /locus_tag="mCG_2709"
FT                   /product="mCG2709"
FT                   /note="gene_id=mCG2709.2 transcript_id=mCT2178.2 created on
FT                   07-JUN-2002"
FT   CDS             complement(14504650..>14505057)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2709"
FT                   /product="mCG2709"
FT                   /note="gene_id=mCG2709.2 transcript_id=mCT2178.2
FT                   protein_id=mCP15223.1"
FT                   /protein_id="EDL02243.1"
FT                   /translation="VLAIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYVF
FT                   LHTVKGTPFETPDQGKARLLTHWEQMDHEVQFTASRKFLTITPIVLYFLTSFYTKYDQV
FT                   HFILNTVSLMTVLMPKFPQLHGVRIFGINKC"
FT   assembly_gap    14518893..14518912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14537253..14537527
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   gene            complement(14546804..14548789)
FT                   /pseudo
FT                   /locus_tag="mCG_1041275"
FT                   /note="gene_id=mCG1041275.1"
FT   mRNA            complement(join(14546804..14547342,14548135..14548789))
FT                   /pseudo
FT                   /locus_tag="mCG_1041275"
FT                   /note="gene_id=mCG1041275.1 transcript_id=mCT158979.1
FT                   created on 07-JUN-2002"
FT   assembly_gap    14550539..14550558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14553023..14553143
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    14565357..14565461
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    14588018..14589120
FT                   /estimated_length=1103
FT                   /gap_type="unknown"
FT   assembly_gap    14596771..14596790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <14660434..14987112
FT                   /locus_tag="mCG_2708"
FT                   /note="gene_id=mCG2708.2"
FT   mRNA            join(<14660434..14660478,14729388..14729468,
FT                   14739374..14739504,14779835..14779949,14780942..14780963,
FT                   14849267..14849349,14946647..14949122,14975545..14975659,
FT                   14985650..14987112)
FT                   /locus_tag="mCG_2708"
FT                   /product="mCG2708, transcript variant mCT2183"
FT                   /note="gene_id=mCG2708.2 transcript_id=mCT2183.1 created on
FT                   20-NOV-2002"
FT   CDS             join(14660434..14660478,14729388..14729468,
FT                   14739374..14739504,14779835..14779949,14780942..14780963,
FT                   14849267..14849349,14946647..14949122,14975545..14975659,
FT                   14985650..14985830)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2708"
FT                   /product="mCG2708, isoform CRA_c"
FT                   /note="gene_id=mCG2708.2 transcript_id=mCT2183.1
FT                   protein_id=mCP15222.1 isoform=CRA_c"
FT                   /protein_id="EDL02242.1"
FT                   /translation="MAEAELHKERLQAIAEKRKRQTEIEGKRRQLDEQVLLLQHSKSKV
FT                   LREKWLLQGVPAGTAEEEEARRRQSEEDEFKVKQLEDNIQRLEQEIQALESEESQISAK
FT                   EQIILEKLKETEKSFKDLQKSFSTADGASGWSTVLLQGDELTADPIGTNADMAIQKPPQ
FT                   LSEDANQLRSKQDNCGDSRLEPAASSLSPDHKNMEIGVSVAECKSVPGVTSTPHSKDHS
FT                   SPFYSPSHNGLLADHHESLDNDVAREIQYLDEVLEANCCDSSVDGTYNGISSPEPGAAI
FT                   LVSSLGSPAHSVTEAEPTEKASGRQVPPHIELSRSPSDRMAEGERANGHSTDQPQDLLG
FT                   NSLQAPASPSSSTSSHCSSRDGEFTLTTLKKEAKFELRAFHEDKKPSKLFEEDEREKEQ
FT                   FCVRKVRPSEEMIELEKERRELIRSQAVKKNPGIAAKWWNPPQEKTIEEQLDEEHLESH
FT                   RKYKERKEKRAQQEQLQLQQQQQQQLQQQQLQQQQLQQQQLQQQLQQQQLSTSQPCTAP
FT                   AAHKHLDGIEHTKEDVVTEQIDFSAARKQFQLMENSRQTLAKGQSTPRLFSIKPYYKPL
FT                   GSIHSDKPPTILRPATVGGTLEDGGTQAAKEQKAPCVSESQSAGAGPANAATQGKEGPY
FT                   SEPSKRGPLSKLWAEDGEFTSARAVLTVVKDEDHGILDQFSRSVNVSLTQEELDSGLDE
FT                   LSVRSQDTTVLETLSNDFSMDNISDSGASNETPSALQENSLADFSLPQTPQTDNPSEGR
FT                   EGVSKSFSDHGFYSPSSTLGDSPSVDDPLEYQAGLLVQNAIQQAIAEQVDKAEAHTSKE
FT                   GSEQQEPEATVEEAGSQTPGSEKPQGMFAPPQVSSPVQEKRDILPKNLPAEDRALREKG
FT                   PSQPPTAAQPSGPVNMEETRPEGGYFSKYSEAAELRSTASLLATQESDVMVGPFKLRSR
FT                   KQRTLSMIEEEIRAAQEREEELKRQRQVRQSTPSPRAKNAPSLPSRTTCYKTAPEIEKV
FT                   KPPPSPTTEGPSLQPDLAPEEAAGTQRPKNLMQTSWRPHGLIGGRVLWPCAGRQGFTLT
FT                   RKRRTTNKLPSAQETSLLKEFLQRNQEIIESEAF"
FT   mRNA            join(<14660434..14660478,14729388..14729468,
FT                   14739374..14739504,14779835..14779949,14780942..14780963,
FT                   14789914..14790012,14800872..14801605)
FT                   /locus_tag="mCG_2708"
FT                   /product="mCG2708, transcript variant mCT169892"
FT                   /note="gene_id=mCG2708.2 transcript_id=mCT169892.0 created
FT                   on 20-NOV-2002"
FT   CDS             join(14660434..14660478,14729388..14729468,
FT                   14739374..14739504,14779835..14779949,14780942..14780963,
FT                   14789914..14789939)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2708"
FT                   /product="mCG2708, isoform CRA_a"
FT                   /note="gene_id=mCG2708.2 transcript_id=mCT169892.0
FT                   protein_id=mCP92498.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9P1"
FT                   /db_xref="InterPro:IPR004965"
FT                   /db_xref="MGI:MGI:1934601"
FT                   /db_xref="MGI:MGI:5141924"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9P1"
FT                   /protein_id="EDL02240.1"
FT                   /translation="MAEAELHKERLQAIAEKRKRQTEIEGKRRQLDEQVLLLQHSKSKV
FT                   LREKWLLQGVPAGTAEEEEARRRQSEEDEFKVKQLEDNIQRLEQEIQALESEESQISAK
FT                   EQIILEKLKETEKSFKDLQKSFSTADGDAVCYISS"
FT   assembly_gap    14686641..14686660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14689727..14689746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14696539..14696862
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    14717028..14717047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14729271..14729290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14765222..14765566
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    14768485..14768622
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    14804262..14804281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14813123..14813142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14839870..14839907
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    14853195..14853235
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    14859829..14860073
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    14863665..14863684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14865998..14866722
FT                   /estimated_length=725
FT                   /gap_type="unknown"
FT   assembly_gap    14871721..14871778
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    14882846..14883706
FT                   /estimated_length=861
FT                   /gap_type="unknown"
FT   assembly_gap    14886775..14886794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14903084..14903688
FT                   /estimated_length=605
FT                   /gap_type="unknown"
FT   mRNA            join(14946244..14949122,14985650..14986472)
FT                   /locus_tag="mCG_2708"
FT                   /product="mCG2708, transcript variant mCT176171"
FT                   /note="gene_id=mCG2708.2 transcript_id=mCT176171.0 created
FT                   on 20-NOV-2002"
FT   CDS             join(14946758..14949122,14985650..14985672)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2708"
FT                   /product="mCG2708, isoform CRA_b"
FT                   /note="gene_id=mCG2708.2 transcript_id=mCT176171.0
FT                   protein_id=mCP99093.0 isoform=CRA_b"
FT                   /protein_id="EDL02241.1"
FT                   /translation="MEIGVSVAECKSVPGVTSTPHSKDHSSPFYSPSHNGLLADHHESL
FT                   DNDVAREIQYLDEVLEANCCDSSVDGTYNGISSPEPGAAILVSSLGSPAHSVTEAEPTE
FT                   KASGRQVPPHIELSRSPSDRMAEGERANGHSTDQPQDLLGNSLQAPASPSSSTSSHCSS
FT                   RDGEFTLTTLKKEAKFELRAFHEDKKPSKLFEEDEREKEQFCVRKVRPSEEMIELEKER
FT                   RELIRSQAVKKNPGIAAKWWNPPQEKTIEEQLDEEHLESHRKYKERKEKRAQQEQLQLQ
FT                   QQQQQQLQQQQLQQQQLQQQQLQQQLQQQQLSTSQPCTAPAAHKHLDGIEHTKEDVVTE
FT                   QIDFSAARKQFQLMENSRQTLAKGQSTPRLFSIKPYYKPLGSIHSDKPPTILRPATVGG
FT                   TLEDGGTQAAKEQKAPCVSESQSAGAGPANAATQGKEGPYSEPSKRGPLSKLWAEDGEF
FT                   TSARAVLTVVKDEDHGILDQFSRSVNVSLTQEELDSGLDELSVRSQDTTVLETLSNDFS
FT                   MDNISDSGASNETPSALQENSLADFSLPQTPQTDNPSEGREGVSKSFSDHGFYSPSSTL
FT                   GDSPSVDDPLEYQAGLLVQNAIQQAIAEQVDKAEAHTSKEGSEQQEPEATVEEAGSQTP
FT                   GSEKPQGMFAPPQVSSPVQEKRDILPKNLPAEDRALREKGPSQPPTAAQPSGPVNMEET
FT                   RPEGGYFSKYSEAAELRSTASLLATQESDVMVGPFKLRSRKQRTLSMIEEEIRAAQERE
FT                   EELKRQRQVRQSTPSPRAKNAPSLPSRTTCYKTAPGPGGHTG"
FT   assembly_gap    14960457..14960914
FT                   /estimated_length=458
FT                   /gap_type="unknown"
FT   assembly_gap    14968259..14968495
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    14975661..14976183
FT                   /estimated_length=523
FT                   /gap_type="unknown"
FT   gene            complement(14988304..14989765)
FT                   /locus_tag="mCG_1041308"
FT                   /note="gene_id=mCG1041308.1"
FT   mRNA            complement(14988304..14989765)
FT                   /locus_tag="mCG_1041308"
FT                   /product="mCG1041308"
FT                   /note="gene_id=mCG1041308.1 transcript_id=mCT159012.1
FT                   created on 06-JUN-2002"
FT   CDS             complement(14989050..14989373)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041308"
FT                   /product="mCG1041308"
FT                   /note="gene_id=mCG1041308.1 transcript_id=mCT159012.1
FT                   protein_id=mCP53434.1"
FT                   /protein_id="EDL02239.1"
FT                   /translation="MSLNTTINTVLVFLVRVCVCVYVCVCVCVQAHRVCMCISVCEWIL
FT                   IYILLLCHCLGWAACMGKRKGHAPCSPSATQPLPPTDPASLISRGERPGCQVTGSGGKC
FT                   SGV"
FT   gene            complement(<15002877..15009403)
FT                   /gene="D630039A03Rik"
FT                   /locus_tag="mCG_1041274"
FT                   /note="gene_id=mCG1041274.1"
FT   mRNA            complement(join(<15002877..15003388,15008500..15009403))
FT                   /gene="D630039A03Rik"
FT                   /locus_tag="mCG_1041274"
FT                   /product="RIKEN cDNA D630039A03"
FT                   /note="gene_id=mCG1041274.1 transcript_id=mCT158978.1
FT                   created on 06-JUN-2002"
FT   CDS             complement(join(15002877..15003388,15008500..15008698))
FT                   /codon_start=1
FT                   /gene="D630039A03Rik"
FT                   /locus_tag="mCG_1041274"
FT                   /product="RIKEN cDNA D630039A03"
FT                   /note="gene_id=mCG1041274.1 transcript_id=mCT158978.1
FT                   protein_id=mCP53562.1"
FT                   /db_xref="GOA:Q8K0M7"
FT                   /db_xref="InterPro:IPR032738"
FT                   /db_xref="MGI:MGI:2442889"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K0M7"
FT                   /protein_id="EDL02238.1"
FT                   /translation="MRMKGLACPCPALPKFLELGTCLMAEGSRTQAPGQGPPVNIQFLR
FT                   AQYEGLRKQQRTQAHLMVFPKEGTMPTPAESMTSAVWINKERRSSLSPEETDSEAEGML
FT                   EEGDRSCHQASETPWHTYLELHRLVQTFHLEAGHQGNPKGYLVEPEPRFSPEGDTDVLK
FT                   NNQKTQQEVKIPEVAQCQSQEGCAPLQVAGSRAQYLSSTKHLRSGKPAYYPFPQRKPPR
FT                   ISQAARNLGLYGPP"
FT   assembly_gap    15007088..15007311
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    15036100..15036187
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   gene            complement(15036337..15049272)
FT                   /locus_tag="mCG_2706"
FT                   /note="gene_id=mCG2706.2"
FT   mRNA            complement(join(15036337..15036931,15038006..15038071,
FT                   15043698..15043757,15044656..15044760,15049046..15049272))
FT                   /locus_tag="mCG_2706"
FT                   /product="mCG2706"
FT                   /note="gene_id=mCG2706.2 transcript_id=mCT2181.1 created on
FT                   06-JUN-2002"
FT   CDS             complement(join(15036869..15036931,15038006..15038071,
FT                   15043698..15043757,15044656..15044760,15049046..15049069))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2706"
FT                   /product="mCG2706"
FT                   /note="gene_id=mCG2706.2 transcript_id=mCT2181.1
FT                   protein_id=mCP15287.1"
FT                   /protein_id="EDL02237.1"
FT                   /translation="MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSL
FT                   CDKYSNVVFLEVDVDDCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEY
FT                   A"
FT   assembly_gap    15037662..15037695
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    15053194..15053303
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    15065822..15065841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15068026..15068045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15076841..>15101975)
FT                   /gene="Txndc8"
FT                   /locus_tag="mCG_2704"
FT                   /note="gene_id=mCG2704.1"
FT   mRNA            complement(join(15076841..15077042,15078389..15078454,
FT                   15093095..15093160,15095250..15095309,15099925..15100027,
FT                   15101852..>15101975))
FT                   /gene="Txndc8"
FT                   /locus_tag="mCG_2704"
FT                   /product="thioredoxin domain containing 8"
FT                   /note="gene_id=mCG2704.1 transcript_id=mCT2179.0 created on
FT                   06-JUN-2002"
FT   CDS             complement(join(15076980..15077042,15078389..15078454,
FT                   15093095..15093160,15095250..15095309,15099925..15100027,
FT                   15101852..>15101862))
FT                   /codon_start=1
FT                   /gene="Txndc8"
FT                   /locus_tag="mCG_2704"
FT                   /product="thioredoxin domain containing 8"
FT                   /note="gene_id=mCG2704.1 transcript_id=mCT2179.0
FT                   protein_id=mCP15285.0"
FT                   /protein_id="EDL02236.1"
FT                   /translation="EHGNELKELFSDAGNKLVVVEFSAKWCGPCKTIAPVFQAMSLKYQ
FT                   NVTFAQVDVDSSKELAEHCDITMLPTFQMFKYTQKVTPFSRLKRVLCCLRSGPKSKMIF
FT                   ECHGADAKQLEKKIQELM"
FT   assembly_gap    15080820..15080839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15104614..15106563
FT                   /estimated_length=1950
FT                   /gap_type="unknown"
FT   assembly_gap    15118507..15118632
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    15133874..15134044
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   gene            complement(15135003..15150955)
FT                   /locus_tag="mCG_113948"
FT                   /note="gene_id=mCG113948.1"
FT   mRNA            complement(join(15135003..15135719,15141661..15141831,
FT                   15145670..15145846,15150481..15150552,15150937..15150955))
FT                   /locus_tag="mCG_113948"
FT                   /product="mCG113948"
FT                   /note="gene_id=mCG113948.1 transcript_id=mCT115037.1
FT                   created on 06-JUN-2002"
FT   CDS             complement(join(15135649..15135719,15141661..15141831,
FT                   15145670..15145846,15150481..15150552,15150937..15150940))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113948"
FT                   /product="mCG113948"
FT                   /note="gene_id=mCG113948.1 transcript_id=mCT115037.1
FT                   protein_id=mCP53369.1"
FT                   /protein_id="EDL02235.1"
FT                   /translation="MDSQGNRERICQENRQWSGEVAVCRANPCPVPFVIPENAVLSEKE
FT                   FYVDQNVSIKCREGFLLKGNGVITCSPDETWTHTNARCEKISCGPPSHVENAIARGVYY
FT                   QYGDMITYSCYSGYMLEGSLRSVCLENGTWTPSPVCRGKGEPGFDLMPHPLSLSSIISF
FT                   R"
FT   assembly_gap    15154091..15154110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<15156733..>15302698)
FT                   /locus_tag="mCG_12393"
FT                   /note="gene_id=mCG12393.1"
FT   mRNA            complement(join(<15156733..15156893,15158995..15159220,
FT                   15160923..15163705,15165229..15165901,15175210..15175377,
FT                   15176526..15176717,15177074..15177158,15177369..15177545,
FT                   15180291..15180410,15180781..15180954,15181915..15182085,
FT                   15183144..15183267,15184347..15184471,15186475..15186650,
FT                   15188633..15188834,15189758..15189915,15192417..15192618,
FT                   15193237..15193350,15196914..15197027,15198775..15198871,
FT                   15200005..15200100,15200720..15200881,15203791..15203952,
FT                   15205981..15206142,15208189..15208422,15208980..15209144,
FT                   15210617..15210725,15213037..15213158,15214319..15214513,
FT                   15215637..15215768,15216474..15216581,15221258..15221387,
FT                   15226135..15226253,15228194..15228388,15234066..15234245,
FT                   15240619..15240798,15241976..15242134,15272011..15272187,
FT                   15275555..15275810,15301945..>15302698))
FT                   /locus_tag="mCG_12393"
FT                   /product="mCG12393"
FT                   /note="gene_id=mCG12393.1 transcript_id=mCT16130.1 created
FT                   on 25-JUN-2002"
FT   CDS             complement(join(<15156733..15156893,15158995..15159220,
FT                   15160923..15163705,15165229..15165901,15175210..15175377,
FT                   15176526..15176717,15177074..15177158,15177369..15177545,
FT                   15180291..15180410,15180781..15180954,15181915..15182085,
FT                   15183144..15183267,15184347..15184471,15186475..15186650,
FT                   15188633..15188834,15189758..15189915,15192417..15192618,
FT                   15193237..15193350,15196914..15197027,15198775..15198871,
FT                   15200005..>15200061))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12393"
FT                   /product="mCG12393"
FT                   /note="gene_id=mCG12393.1 transcript_id=mCT16130.1
FT                   protein_id=mCP15284.1"
FT                   /protein_id="EDL02234.1"
FT                   /translation="CPSWPLDIPRTSTKSAVRQVFHECFLNPCHNSGTCQQLGRGYVCL
FT                   CPPGYTGLKCETDIDECSSLPCLNGGICRDQVGGFTCECSLGYSGQICEENINECISSP
FT                   CLNKGTCTDGLASYRCTCVKGYMGVHCETDVNECQSSPCLNNAVCKDQVGGFSCKCPPG
FT                   FLGTRCEKNVDECLSQPCQNGATCKDGANSFRCQCPAGFTGTHCELNINECQSNPCRNQ
FT                   ATCVDELNSYSCKCQPGFSGHRCETEQPSGFNLDFEVSGIYGYVLLDGVLPTLHAITCA
FT                   FWMKSSDVINYGTPISYALEDDKDNTFLLTDYNGWVLYVNGKEKITNCPSVNDGIWHHI
FT                   AITWTSTGGAWRVYIDGELSDGGTGLSIGKAIPGGGALVLGQEQDKKGEGFNPAESFVG
FT                   SISQLNLWDYVLSPQQVKLLASSCPEELSRGNVLAWPDFLSGITGKVKVDSSSMFCSDC
FT                   PSLEGSVPHLRPASGNRKPGSKVSLFCDPGFQMVGNPVQYCLNQGQWTQPLPHCERIRC
FT                   GLPPALENGFYSAEDFHAGSTVTYQCTSGYYLLGDSRMFCTDNGSWNGISPSCLDVDEC
FT                   AVGSDCSEHASCLNTNGSYVCSCNPPYTGDGKNCAEPVKCKAPENPENGHSSGEIYTVG
FT                   TAVTFSCDEGHELVGVSTITCLETGEWDRLRPSCEAISCGVPPVPENGGVDGSAFTYGS
FT                   KVVYRCDKGYTLSGDEESACLASGSWSHSSPVCELVKCSQPEDINNGKYILSGLTYLSI
FT                   ASYSCENGYSLQGPSLLECTASGSWDRAPPSCQLVSCGEPPIVKDAVITGSNFTFGNTV
FT                   AYTCKEGYTLAGPDTIICQANGKWNSSNHQCLAVSCDEPPNVDHASPETAHRLFGDTAF
FT                   YYCADGYSLADNSQLICNAQGNWVPPAGQAVPRCIAHFCEKPPSVSYSILESVSKAKFA
FT                   AGSVVSFKCMEGFVLNTSAKIECLRGGEWSPSPLSVQCIPVRCGEPPSIANGYPSGTNY
FT                   SFGAVVAYSCHKGFYIKGEKKSTCEATGQWSKPTPTCHPVSCNEPPKVENGFLEHTTGR
FT                   TFESEARFQCNPGYKAAGSPVFVCQANRHWHSDAPLSCTPLNCGKPPPIQNGFLKGESF
FT                   EVGSKVQFVCNEGYELVGDNSWTCQKSGKWSKKPSPKCVPTKCAEPPLLENQLVLKELA
FT                   SEVGVMTISCKEGHALQGPSVLKCLPSGQWNGSFPICKMVLCPSPPLIPFGVPASSGAL
FT                   HFGSTVKYLCVDGFFLRGSPTILCQADSTWSSPLPECVPVECPQPEEILNGIIHVQGLA
FT                   YLSTTLYTCKPGFELVGNATTLCGENGQWLGGKPMCKPIECPEPKEILNGQFSSVSFQY
FT                   GQTITYFCDRGFRLEGPKSLTCLETGDWDMDPPSCDAIHCSDPQPIENGFVEGADYRYG
FT                   AMIIYSCFPGFQVLGHAMQTCEESGWSSSSPTCVPIDCGLPPHIDFGDCTKVRDGQGHF
FT                   DQEDDMMEVPYLAHPQHLEATAKALENTKESPASHASHFLYGTMVSYSCEPGYELLGIP
FT                   VLICQEDGTWNGTAPSCISIECDLPVAPENGFLHFTQTTMGSAAQYSCKPGHILEGSHL
FT                   RLCLQNKQWSGTVPRCEAISCSKPNPLWNGSIKGDDYSYLGVLYYECDSGYILNGSKKR
FT                   TCQENRDWDGHEPMCIPVDCGSPPVPTNGRVKGEEYTFQKEITYSCREGFILEGARSRI
FT                   CLTNGSWSGATPSCMPVRCPAPPQVPNGVADGLDYGFKKEVAFHCLEGYVLQGAPRLTC
FT                   QSNGTWDAEVPVCKPATCGPPADLPQGFPNGFSFYHGGHIQYQCFTGYKLHGNPSRRCL
FT                   PNGSWSGSSPSCLPCRCSTPIIQQGTINATDLGCGKTVQIECFKGFKLLGLSEITCDAN
FT                   GQWSDVPLCEHAQCGPLPTIPNAIVLEGSLSEDNVVTYSCRPGYTMQGSSDLICTEKAI
FT                   WSQPYPTCEPLSCGPPPTVANAVATGEAHTYESKVKLRCLEGYVMDSDTDTFTCQQDGH
FT                   WVPERITCSPKKCPVPSNMTRIRFHGDDFQVNRQVSVSCAEGFTHEGVNWSTCQPDGTW
FT                   EPPFSDESCIPVVCGHPESPAHGSVVGNKHSFGSTIVYQCDPGYKLEV"
FT   assembly_gap    15222129..15222148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15227457..15227476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15229317..15229336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15231827..15231846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15233463..15233482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15244509..15244528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15245632..15246385
FT                   /estimated_length=754
FT                   /gap_type="unknown"
FT   assembly_gap    15248029..15248048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15273802..15273821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15306403..15306624
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    15313437..15313685
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    15315784..15315803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15324065..15324084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15334890..15335332)
FT                   /pseudo
FT                   /locus_tag="mCG_1041338"
FT                   /note="gene_id=mCG1041338.1"
FT   mRNA            complement(15334890..15335332)
FT                   /pseudo
FT                   /locus_tag="mCG_1041338"
FT                   /note="gene_id=mCG1041338.1 transcript_id=mCT159042.1
FT                   created on 05-JUN-2002"
FT   gene            complement(<15346909..>15365067)
FT                   /locus_tag="mCG_1041337"
FT                   /note="gene_id=mCG1041337.0"
FT   mRNA            complement(join(<15346909..15347247,15364956..>15365067))
FT                   /locus_tag="mCG_1041337"
FT                   /product="mCG1041337"
FT                   /note="gene_id=mCG1041337.0 transcript_id=mCT159041.0
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(15346909..15347247,15364956..>15365066))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041337"
FT                   /product="mCG1041337"
FT                   /note="gene_id=mCG1041337.0 transcript_id=mCT159041.0
FT                   protein_id=mCP53473.0"
FT                   /protein_id="EDL02233.1"
FT                   /translation="CVRASVCVCVCVCVCVCVCVCTSEGISLYLFIYVPFAGFTALSVS
FT                   LCLSLCFSLCVSVSVFLRLSLFLSVCLCFCLSPSLSLFLSLCFSLSVSLSLSLSLCLCL
FT                   CLCLCLCLCLSLSLSHTHTHTHTHTHTVSKNRWMSSLCLLASSII"
FT   assembly_gap    15352763..15352782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15354177..15354439
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   gene            <15379154..>15473480
FT                   /gene="Musk"
FT                   /locus_tag="mCG_12401"
FT                   /note="gene_id=mCG12401.2"
FT   mRNA            join(<15379154..15379385,15386720..15386846,
FT                   15389836..15389987,15394830..15394957,15397023..15397164,
FT                   15425913..15426037,15436488..15436658,15450145..15450408,
FT                   15451836..15452011,15452637..15452660,15462843..15463041,
FT                   15463442..15463633,15464928..15465076,15469091..15470364)
FT                   /gene="Musk"
FT                   /locus_tag="mCG_12401"
FT                   /product="muscle, skeletal, receptor tyrosine kinase,
FT                   transcript variant mCT189508"
FT                   /note="gene_id=mCG12401.2 transcript_id=mCT189508.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<15379154..15379385,15386720..15386846,
FT                   15389836..15389987,15394830..15394957,15397023..15397164,
FT                   15425913..15426037,15436488..15436658,15450145..15450408,
FT                   15451836..15452011,15462843..15463041,15463442..15463633,
FT                   15464928..15465076,15469091..15470364)
FT                   /gene="Musk"
FT                   /locus_tag="mCG_12401"
FT                   /product="muscle, skeletal, receptor tyrosine kinase,
FT                   transcript variant mCT189509"
FT                   /note="gene_id=mCG12401.2 transcript_id=mCT189509.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(15379154..15379385,15386720..15386846,
FT                   15389836..15389987,15394830..15394957,15397023..15397164,
FT                   15425913..15426037,15436488..15436651,15450145..15450408,
FT                   15451836..15452011,15452637..15452660,15462843..15463041,
FT                   15463442..15463633,15464928..15465076,15469091..15470364)
FT                   /gene="Musk"
FT                   /locus_tag="mCG_12401"
FT                   /product="muscle, skeletal, receptor tyrosine kinase,
FT                   transcript variant mCT170375"
FT                   /note="gene_id=mCG12401.2 transcript_id=mCT170375.0 created
FT                   on 25-JUN-2002"
FT   mRNA            join(15379154..15379385,15386720..15386846,
FT                   15389836..15389987,15394830..15394957,15397023..15397164,
FT                   15425913..15426037,15436488..15436651,15450145..15450408,
FT                   15451836..15452011,15462843..15463041,15463442..15463633,
FT                   15464928..15465076,15469091..15470364)
FT                   /gene="Musk"
FT                   /locus_tag="mCG_12401"
FT                   /product="muscle, skeletal, receptor tyrosine kinase,
FT                   transcript variant mCT170374"
FT                   /note="gene_id=mCG12401.2 transcript_id=mCT170374.0 created
FT                   on 25-JUN-2002"
FT   mRNA            join(<15379307..15379385,15386720..15386846,
FT                   15389836..15389987,15394830..15394957,15397023..15397164,
FT                   15425913..15426037,15436488..15436651,15450145..15450408,
FT                   15451836..15452022,15462836..15463041,15463442..15463633,
FT                   15464928..15465076,15469091..15469761,15473439..>15473480)
FT                   /gene="Musk"
FT                   /locus_tag="mCG_12401"
FT                   /product="muscle, skeletal, receptor tyrosine kinase,
FT                   transcript variant mCT16138"
FT                   /note="gene_id=mCG12401.2 transcript_id=mCT16138.0 created
FT                   on 25-JUN-2002"
FT   CDS             join(15379307..15379385,15386720..15386846,
FT                   15389836..15389987,15394830..15394957,15397023..15397164,
FT                   15425913..15426037,15436488..15436651,15450145..15450408,
FT                   15451836..15452022,15462836..15463041,15463442..15463633,
FT                   15464928..15465076,15469091..15469761,15473439..15473480)
FT                   /codon_start=1
FT                   /gene="Musk"
FT                   /locus_tag="mCG_12401"
FT                   /product="muscle, skeletal, receptor tyrosine kinase,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG12401.2 transcript_id=mCT16138.0
FT                   protein_id=mCP15270.0 isoform=CRA_a"
FT                   /protein_id="EDL02228.1"
FT                   /translation="MRELVNIPLLQMLTLVAFSGTEKLPKAPVITTPLETVDALVEEVA
FT                   TFMCAVESYPQPEISWTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCIANNG
FT                   VGGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDNALRE
FT                   NSRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKLVKLEVEVFARILRAPESHN
FT                   VTFGSFVTLRCTAIGIPVPTISWIENGNAVSSGSIQESVKDRVIDSRLQLFITKPGLYT
FT                   CIATNKHGEKFSTAKAAATVSIAGSKSQKDSQGYCAQYRGEVCDAVLAKDALVFFNTSY
FT                   RDPEDAQELLIHTAWNELKAVSPLCRPAAEALLCNHLFQECSPGVVPTPMPICREYCLA
FT                   VKELFCAKEWQAMEGKAHRGLYRSGMHLLPVPECSKLPSMHRDPTACTRLPYLGNKELA
FT                   AFPSITSSRPSADIPNLPASTSSFAVSPAYSMTVIISIVSSFALFALLTIATLYCCRRR
FT                   KEWKNKKRESTAVTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRD
FT                   IGEGAFGRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIV
FT                   KLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSTRARVSSPGPPPLS
FT                   CAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGETMVVKIADFGLSRNIYSADYYK
FT                   ADGNDAIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVR
FT                   DGNILACPENCPLELYNLMRLCWSKLPADRPSFCSIHRILQRMCERAEGTTDGRAHFFW
FT                   PHQY"
FT   CDS             join(15379307..15379385,15386720..15386846,
FT                   15389836..15389987,15394830..15394957,15397023..15397164,
FT                   15425913..15426037,15436488..15436651,15450145..15450408,
FT                   15451836..15452011,15452637..15452660,15462843..15463041,
FT                   15463442..15463633,15464928..15465076,15469091..15469773)
FT                   /codon_start=1
FT                   /gene="Musk"
FT                   /locus_tag="mCG_12401"
FT                   /product="muscle, skeletal, receptor tyrosine kinase,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG12401.2 transcript_id=mCT170375.0
FT                   protein_id=mCP93293.0 isoform=CRA_c"
FT                   /protein_id="EDL02230.1"
FT                   /translation="MRELVNIPLLQMLTLVAFSGTEKLPKAPVITTPLETVDALVEEVA
FT                   TFMCAVESYPQPEISWTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCIANNG
FT                   VGGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDNALRE
FT                   NSRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKLVKLEVEVFARILRAPESHN
FT                   VTFGSFVTLRCTAIGIPVPTISWIENGNAVSSGSIQESVKDRVIDSRLQLFITKPGLYT
FT                   CIATNKHGEKFSTAKAAATVSIAGSKSQKDSQGYCAQYRGEVCDAVLAKDALVFFNTSY
FT                   RDPEDAQELLIHTAWNELKAVSPLCRPAAEALLCNHLFQECSPGVVPTPMPICREYCLA
FT                   VKELFCAKEWQAMEGKAHRGLYRSGMHLLPVPECSKLPSMHRDPTACTRLPYLDYKKEN
FT                   ITTFPSITSSRPSADIPNLPASTSSFAVSPAYSMTVIISIVSSFALFALLTIATLYCCR
FT                   RRKEWKNKKRESTAVTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYV
FT                   RDIGEGAFGRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPN
FT                   IVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSTRARVSSPGPPP
FT                   LSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGETMVVKIADFGLSRNIYSADY
FT                   YKADGNDAIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYY
FT                   VRDGNILACPENCPLELYNLMRLCWSKLPADRPSFCSIHRILQRMCERAEGTVGV"
FT   CDS             join(15379307..15379385,15386720..15386846,
FT                   15389836..15389987,15394830..15394957,15397023..15397164,
FT                   15425913..15426037,15436488..15436651,15450145..15450408,
FT                   15451836..15452011,15462843..15463041,15463442..15463633,
FT                   15464928..15465076,15469091..15469773)
FT                   /codon_start=1
FT                   /gene="Musk"
FT                   /locus_tag="mCG_12401"
FT                   /product="muscle, skeletal, receptor tyrosine kinase,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG12401.2 transcript_id=mCT170374.0
FT                   protein_id=mCP93292.0 isoform=CRA_b"
FT                   /protein_id="EDL02229.1"
FT                   /translation="MRELVNIPLLQMLTLVAFSGTEKLPKAPVITTPLETVDALVEEVA
FT                   TFMCAVESYPQPEISWTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCIANNG
FT                   VGGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDNALRE
FT                   NSRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKLVKLEVEVFARILRAPESHN
FT                   VTFGSFVTLRCTAIGIPVPTISWIENGNAVSSGSIQESVKDRVIDSRLQLFITKPGLYT
FT                   CIATNKHGEKFSTAKAAATVSIAGSKSQKDSQGYCAQYRGEVCDAVLAKDALVFFNTSY
FT                   RDPEDAQELLIHTAWNELKAVSPLCRPAAEALLCNHLFQECSPGVVPTPMPICREYCLA
FT                   VKELFCAKEWQAMEGKAHRGLYRSGMHLLPVPECSKLPSMHRDPTACTRLPYLAFPSIT
FT                   SSRPSADIPNLPASTSSFAVSPAYSMTVIISIVSSFALFALLTIATLYCCRRRKEWKNK
FT                   KRESTAVTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAF
FT                   GRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVC
FT                   AVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLC
FT                   IARQVAAGMAYLSERKFVHRDLATRNCLVGETMVVKIADFGLSRNIYSADYYKADGNDA
FT                   IPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILA
FT                   CPENCPLELYNLMRLCWSKLPADRPSFCSIHRILQRMCERAEGTVGV"
FT   assembly_gap    15383852..15383871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15401002..15401558
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    15407596..15408008
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   CDS             join(<15436645..15436658,15450145..15450408,
FT                   15451836..15452011,15452637..15452660,15462843..15463041,
FT                   15463442..15463633,15464928..15465076,15469091..15469773)
FT                   /codon_start=1
FT                   /gene="Musk"
FT                   /locus_tag="mCG_12401"
FT                   /product="muscle, skeletal, receptor tyrosine kinase,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG12401.2 transcript_id=mCT189508.0
FT                   protein_id=mCP110477.0 isoform=CRA_d"
FT                   /protein_id="EDL02231.1"
FT                   /translation="QVGAAKSQKDSQGYCAQYRGEVCDAVLAKDALVFFNTSYRDPEDA
FT                   QELLIHTAWNELKAVSPLCRPAAEALLCNHLFQECSPGVVPTPMPICREYCLAVKELFC
FT                   AKEWQAMEGKAHRGLYRSGMHLLPVPECSKLPSMHRDPTACTRLPYLDYKKENITTFPS
FT                   ITSSRPSADIPNLPASTSSFAVSPAYSMTVIISIVSSFALFALLTIATLYCCRRRKEWK
FT                   NKKRESTAVTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEG
FT                   AFGRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLG
FT                   VCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQ
FT                   LCIARQVAAGMAYLSERKFVHRDLATRNCLVGETMVVKIADFGLSRNIYSADYYKADGN
FT                   DAIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNI
FT                   LACPENCPLELYNLMRLCWSKLPADRPSFCSIHRILQRMCERAEGTVGV"
FT   CDS             join(<15436645..15436658,15450145..15450408,
FT                   15451836..15452011,15462843..15463041,15463442..15463633,
FT                   15464928..15465076,15469091..15469773)
FT                   /codon_start=1
FT                   /gene="Musk"
FT                   /locus_tag="mCG_12401"
FT                   /product="muscle, skeletal, receptor tyrosine kinase,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG12401.2 transcript_id=mCT189509.0
FT                   protein_id=mCP110478.0 isoform=CRA_e"
FT                   /protein_id="EDL02232.1"
FT                   /translation="QVGAAKSQKDSQGYCAQYRGEVCDAVLAKDALVFFNTSYRDPEDA
FT                   QELLIHTAWNELKAVSPLCRPAAEALLCNHLFQECSPGVVPTPMPICREYCLAVKELFC
FT                   AKEWQAMEGKAHRGLYRSGMHLLPVPECSKLPSMHRDPTACTRLPYLAFPSITSSRPSA
FT                   DIPNLPASTSSFAVSPAYSMTVIISIVSSFALFALLTIATLYCCRRRKEWKNKKRESTA
FT                   VTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQA
FT                   RAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPM
FT                   CLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLCIARQVA
FT                   AGMAYLSERKFVHRDLATRNCLVGETMVVKIADFGLSRNIYSADYYKADGNDAIPIRWM
FT                   PPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCP
FT                   LELYNLMRLCWSKLPADRPSFCSIHRILQRMCERAEGTVGV"
FT   assembly_gap    15439543..15439562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15441198..15441217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15442411..15442430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15443587..15443606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15444682..15446564
FT                   /estimated_length=1883
FT                   /gap_type="unknown"
FT   assembly_gap    15458868..15458887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15481486..15486086
FT                   /estimated_length=4601
FT                   /gap_type="unknown"
FT   assembly_gap    15502604..15503147
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    15506090..15507319
FT                   /estimated_length=1230
FT                   /gap_type="unknown"
FT   assembly_gap    15508121..15508653
FT                   /estimated_length=533
FT                   /gap_type="unknown"
FT   gene            complement(15530879..15649484)
FT                   /gene="Edg2"
FT                   /locus_tag="mCG_12400"
FT                   /note="gene_id=mCG12400.1"
FT   mRNA            complement(join(15530879..15533529,15582362..15583109,
FT                   15600622..15600781,15649386..15649484))
FT                   /gene="Edg2"
FT                   /locus_tag="mCG_12400"
FT                   /product="endothelial differentiation, lysophosphatidic
FT                   acid G-protein-coupled receptor, 2, transcript variant
FT                   mCT16137"
FT                   /note="gene_id=mCG12400.1 transcript_id=mCT16137.0 created
FT                   on 25-JUN-2002"
FT   mRNA            complement(join(15531155..15533529,15582362..15583109,
FT                   15600622..15600781,15649099..>15649221))
FT                   /gene="Edg2"
FT                   /locus_tag="mCG_12400"
FT                   /product="endothelial differentiation, lysophosphatidic
FT                   acid G-protein-coupled receptor, 2, transcript variant
FT                   mCT189507"
FT                   /note="gene_id=mCG12400.1 transcript_id=mCT189507.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(15533228..15533529,15582362..15583109,
FT                   15600622..>15600747))
FT                   /codon_start=1
FT                   /gene="Edg2"
FT                   /locus_tag="mCG_12400"
FT                   /product="endothelial differentiation, lysophosphatidic
FT                   acid G-protein-coupled receptor, 2, isoform CRA_a"
FT                   /note="gene_id=mCG12400.1 transcript_id=mCT189507.0
FT                   protein_id=mCP110476.0 isoform=CRA_a"
FT                   /protein_id="EDL02226.1"
FT                   /translation="SANPRIAFCAWHCSAGGLFIAPNYSTVMAAASTSSPVISQPQFTA
FT                   MNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVCVFIMLANLLVMVAIYVN
FT                   RRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASV
FT                   ANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIDHC
FT                   SNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMM
FT                   SLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSY
FT                   RDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSNDHSVV"
FT   CDS             complement(join(15533228..15533529,15582362..15583109,
FT                   15600622..15600666))
FT                   /codon_start=1
FT                   /gene="Edg2"
FT                   /locus_tag="mCG_12400"
FT                   /product="endothelial differentiation, lysophosphatidic
FT                   acid G-protein-coupled receptor, 2, isoform CRA_b"
FT                   /note="gene_id=mCG12400.1 transcript_id=mCT16137.0
FT                   protein_id=mCP15267.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q544V2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR002277"
FT                   /db_xref="InterPro:IPR004065"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:108429"
FT                   /db_xref="UniProtKB/TrEMBL:Q544V2"
FT                   /protein_id="EDL02227.1"
FT                   /translation="MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEW
FT                   NTVSKLVMGLGITVCVFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFY
FT                   LMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRR
FT                   VVVVIVVIWTMAIVMGAIPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMV
FT                   VLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLD
FT                   VCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEG
FT                   SDRSASSLNHTILAGVHSNDHSVV"
FT   assembly_gap    15536169..15536420
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    15547612..15547711
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    15594973..15594992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15596134..15596337
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    15635199..15635409
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    15647700..15647719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15654037..15654056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15674188..15674613
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    15678417..15678436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15688347..15688387
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   gene            15707203..15708321
FT                   /pseudo
FT                   /locus_tag="mCG_54766"
FT                   /note="gene_id=mCG54766.2"
FT   mRNA            15707203..15708321
FT                   /pseudo
FT                   /locus_tag="mCG_54766"
FT                   /note="gene_id=mCG54766.2 transcript_id=mCT54949.2 created
FT                   on 25-JUN-2002"
FT   assembly_gap    15725115..15725134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15744579..15754762)
FT                   /locus_tag="mCG_147027"
FT                   /note="gene_id=mCG147027.0"
FT   mRNA            complement(join(15744579..15746278,15754711..15754762))
FT                   /locus_tag="mCG_147027"
FT                   /product="mCG147027"
FT                   /note="gene_id=mCG147027.0 transcript_id=mCT187290.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(15745598..15746143)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147027"
FT                   /product="mCG147027"
FT                   /note="gene_id=mCG147027.0 transcript_id=mCT187290.0
FT                   protein_id=mCP108162.0"
FT                   /protein_id="EDL02225.1"
FT                   /translation="MQPRDSICIFRYNKLLNNQAVMVYTCSSLEADVSKSLQSEDFVQL
FT                   SSKARLSQKKKSHANLNAGCILEIATLTRLRHDGCKLEASLGCYTVRTGFSNNNNNNNN
FT                   NSNSNSNSNSNSNSNSNSNSNNNNNNSNSSSNNNKAAAATTTTTEENFTLEKNSLKTKT
FT                   TKTSTIISTNPNKAGQQK"
FT   assembly_gap    15788498..15788530
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    15813399..15813602
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    15824846..15824868
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    15842359..15842539
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    15854325..15854878
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    15861080..15861185
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            complement(<15877898..>15878839)
FT                   /gene="Olfr267"
FT                   /locus_tag="mCG_1041273"
FT                   /note="gene_id=mCG1041273.1"
FT   mRNA            complement(<15877898..>15878839)
FT                   /gene="Olfr267"
FT                   /locus_tag="mCG_1041273"
FT                   /product="olfactory receptor 267"
FT                   /note="gene_id=mCG1041273.1 transcript_id=mCT158977.1
FT                   created on 05-JUN-2002"
FT   CDS             complement(15877898..15878839)
FT                   /codon_start=1
FT                   /gene="Olfr267"
FT                   /locus_tag="mCG_1041273"
FT                   /product="olfactory receptor 267"
FT                   /note="gene_id=mCG1041273.1 transcript_id=mCT158977.1
FT                   protein_id=mCP53558.1"
FT                   /db_xref="GOA:Q8VGI0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030101"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGI0"
FT                   /protein_id="EDL02224.1"
FT                   /translation="MPGENVTVWSLFFLEGFSRYPRLEIVLFVFSLVMYLVTILGNCTL
FT                   ILITVLDSRLQTPMYLFLGNLSFMDICYTSASIPTLLVNLLSSKKTIIFSGCAVQMYLS
FT                   LSMGSTECILLAVMAYDRYVAICNPLRYPIIMNRQVCVQMATISWVTGCLTALLETSFA
FT                   LQIPLCGNIINHFTCEILAVLKLACVSSLLMDLVMLVVSILLLPIPMLLICISYGFILS
FT                   TILRISSTEGRNKAFSTCGAHLTVVILYYGAALSMYLKPSSSNSQEIDKIISLLYGVLT
FT                   PMLNPIIYSLRNKEVKDAVIKLLGKVPLAPSV"
FT   gene            complement(15893166..>16005895)
FT                   /gene="AI314180"
FT                   /locus_tag="mCG_115163"
FT                   /note="gene_id=mCG115163.2"
FT   mRNA            complement(join(15893166..15893453,15894866..15894937,
FT                   15896798..15896886,15898669..15898774,15900879..15901017,
FT                   15902522..15902714,15902808..15902851,15903716..15903924,
FT                   15904471..15904662,15904813..15904879,15904956..15905047,
FT                   15905760..15905826,15907109..15907198,15908376..15908441,
FT                   15910520..15910670,15912214..15912335,15913192..15913239,
FT                   15914417..15914522,15915086..15915165,15917216..15917383,
FT                   15917748..15917865,15919452..15919520,15920087..15920201,
FT                   15921058..15921112,15921557..15921702,15923380..15923503,
FT                   15925751..15925852,15926973..15927145,15927544..15927706,
FT                   15929189..15929323,15933820..15933911,15934528..15934750,
FT                   15935716..15935796,15937223..15937346,15940166..15940269,
FT                   15942847..15942969,15943054..15943120,15944072..15944121,
FT                   15946173..15946251,15946708..15946793,15954624..15954743,
FT                   15957439..15957520,15962338..15962477,15965546..15965717,
FT                   15968382..15968531,15970009..15970127,15971968..15972084,
FT                   15978334..15978464,16005646..>16005895))
FT                   /gene="AI314180"
FT                   /locus_tag="mCG_115163"
FT                   /product="expressed sequence AI314180, transcript variant
FT                   mCT189517"
FT                   /note="gene_id=mCG115163.2 transcript_id=mCT189517.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(15893314..15893453,15894866..15894937,
FT                   15896798..15896886,15898669..15898774,15900879..15901017,
FT                   15902522..15902714,15902808..15902851,15903716..15903924,
FT                   15904471..15904662,15904813..15904879,15904956..15905047,
FT                   15905760..15905826,15907109..15907198,15908376..15908441,
FT                   15910520..15910670,15912214..15912335,15913192..15913239,
FT                   15914417..15914522,15915086..15915165,15917216..15917383,
FT                   15917748..15917865,15919452..15919520,15920087..15920201,
FT                   15921058..15921112,15921557..15921702,15923380..15923503,
FT                   15925751..15925852,15926973..15927145,15927544..15927706,
FT                   15929189..15929323,15933820..15933911,15934528..15934750,
FT                   15935716..15935796,15937223..15937346,15940166..15940269,
FT                   15942847..15942969,15943054..15943120,15944072..15944121,
FT                   15946173..15946251,15946708..15946793,15954624..15954743,
FT                   15957439..15957520,15962338..15962477,15965546..15965717,
FT                   15968382..15968531,15970009..15970127,15971968..15972084,
FT                   15978334..15978464,16005646..>16005832))
FT                   /codon_start=1
FT                   /gene="AI314180"
FT                   /locus_tag="mCG_115163"
FT                   /product="expressed sequence AI314180, isoform CRA_a"
FT                   /note="gene_id=mCG115163.2 transcript_id=mCT189517.0
FT                   protein_id=mCP110472.0 isoform=CRA_a"
FT                   /protein_id="EDL02220.1"
FT                   /translation="QPQTFNATARGGEALRGSQDSPAPLGRTQAPPERPRVSSGPARPP
FT                   PRWVAAASRAMETGSDSDQLERVFLRLGHAETDEQLQNIISKFLPPVLLKLSSTQEGVR
FT                   KKVMELLVHLNKRIKSRPKIQLPVETLLVQYQDPAAVSFVTNFTIIYVKMGYPRLPVEK
FT                   QCELAPTLLTAMEGKPQPQQDSLMHLLIPTLFHMKYPAESSKSASPFNLAEKPKTVQLL
FT                   LDFMLDVLLMPYGYVLNESQSRQNSSSSSQGSSSNSGGGSGIPQPPPGMSFYAAKRVIG
FT                   DNPWTPEQLEQCKLGIVKFIEAEQVPELEAVLHLVIASSDTRHSVATAADLELKSKQSL
FT                   IDWNNPAIINKMYKVYLGDIPLKTKEGAVLKPELKRDPVSTRVKLKIVPHLLRSRQAAE
FT                   TFPANIQVVYDGLFGTNTNSKLRTLSLQFVHHICLTCPEIKIKPLGPMLLNGLTKLINE
FT                   YKEDPKLLSMAYSAVGKLSSRMPHLFTKDIALVQQLFEALCKEEPETRLAIQEALSMMV
FT                   GAYSTLEGAQRTLMEALVASYLIKPEVQVRQVAVKFASTVFPSDHIPSRYLLLLAAGDP
FT                   REEVHGEAQRVLRCLPGRNKKESASKQMPSFPEMVYYIQEKASHRMKTPVKYMTGTTVL
FT                   PFNPAAFGEIVLYLRMCLAHSAGVVPTSQSLADMQDHAPAIGRYIRALMSSSQATASSS
FT                   NKSGETNPVQIYTGLLQQLLAGVGGLPVMYCLLEAVSVYPEKLATKFVDKTEWIKSLMS
FT                   SSKEEMRELAALFYSVVVSTVSGIELKSMIEQLIKATKDNHSPEVQHGSLLALGFTVGR
FT                   YLAKKRVRMAEQHDLETDADLLPEQEEIIRSATETIGSFLDSTSPLLAIAACTALGEIG
FT                   RNGPLPIPSEGSGFTKLHLVESLLNRIPSSKETNKMKERAIQTLGYFPVGDGVFPHQKL
FT                   LLQGLMDSVEAKQIELQFTIGEAITSAAIGTNSVAARDAWLVTEEEYIPPAGAKVNDVV
FT                   PWVLDVILNKHIISPNPHVRQAACIWLLSLVRKLSTHREVKSHLKEIQSAFVSVLSEND
FT                   ELSQDVASKGLGLVYELGNEQDQQELVSTLVETLMTGKRVKHEVSGETVVFQGGGLGKT
FT                   PDGQGLSTYKELCSLASDLSQPDLVYKFMNLANHHAMWNSRKGAAFGFNVIATRAGEQL
FT                   APFLPQLVPRLYRYQFDPNLGIRQAMTSIWNALVTDKSMVDKYLKEILQDLIKNLTSNM
FT                   WRVRESSCLALNDLLRGRPLDDVIDKLPEMWETLFRVQDDIKESVRKAAELALKTLSKV
FT                   CVKMCDPAKGAAGQRTIAVLLPCLLDKGMMSPVTEVRALSINTLVKISKSAGAMLKPHA
FT                   PKLIPALLESLSVLEPQVLNYLSLRATEQEKDVMDSARLSAAKSSPMMETINMCLQYLD
FT                   VSVLGELVPRLCELIRSGVGLGTKGGCASVIVSLTTQCPQDLTPYSGKLMSALLSGLTD
FT                   RNSVIQKSCAFAMGHLVRTSRDSSTEKLLQKLNGWYMEKEEPVYKTSCALTIHAIGRYS
FT                   PDVLKNHAKEVLPLAFLGMHEIADEEKSEKEECNMWTEVWQENVPGSFGGIRLYLQELI
FT                   TITQKALQSQSWKMKAQGAIAMASISKQTSSLVPPYLGMILSALMQGLAGRTWAGKEEL
FT                   LKAIACVVTACSTELEKSVPNQPTTNEILQAVLKECCKENLKYKIVAISCAADVLKATK
FT                   EDRFQEFSDIVIPLIKKNSLESMGVRTTKAEDENEKERELQLESLLGAFESLGKAWPRN
FT                   PDTQRCYRQELCKLMCERLRLSTWKVQLGVLQSMNAFFQGLMLLEEEHADPEALAEILL
FT                   ETCKSITYSLENKTYSSVRTEALSVVELLLKKLEEAKQWESLTAECRGLLIESLATMET
FT                   DNRPELQEKASVLKKTLESLE"
FT   mRNA            complement(join(<15893314..15893453,15894866..15894937,
FT                   15896798..15896886,15898669..15898774,15900879..15901017,
FT                   15902522..15902714,15902808..15902851,15903716..15903924,
FT                   15904471..15904662,15904813..15904879,15904956..15905047,
FT                   15905760..15905826,15907109..15907198,15908376..15908441,
FT                   15910520..15910670,15912214..15912335,15913192..15913239,
FT                   15914417..15914522,15917223..15917383,15917748..15917865,
FT                   15919452..15919520,15920087..15920201,15921058..15921112,
FT                   15921557..15921702,15923380..15923503,15925751..15925852,
FT                   15929189..15929323,15933820..15933911,15934528..15934750,
FT                   15937223..15937346,15940166..15940269,15942847..15942969,
FT                   15943054..15943120,15946708..15946793,15954624..15954743,
FT                   15957439..15957520,15962338..15962477,15965546..15965717,
FT                   15968382..15968531,15970009..15970127,15971968..15972084,
FT                   15978334..15978464,15998240..15998343,16005646..16005724))
FT                   /gene="AI314180"
FT                   /locus_tag="mCG_115163"
FT                   /product="expressed sequence AI314180, transcript variant
FT                   mCT116263"
FT                   /note="gene_id=mCG115163.2 transcript_id=mCT116263.1
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(15893314..15893453,15894866..15894937,
FT                   15896798..15896886,15898669..15898774,15900879..15901017,
FT                   15902522..15902714,15902808..15902851,15903716..15903924,
FT                   15904471..15904662,15904813..15904879,15904956..15905047,
FT                   15905760..15905826,15907109..15907198,15908376..15908441,
FT                   15910520..15910670,15912214..15912335,15913192..15913239,
FT                   15914417..15914522,15917223..15917383,15917748..15917865,
FT                   15919452..15919520,15920087..15920201,15921058..15921112,
FT                   15921557..15921702,15923380..15923503,15925751..15925852,
FT                   15929189..15929323,15933820..15933911,15934528..15934750,
FT                   15937223..15937346,15940166..15940269,15942847..15942969,
FT                   15943054..15943120,15946708..15946793,15954624..15954743,
FT                   15957439..15957520,15962338..15962477,15965546..15965717,
FT                   15968382..15968531,15970009..15970127,15971968..15972084,
FT                   15978334..15978464,15998240..15998261))
FT                   /codon_start=1
FT                   /gene="AI314180"
FT                   /locus_tag="mCG_115163"
FT                   /product="expressed sequence AI314180, isoform CRA_c"
FT                   /note="gene_id=mCG115163.2 transcript_id=mCT116263.1
FT                   protein_id=mCP53440.1 isoform=CRA_c"
FT                   /protein_id="EDL02222.1"
FT                   /translation="MYHIDCRDQLERVFLRLGHAETDEQLQNIISKFLPPVLLKLSSTQ
FT                   EGVRKKVMELLVHLNKRIKSRPKIQLPVETLLVQYQDPAAVSFVTNFTIIYVKMGYPRL
FT                   PVEKQCELAPTLLTAMEGKPQPQQDSLMHLLIPTLFHMKYPAESSKSASPFNLAEKPKT
FT                   VQLLLDFMLDVLLMPYGYVLNESQSRQNSSSSSQGSSSNSGGGSGIPQPPPGMSFYAAK
FT                   RVIGDNPWTPEQLEQCKLGIVKFIEAEQVPELEAVLHLVIASSDTRHSVATAADLELKS
FT                   KQSLIDWNNPAIINKMYKVYLGDIPLKTKEGAVLKPELKRDPVSTRVKLKIVPHLLRSR
FT                   QAAETFPANIQVVYDGLFGTNTNSKLRTLSLQFVHHICLTRMPHLFTKDIALVQQLFEA
FT                   LCKEEPETRLAIQEALSMMVGAYSTLEGAQRTLMEALVASYLIKPEVQVRQVAVKFAST
FT                   VFPSDHIPSRYLLLLAAGDPREEVHGEAQRVLRCLPGRNKKESASKQMPSFPEMVYYIQ
FT                   EKIVLYLRMCLAHSAGVVPTSQSLADMQDHAPAIGRYIRALMSSSQATASSSNKSGETN
FT                   PVQIYTGLLQQLLAGVGGLPVMYCLLEAVSVYPEKLATKFVDKTEWIKSLMSSSKEEMR
FT                   ELAALFYSVVVSTVSGIELKSMIEQLIKATKDNHMKERAIQTLGYFPVGDGVFPHQKLL
FT                   LQGLMDSVEAKQIELQFTIGEAITSAAIGTNSVAARDAWLVTEEEYIPPAGAKVNDVVP
FT                   WVLDVILNKHIISPNPHVRQAACIWLLSLVRKLSTHREVKSHLKEIQSAFVSVLSENDE
FT                   LSQDVASKGLGLVYELGNEQDQQELVSTLVETLMTGKRVKHEVSGETVVFQGGGLGKTP
FT                   DGQGLSTYKELCSLASDLSQPDLVYKFMNLANHHAMWNSRKGAAFGFNVIATRAGEQLA
FT                   PFLPQLVPRLYRYQFDPNLGIRQAMTSIWNALVTDNCLALNDLLRGRPLDDVIDKLPEM
FT                   WETLFRVQDDIKESVRKAAELALKTLSKVCVKMCDPAKGAAGQRTIAVLLPCLLDKGMM
FT                   SPVTEVRALSINTLVKISKSAGAMLKPHAPKLIPALLESLSVLEPQVLNYLSLRATEQE
FT                   KDVMDSARLSAAKSSPMMETINMCLQYLDVSVLGELVPRLCELIRSGVGLGTKGGCASV
FT                   IVSLTTQCPQDLTPYSGKLMSALLSGLTDRNSVIQKSCAFAMGHLVRTSRDSSTEKLLQ
FT                   KLNGWYMEKEEPVYKTSCALTIHAIGRYSPDVLKNHAKEVLPLAFLGMHEIADEEKSEK
FT                   EECNMWTEVWQENVPGSFGGIRLYLQELITITQKALQSQSWKMKAQGAIAMASISKQTS
FT                   SLVPPYLGMILSALMQGLAGRTWAGKEELLKAIACVVTACSTELEKSVPNQPTTNEILQ
FT                   AVLKECCKENLKYKIVAISCAADVLKATKEDRFQEFSDIVIPLIKKNSLESMGVRTTKA
FT                   EDENEKERELQLESLLGAFESLGKAWPRNPDTQRCYRQELCKLMCERLRLSTWKVQLGV
FT                   LQSMNAFFQGLMLLEEEHADPEALAEILLETCKSITYSLENKTYSSVRTEALSVVELLL
FT                   KKLEEAKQWESLTAECRGLLIESLATMETDNRPELQEKASVLKKTLESLE"
FT   mRNA            complement(join(<15904531..15904662,15904813..15904879,
FT                   15904956..15905047,15905760..15905826,15907109..15907198,
FT                   15908376..15908441,15910520..15910670,15912214..15912335,
FT                   15913192..15913239,15914417..15914522,15915086..15915165,
FT                   15917216..15917383,15917748..15917865,15919452..15919520,
FT                   15920087..15920201,15921058..15921112,15921557..15921702,
FT                   15923380..15923503,15925751..15925852,15926973..15927145,
FT                   15927544..15927706,15929189..15929323,15933820..15933911,
FT                   15934528..15934750,15935716..15935796,15937223..15937346,
FT                   15940166..15940269,15942847..15942969,15943054..15943120,
FT                   15944072..15944121,15946173..15946251,15946708..15946793,
FT                   15954624..15954743,15957439..15957520,15962338..15962477,
FT                   15965546..15965717,15968382..15968531,15970009..15970127,
FT                   15971968..15972084,15978334..15978464,15998240..15998343,
FT                   16005051..>16005113))
FT                   /gene="AI314180"
FT                   /locus_tag="mCG_115163"
FT                   /product="expressed sequence AI314180, transcript variant
FT                   mCT189518"
FT                   /note="gene_id=mCG115163.2 transcript_id=mCT189518.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(<15904531..15904662,15904813..15904879,
FT                   15904956..15905047,15905760..15905826,15907109..15907198,
FT                   15908376..15908441,15910520..15910670,15912214..15912335,
FT                   15913192..15913239,15914417..15914522,15915086..15915165,
FT                   15917216..15917383,15917748..15917865,15919452..15919520,
FT                   15920087..15920201,15921058..15921112,15921557..15921702,
FT                   15923380..15923503,15925751..15925852,15926973..15927145,
FT                   15927544..15927706,15929189..15929323,15933820..15933911,
FT                   15934528..15934750,15935716..15935796,15937223..15937346,
FT                   15940166..15940269,15942847..15942969,15943054..15943120,
FT                   15944072..15944121,15946173..15946251,15946708..15946793,
FT                   15954624..15954743,15957439..15957520,15962338..15962477,
FT                   15965546..15965717,15968382..15968531,15970009..15970127,
FT                   15971968..15972084,15978334..15978464,15998240..>15998264))
FT                   /codon_start=1
FT                   /gene="AI314180"
FT                   /locus_tag="mCG_115163"
FT                   /product="expressed sequence AI314180, isoform CRA_b"
FT                   /note="gene_id=mCG115163.2 transcript_id=mCT189518.0
FT                   protein_id=mCP110473.0 isoform=CRA_b"
FT                   /protein_id="EDL02221.1"
FT                   /translation="TMYHIDCRDQLERVFLRLGHAETDEQLQNIISKFLPPVLLKLSST
FT                   QEGVRKKVMELLVHLNKRIKSRPKIQLPVETLLVQYQDPAAVSFVTNFTIIYVKMGYPR
FT                   LPVEKQCELAPTLLTAMEGKPQPQQDSLMHLLIPTLFHMKYPAESSKSASPFNLAEKPK
FT                   TVQLLLDFMLDVLLMPYGYVLNESQSRQNSSSSSQGSSSNSGGGSGIPQPPPGMSFYAA
FT                   KRVIGDNPWTPEQLEQCKLGIVKFIEAEQVPELEAVLHLVIASSDTRHSVATAADLELK
FT                   SKQSLIDWNNPAIINKMYKVYLGDIPLKTKEGAVLKPELKRDPVSTRVKLKIVPHLLRS
FT                   RQAAETFPANIQVVYDGLFGTNTNSKLRTLSLQFVHHICLTCPEIKIKPLGPMLLNGLT
FT                   KLINEYKEDPKLLSMAYSAVGKLSSRMPHLFTKDIALVQQLFEALCKEEPETRLAIQEA
FT                   LSMMVGAYSTLEGAQRTLMEALVASYLIKPEVQVRQVAVKFASTVFPSDHIPSRYLLLL
FT                   AAGDPREEVHGEAQRVLRCLPGRNKKESASKQMPSFPEMVYYIQEKASHRMKTPVKYMT
FT                   GTTVLPFNPAAFGEIVLYLRMCLAHSAGVVPTSQSLADMQDHAPAIGRYIRALMSSSQA
FT                   TASSSNKSGETNPVQIYTGLLQQLLAGVGGLPVMYCLLEAVSVYPEKLATKFVDKTEWI
FT                   KSLMSSSKEEMRELAALFYSVVVSTVSGIELKSMIEQLIKATKDNHSPEVQHGSLLALG
FT                   FTVGRYLAKKRVRMAEQHDLETDADLLPEQEEIIRSATETIGSFLDSTSPLLAIAACTA
FT                   LGEIGRNGPLPIPSEGSGFTKLHLVESLLNRIPSSKETNKMKERAIQTLGYFPVGDGVF
FT                   PHQKLLLQGLMDSVEAKQIELQFTIGEAITSAAIGTNSVAARDAWLVTEEEYIPPAGAK
FT                   VNDVVPWVLDVILNKHIISPNPHVRQAACIWLLSLVRKLSTHREVKSHLKEIQSAFVSV
FT                   LSENDELSQDVASKGLGLVYELGNEQDQQELVSTLVETLMTGKRVKHEVSGETVVFQGG
FT                   GLGKTPDGQGLSTYKELCSLASDLSQPDLVYKFMNLANHHAMWNSRKGAAFGFNVIATR
FT                   AGEQLAPFLPQLVPRLYRYQFDPNLGIRQAMTSIWNALVTDKSMVDKYLKEILQDLIKN
FT                   LTSNMWRVRESSCLALNDLLRGRPLDDVIDKLPEMWETLFRVQDDIKESVRKAAELALK
FT                   TLSKVCVKMCDPAKGAAGQRTIAVLLPCLLDKGMMSPVTEVRALSINTLVKISKSAGAM
FT                   LKPHAPKLIPALLESLSVLEPQVLNYLSLRATEQEKDVMDSARLSAAKSSPMMETINMC
FT                   LQYLDVSVLGELVPRLCELIRSGVGLGTKGGCASVIVSLTTQCPQDLTPYSGKLMSALL
FT                   SGLTDRNSVIQKSCAFAMGHLVRTSRDSSTEKLLQKLNGWYMEKEEPVYKTSCALTIHA
FT                   IGRYSPDVLKNHAKEVLPLAFLGMHEIADE"
FT   assembly_gap    15932152..15933016
FT                   /estimated_length=865
FT                   /gap_type="unknown"
FT   assembly_gap    15944887..15944906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15949033..15952700
FT                   /locus_tag="mCG_147026"
FT                   /note="gene_id=mCG147026.0"
FT   mRNA            join(15949033..15951070,15951089..15952700)
FT                   /locus_tag="mCG_147026"
FT                   /product="mCG147026"
FT                   /note="gene_id=mCG147026.0 transcript_id=mCT187289.0
FT                   created on 13-JAN-2004"
FT   CDS             join(15951052..15951070,15951089..15951246)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147026"
FT                   /product="mCG147026"
FT                   /note="gene_id=mCG147026.0 transcript_id=mCT187289.0
FT                   protein_id=mCP108160.0"
FT                   /protein_id="EDL02223.1"
FT                   /translation="MGEEFVGQTSGGGGGNNWTVKNKSNGAGEMAQQLRTLTVLLKVLS
FT                   SNPSNHMVAHNHP"
FT   assembly_gap    15955118..15955137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16000876..16000961
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   gene            <16005728..16006143
FT                   /locus_tag="mCG_1041305"
FT                   /note="gene_id=mCG1041305.1"
FT   mRNA            <16005728..16006143
FT                   /locus_tag="mCG_1041305"
FT                   /product="mCG1041305"
FT                   /note="gene_id=mCG1041305.1 transcript_id=mCT159009.1
FT                   created on 05-JUN-2002"
FT   CDS             <16005729..16005992
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041305"
FT                   /product="mCG1041305"
FT                   /note="gene_id=mCG1041305.1 transcript_id=mCT159009.1
FT                   protein_id=mCP53415.1"
FT                   /protein_id="EDL02219.1"
FT                   /translation="GRSGGACVRPSGAGLSWLPRRASPPRAVALKVCGCHVRLVGAGGT
FT                   RARTEEETRTRKSRAGLESEEEEEEEEEAPPCASRPTSRPPR"
FT   assembly_gap    16019215..16019234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <16039537..>16051245
FT                   /locus_tag="mCG_12396"
FT                   /note="gene_id=mCG12396.2"
FT   mRNA            join(<16039537..16039915,16042233..16042330,
FT                   16045173..16045299,16045677..16045787,16049798..>16051245)
FT                   /locus_tag="mCG_12396"
FT                   /product="mCG12396"
FT                   /note="gene_id=mCG12396.2 transcript_id=mCT16132.2 created
FT                   on 25-JUN-2002"
FT   CDS             join(16039537..16039915,16042233..16042330,
FT                   16045173..16045299,16045677..16045787,16049798..16051245)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12396"
FT                   /product="mCG12396"
FT                   /note="gene_id=mCG12396.2 transcript_id=mCT16132.2
FT                   protein_id=mCP15280.2"
FT                   /protein_id="EDL02218.1"
FT                   /translation="MTTGPSALALSEQSRVPRVDTLRVQESMLRGNTDDLESFRQKFRW
FT                   FCYSQEEGPRKTLNQLWELCKQWLRPDIHTKEQILELLVFEQFLRVLPGEMRIWVNSQH
FT                   PGSSVEVVTLVEDLNQTLEEKEDLSTQASAVCKEEDLGEDAMVVVVMASPDPEPRESVT
FT                   FEDVSVDFSRGEWKLLEPSQRELYKEVLLENLGTLEFLGSPVSKLDLISHLKWVKLPRV
FT                   LEKEILKDPRPGELVKESESRRELDAFMEGLTLEKTVEYCFRDGGYGLKTEFQRRHGKP
FT                   KKDHGKRSSHENRESETEGTSSGKRVKQTSDTLKHRKASLSKMSQRSKEGKKPFSFHSA
FT                   LVNRRELRREKSRKCGEPEKDPRRHLSPAERKRHPKIGSLSKTETCSKCGVAFTQILEN
FT                   CIESSQCEKCRKNLFQDEAPNQDKEPDPEEASKCGKCGKAFEPGTKRSVCLECRKAPKA
FT                   SASPKPHNKADRKEKRYKCDECGKRFAELYFLTHHQRTHTGEKPYVCKHCGRPFSDYSS
FT                   FYQHQRIHTGEKPYTCKECGKSFTHSSSLSKHQRIHTGEKPYKCNECGKAFRQNSCLTR
FT                   HQKIHTGEKPFLCKDCGLSFRLFSSIMYHQRLHAGEKPYKCTHCEKGFPSHSRLSRHLR
FT                   CHTGAKPYKCKECGKTFRQSSSLNLHIRTHTGEKPYKCDYCGAAFTRSTILIEHVKTHT
FT                   NVQYECKKCGKTFKSRTTSLKHHCTQ"
FT   assembly_gap    16042535..16042556
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   gene            complement(16058516..16080542)
FT                   /gene="Ltb4dh"
FT                   /locus_tag="mCG_12399"
FT                   /note="gene_id=mCG12399.2"
FT   mRNA            complement(join(16058516..16059364,16059419..16060131,
FT                   16062128..16062246,16064361..16064469,16066905..16067060,
FT                   16069229..16069346,16071383..16071550,16075197..16075253,
FT                   16076320..16076365,16078184..16078299,16080478..16080542))
FT                   /gene="Ltb4dh"
FT                   /locus_tag="mCG_12399"
FT                   /product="leukotriene B4 12-hydroxydehydrogenase"
FT                   /note="gene_id=mCG12399.2 transcript_id=mCT16136.2 created
FT                   on 17-JUN-2003"
FT   assembly_gap    16059378..16059405
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   CDS             complement(join(16060021..16060131,16062128..16062246,
FT                   16064361..16064469,16066905..16067060,16069229..16069346,
FT                   16071383..16071550,16075197..16075253,16076320..16076365,
FT                   16078184..16078289))
FT                   /codon_start=1
FT                   /gene="Ltb4dh"
FT                   /locus_tag="mCG_12399"
FT                   /product="leukotriene B4 12-hydroxydehydrogenase"
FT                   /note="gene_id=mCG12399.2 transcript_id=mCT16136.2
FT                   protein_id=mCP15255.2"
FT                   /protein_id="EDL02217.1"
FT                   /translation="MVQAKSWTLKKHFEGFPTDGNFELKTTELPPLNNGEVLLEALFLS
FT                   VDPYMRVAAKKLKEGDRMMGEQVARVVESKNSAFPKGTIVAALLGWTSHSISDGNGLTK
FT                   LPVEWPDKLPLSLALGTVGMPGLTAYFGLLDICGVKGGETVMVSAAAGAVGSVVGQIAK
FT                   LKGCKVVGTAGSDEKVAYLKKLGFDVAFNYKTVKSLEEALRTASPDGYDCYFDNVGGEF
FT                   SNAVILQMKTFGRIAICGAISQYNRTGPCPQGPAPEVVIYQQLRMEGFIVNRWQGEVRQ
FT                   KALTELMNWVSEGKVQCHEYVTEGFEKMPAAFMGMLKGENLGKTIVKA"
FT   assembly_gap    16075835..16076108
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    16091571..16091847
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    16094263..16095160
FT                   /estimated_length=898
FT                   /gap_type="unknown"
FT   gene            <16096733..16116727
FT                   /locus_tag="mCG_19330"
FT                   /note="gene_id=mCG19330.2"
FT   mRNA            join(<16096733..16097032,16111037..16111189,
FT                   16113427..16113897,16115889..16116727)
FT                   /locus_tag="mCG_19330"
FT                   /product="mCG19330"
FT                   /note="gene_id=mCG19330.2 transcript_id=mCT18274.2 created
FT                   on 25-JUN-2002"
FT   CDS             join(<16096733..16097032,16111037..16111189,
FT                   16113427..16113897,16115889..16116011)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19330"
FT                   /product="mCG19330"
FT                   /note="gene_id=mCG19330.2 transcript_id=mCT18274.2
FT                   protein_id=mCP15282.2"
FT                   /protein_id="EDL02216.1"
FT                   /translation="GPGAAGQRPWLLLAPLLLVPLLARPAEALVEGLYCGTRDCYEVLG
FT                   VSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAEAFLLVATAYETLKDEET
FT                   RKDYDYMLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISMFQYFSWWNSYNKAI
FT                   SYLATVPKYRIQATEIAKEQGLLKKAKEKGKNKKSKEEIRDEEENIIKNIIKSKIDIKG
FT                   GYQKPQVRDLLLFQVILAPVHLCSYIAWYCRWIYNFNIKGKEYGEEERLYIIRKSMKMS
FT                   QSQFDSLEDHQKEMFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGP
FT                   GRLTFVDD"
FT   assembly_gap    16116736..16116755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <16125634..16132397
FT                   /gene="Gng10"
FT                   /locus_tag="mCG_19342"
FT                   /note="gene_id=mCG19342.2"
FT   mRNA            join(<16125634..16125865,16129734..16129865,
FT                   16131588..16132397)
FT                   /gene="Gng10"
FT                   /locus_tag="mCG_19342"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma 10"
FT                   /note="gene_id=mCG19342.2 transcript_id=mCT18623.1 created
FT                   on 25-JUN-2002"
FT   CDS             join(<16125634..16125865,16129734..16129865,
FT                   16131588..16131634)
FT                   /codon_start=1
FT                   /gene="Gng10"
FT                   /locus_tag="mCG_19342"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma 10"
FT                   /note="gene_id=mCG19342.2 transcript_id=mCT18623.1
FT                   protein_id=mCP15258.1"
FT                   /protein_id="EDL02215.1"
FT                   /translation="CSEAAATGAGQLATPARGQRGGRGGYPAPGRHPARRSFLPAEPAS
FT                   RSLSRHVFRGQRERPAAPGGAAEAGGWRGEDQGLPGSCRASAVLHTECMQGRPAARCSG
FT                   WKQPLPGAQVLCSTLKTGKKLAEEALCAHGDG"
FT   assembly_gap    16127823..16127842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16136002..16136424
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   assembly_gap    16147923..16147942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16157304..16157451
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    16167012..16167260
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    16167550..16167581
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    16205583..16205741
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    16206145..16206182
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    16212969..16213480
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   assembly_gap    16221584..16221803
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    16246474..16246577
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   gene            complement(16251612..16252642)
FT                   /pseudo
FT                   /locus_tag="mCG_19340"
FT                   /note="gene_id=mCG19340.0"
FT   mRNA            complement(16251612..16252642)
FT                   /pseudo
FT                   /locus_tag="mCG_19340"
FT                   /note="gene_id=mCG19340.0 transcript_id=mCT18622.1 created
FT                   on 25-JUN-2002"
FT   assembly_gap    16274538..16274557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16278660..16278958
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   gene            16278959..16311891
FT                   /gene="Ugcg"
FT                   /locus_tag="mCG_19338"
FT                   /note="gene_id=mCG19338.2"
FT   mRNA            join(16278959..16279104,16296807..16296948,
FT                   16300926..16301028,16302209..16302310,16302917..16303029,
FT                   16306088..16306266,16307546..16307632,16308540..16308729,
FT                   16309292..16311891)
FT                   /gene="Ugcg"
FT                   /locus_tag="mCG_19338"
FT                   /product="UDP-glucose ceramide glucosyltransferase"
FT                   /note="gene_id=mCG19338.2 transcript_id=mCT18621.2 created
FT                   on 25-JUN-2002"
FT   CDS             join(16279007..16279104,16296807..16296948,
FT                   16300926..16301028,16302209..16302310,16302917..16303029,
FT                   16306088..16306266,16307546..16307632,16308540..16308729,
FT                   16309292..16309462)
FT                   /codon_start=1
FT                   /gene="Ugcg"
FT                   /locus_tag="mCG_19338"
FT                   /product="UDP-glucose ceramide glucosyltransferase"
FT                   /note="gene_id=mCG19338.2 transcript_id=mCT18621.2
FT                   protein_id=mCP15242.2"
FT                   /db_xref="GOA:O88693"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1332243"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88693"
FT                   /protein_id="EDL02214.1"
FT                   /translation="MALLDLAQEGMALFGFVLFVVLWLMHFMSIIYTRLHLNKKATDKQ
FT                   PYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGK
FT                   YPNVDARLFIGGKKVGINPKINNLMPAYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTE
FT                   KVGLVHGLPYVADRQGFAATLEQVYFGTSHPRSYISANVTGFKCVTGMSCLMRKDVLDQ
FT                   AGGLIAFAQYIAEDYFMAKAIADRGWRFSMSTQVAMQNSGSYSISQFQSRMIRWTKLRI
FT                   NMLPATIICEPISECFVASLIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGG
FT                   TLCFSKLDYAVAWFIRESMTIYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV"
FT   assembly_gap    16293407..16293426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16296239..16296258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16317677..16317940
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    16322718..16322834
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    16327171..16327239
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    16332624..16336493
FT                   /estimated_length=3870
FT                   /gap_type="unknown"
FT   assembly_gap    16340740..16341196
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   assembly_gap    16401735..16401923
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   gene            <16408963..16409372
FT                   /locus_tag="mCG_1041334"
FT                   /note="gene_id=mCG1041334.1"
FT   mRNA            <16408963..16409372
FT                   /locus_tag="mCG_1041334"
FT                   /product="mCG1041334"
FT                   /note="gene_id=mCG1041334.1 transcript_id=mCT159038.1
FT                   created on 05-JUN-2002"
FT   CDS             <16409062..16409244
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041334"
FT                   /product="mCG1041334"
FT                   /note="gene_id=mCG1041334.1 transcript_id=mCT159038.1
FT                   protein_id=mCP53459.1"
FT                   /protein_id="EDL02213.1"
FT                   /translation="INLTINFILSCHDFQDKHIALGLPQMQQFQVLGNTIPFSLIGLYS
FT                   FTWLFVAPSRSDGWY"
FT   assembly_gap    16409485..16409760
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   gene            complement(16412137..16413420)
FT                   /locus_tag="mCG_147025"
FT                   /note="gene_id=mCG147025.0"
FT   mRNA            complement(join(16412137..16412863,16413166..16413420))
FT                   /locus_tag="mCG_147025"
FT                   /product="mCG147025"
FT                   /note="gene_id=mCG147025.0 transcript_id=mCT187288.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(16412777..16412863,16413166..1