Dbfetch

ID   CH466564; SV 2; linear; genomic DNA; CON; MUS; 17825079 BP.
XX
AC   CH466564;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009769791 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-17825079
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-17825079
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-17825079
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 4660c1a4920bcde08993dba8e9850403.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000228.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000025528; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031204; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031209; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031210; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031212; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031217; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031224; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031227; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031230; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031231; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031232; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031304; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031310; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031320; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031323; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031326; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031327; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031329; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031330; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032894; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033777; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034311; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034403; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034607; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035045; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042903; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044359; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046032; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047686; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049929; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051159; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054293; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056537; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056854; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059327; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062226; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073001; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073007; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079460; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079480; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000082229; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109858; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035918; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035926; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035929; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035935; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035936; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035944; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035947; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035952; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035953; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035956; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035960; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035969; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035971; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035972; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035977; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035980; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035981; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035982; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035983; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035984; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035986; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035988; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035993; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035995; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035998; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036000; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036001; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036009; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036010; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036012; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036017; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036024; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036025; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036026; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036030; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036033; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036035; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035904; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035912; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035914; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035920; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035921; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035929; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035932; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035937; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035938; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035941; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035945; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035954; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035956; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035957; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035960; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035962; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035963; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035964; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035965; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035967; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035969; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035974; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035976; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035977; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035979; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035980; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035988; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035989; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035991; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035996; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0036004; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0036006; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0036010; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0036013; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0036015; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021717; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035820; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035828; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035830; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035836; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035837; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035845; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035848; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035853; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035854; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035857; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035861; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035870; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035879; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035880; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035881; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035882; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035883; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035885; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035887; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035892; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035894; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035896; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035898; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035899; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035907; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035908; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035910; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035915; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035923; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035924; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035925; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035929; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035932; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035934; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035888; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035895; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035897; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035903; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035904; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035912; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035915; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035920; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035921; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035924; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035928; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035939; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035941; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035942; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035949; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035951; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035953; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035954; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035955; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035957; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035959; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035964; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035966; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035967; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035969; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035970; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035979; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035980; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035982; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035987; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035995; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035996; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035997; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0036002; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0036005; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0036007; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035596; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035603; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035606; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035612; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035613; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035621; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035624; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035629; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035630; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035633; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035637; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035647; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035649; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035650; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035656; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035657; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035659; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035660; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035661; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035663; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035665; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035670; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035672; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035674; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035676; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035677; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035685; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035686; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035688; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035693; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035701; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035702; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035703; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035707; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035710; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035712; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036417; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036424; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036426; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036432; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036433; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036441; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036444; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036449; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036450; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036453; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036457; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036467; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036469; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036470; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036474; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036477; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036478; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036479; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036480; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036481; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036483; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036485; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036490; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036492; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036494; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036496; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036497; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036505; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036506; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036508; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036513; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036520; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036521; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036522; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036526; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036529; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036531; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034882; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034890; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034893; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034899; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034900; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034908; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034911; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034916; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034917; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034920; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034924; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034933; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034935; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034936; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034942; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034944; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034945; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034946; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034947; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034949; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034951; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034956; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034958; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034961; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034963; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034964; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034972; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034973; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034975; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034980; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034987; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034988; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034989; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034994; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034997; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034999; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035571; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035579; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035581; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035587; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035588; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035596; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035599; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035604; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035605; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035608; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035612; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035621; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035623; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035624; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035628; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035631; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035633; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035634; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035635; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035636; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035638; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035640; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035645; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035647; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035649; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035651; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035652; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035661; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035662; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035664; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035669; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035677; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035678; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035679; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035683; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035686; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035688; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035726; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035733; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035735; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035741; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035742; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035750; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035753; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035758; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035759; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035762; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035766; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035775; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035777; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035778; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035785; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035787; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035788; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035789; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035790; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035792; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035794; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035799; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035801; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035803; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035805; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035806; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035815; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035816; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035818; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035823; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035830; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035831; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035832; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035836; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035839; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035841; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035664; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035671; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035673; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035679; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035680; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035688; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035691; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035696; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035697; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035700; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035704; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035714; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035716; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035717; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035724; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035727; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035729; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035730; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035731; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035733; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035735; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035740; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035742; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035744; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035746; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035747; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035755; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035756; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035758; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035763; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035771; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035772; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035773; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035777; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035780; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035782; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035816; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035823; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035825; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035831; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035832; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035840; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035843; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035848; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035849; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035852; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035856; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035866; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035868; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035870; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035874; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035877; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035879; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035881; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035882; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035883; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035885; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035887; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035892; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035894; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035896; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035898; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035899; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035907; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035908; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035910; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035915; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035923; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035924; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035925; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035929; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035932; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035934; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035699; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035706; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035708; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035714; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035715; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035723; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035726; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035731; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035732; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035735; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035739; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035748; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035750; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035751; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035758; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035759; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035760; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035761; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035762; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035763; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035765; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035767; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035772; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035774; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035776; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035778; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035779; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035787; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035789; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035802; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035804; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035808; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035811; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036444; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036451; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036453; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036459; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036460; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036468; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036471; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036476; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036477; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036480; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036484; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036493; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036495; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036496; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036503; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036504; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036505; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036506; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036507; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036509; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036511; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036516; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036518; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036520; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036522; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036523; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036532; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036533; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036535; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036540; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036547; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036548; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036549; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036553; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036556; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036558; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034581; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034589; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034592; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034598; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034599; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034607; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034610; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034615; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034616; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034619; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034623; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034632; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034634; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034635; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034641; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034642; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034643; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034644; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034645; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034647; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034649; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034654; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034656; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034657; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034659; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034660; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034668; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034669; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034671; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034676; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034683; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034684; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034688; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034691; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034693; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035022; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035029; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035032; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035038; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035039; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035047; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035050; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035055; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035056; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035059; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035063; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035072; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035074; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035075; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035079; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035082; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035084; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035085; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035086; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035087; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035089; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035091; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035096; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035098; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035099; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035101; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035102; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035110; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035111; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035113; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035118; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035125; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035126; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035127; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035131; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035134; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035136; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026602; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033553; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033556; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033575; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033578; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033581; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033582; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033664; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033683; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033689; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033691; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033692; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039887; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040065; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048061; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048962; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050551; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052839; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053373; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060576; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062000; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062010; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063577; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067249; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077876; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078229; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082183; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101282; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101292; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101336; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113412; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113627; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113779; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113790; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113838; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116547; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120389; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121153; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121720; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124592; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125676; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151689; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152343; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167154; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167673; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180182; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000210331; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096877; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096902; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096912; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096938; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096940; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096965; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096978; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097004; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097008; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097014; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097035; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097087; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097091; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097094; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097115; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097120; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097124; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097125; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097126; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097127; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097129; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097133; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097143; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097147; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097150; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097178; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097182; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097206; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097207; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097211; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097232; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097250; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097251; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097252; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097268; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097276; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097282; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0096976; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097000; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097009; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097035; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097037; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097062; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097075; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097101; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097105; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097132; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097186; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097189; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097191; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097206; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097211; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097212; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097213; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097214; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097216; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097220; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097230; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097234; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097235; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097263; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097267; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097292; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097293; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097297; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097318; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097337; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097339; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097356; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097364; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0097370; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0040681; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0096908; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0096932; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0096941; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0096967; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0096969; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0096994; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097007; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097033; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097037; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097064; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097118; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097143; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097147; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097148; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097149; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097150; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097152; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097156; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097166; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097170; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097172; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097200; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097204; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097229; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097230; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097234; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097255; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097274; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097275; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097276; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097292; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097300; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0097306; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096893; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096916; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096925; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096951; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096953; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096978; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096991; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097015; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097019; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097025; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097046; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097100; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097103; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097107; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097132; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097137; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097139; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097140; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097141; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097143; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097147; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097157; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097161; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097162; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097190; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097194; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097220; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097221; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097225; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097246; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097265; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097266; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097267; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097285; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097293; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097299; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096443; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096465; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096475; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096501; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096503; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096528; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096541; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096567; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096571; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096577; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096598; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096653; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096656; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096659; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096683; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096687; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096689; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096690; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096691; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096693; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096697; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096707; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096711; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096713; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096741; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096745; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096770; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096771; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096775; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096796; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096815; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096816; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096817; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096834; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096842; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096848; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097397; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097421; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097430; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097456; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097458; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097483; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097496; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097522; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097526; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097532; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097553; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097610; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097613; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097616; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097636; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097641; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097645; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097646; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097647; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097648; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097650; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097654; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097664; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097668; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097670; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097698; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097702; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097726; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097727; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097731; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097752; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097770; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097771; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097772; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097789; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097797; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097803; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097028; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097054; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097064; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097090; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097092; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097117; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097130; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097156; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097161; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097167; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097188; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097244; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097247; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097249; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097273; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097278; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097279; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097280; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097281; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097283; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097287; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097297; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097301; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097305; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097335; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097339; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097364; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097365; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097369; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097389; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097408; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097409; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097410; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097427; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097434; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097439; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0096362; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096386; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096395; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096421; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096423; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096448; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096461; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096487; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096491; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096497; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096518; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096570; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096573; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096576; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096596; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096602; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096607; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096608; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096609; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096610; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096612; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096616; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096626; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096630; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096632; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096660; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096664; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096690; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096691; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096695; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096716; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096735; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096736; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096737; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096754; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096762; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0096768; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0096571; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096595; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096604; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096630; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096632; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096657; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096670; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096696; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096700; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096706; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096727; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096781; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096784; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096787; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096811; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096816; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096817; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096818; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096819; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096821; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096825; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096835; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096839; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096841; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096869; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096873; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096900; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096901; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096905; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096926; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096944; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096945; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096946; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096962; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096970; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096976; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0096401; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096425; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096434; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096461; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096463; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096488; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096501; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096527; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096531; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096537; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096557; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096609; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096612; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096615; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096642; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096648; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096650; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096651; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096652; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096654; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096658; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096668; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096672; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096674; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096702; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096706; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096731; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096732; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096736; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096756; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096775; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096776; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096777; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096793; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096801; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0096806; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0096602; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096625; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096634; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096660; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096662; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096687; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096700; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096726; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096730; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096736; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096757; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096810; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096813; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096817; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096835; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096840; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096845; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096847; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096848; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096849; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096851; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096855; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096865; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096869; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096871; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096899; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096903; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096926; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096927; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096931; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096952; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096971; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096972; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096973; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096989; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096997; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0097003; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096352; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096370; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096379; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096404; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096406; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096431; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096444; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096470; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096474; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096480; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096501; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096555; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096558; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096561; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096586; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096587; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096591; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096592; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096593; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096594; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096596; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096600; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096610; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096614; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096616; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096645; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096649; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096674; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096678; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096709; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096711; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096722; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096730; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097754; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097778; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097787; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097813; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097815; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097841; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097854; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097880; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097884; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097890; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097911; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097966; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097969; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097972; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097998; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098002; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098003; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098004; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098005; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098007; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098011; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098021; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098025; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098027; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098055; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098059; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098084; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098085; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098089; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098110; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098128; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098129; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098130; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098147; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098155; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098161; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096438; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096461; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096471; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096496; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096498; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096522; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096535; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096561; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096565; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096571; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096592; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096642; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096645; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096648; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096672; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096676; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096677; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096678; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096679; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096681; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096685; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096695; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096699; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096700; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096728; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096732; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096757; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096758; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096762; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096783; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096801; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096802; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096818; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096827; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096833; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095410; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095433; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095443; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095469; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095471; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095495; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095508; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095534; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095538; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095544; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095565; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095619; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095622; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095625; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095643; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095649; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095654; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095655; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095656; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095657; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095659; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095663; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095673; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095677; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095678; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095706; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095710; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095732; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095733; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095737; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095758; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095776; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095777; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095778; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095795; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095803; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095809; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70979183.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..17825079
FT                   /organism="Mus musculus"
FT                   /chromosome="X"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    1074..1871
FT                   /estimated_length=798
FT                   /gap_type="unknown"
FT   assembly_gap    4731..4973
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    6879..7133
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    9721..9842
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    11417..11496
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    16664..16683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17204..>18742)
FT                   /locus_tag="mCG_56896"
FT                   /note="gene_id=mCG56896.2"
FT   mRNA            complement(17204..>18742)
FT                   /locus_tag="mCG_56896"
FT                   /product="mCG56896"
FT                   /note="gene_id=mCG56896.2 transcript_id=mCT57079.2 created
FT                   on 19-AUG-2002"
FT   CDS             complement(17211..>18740)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56896"
FT                   /product="mCG56896"
FT                   /note="gene_id=mCG56896.2 transcript_id=mCT57079.2
FT                   protein_id=mCP28395.2"
FT                   /protein_id="EDL14237.1"
FT                   /translation="AMGALSSRMWSRRNPEENEPVREGAGRGEEAVEAEEAAGPSVVQE
FT                   AQASEQPGVSTGQGGHKRKGSRRGPLAKVPRRTLYESLFLRGENSDIKICAFQEEWHLH
FT                   KSYLCRSGYFSSMFCGAWRESNMDTIEMQMPDENIDREAFNDVLGFLYSRRIVIPPPRV
FT                   IAVLATANMLQLDELIQQCEDMMRASVSTETVCNYYYSAENYGLQSIKYVCCQWLLDNL
FT                   MTRKNDELLLGISVDLMKELIASSDLLVVGVEMDVYITLKTWMYLQLEARTCSGSERVL
FT                   LPEELSFAKFRRESDNRPFLDSDQGRAFVSVFQRLRLPYIISDLPSARIIEQDRLIPAA
FT                   WLTPVYKEQWLALLQAEQSRELGRMDINVSDIHGNSMRCGGQLFTDEQCSWTWSGFNFG
FT                   WDLVVCYNNRRIILCRSAMNKSCGLGVSLLWQRKIAFRLRVISLDSTGKSVLRRETDYN
FT                   ILSLRKNQQLEVVNLGNQDIIFPIYVACNFLYLPGESSAGPSGESSRSPIN"
FT   assembly_gap    27932..28614
FT                   /estimated_length=683
FT                   /gap_type="unknown"
FT   assembly_gap    30560..30598
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    34265..34303
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    38601..38968
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    44484..44503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    49816..49873
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    56336..56383
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    58448..58467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    59609..59669
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    60706..60725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(69001..216464)
FT                   /locus_tag="mCG_115438"
FT                   /note="gene_id=mCG115438.1"
FT   mRNA            complement(join(69001..70603,72049..72204,74995..75063,
FT                   78869..79112,91225..91356,97491..97620,101750..101982,
FT                   121192..121371,132607..132822,150503..150682,
FT                   216374..216464))
FT                   /locus_tag="mCG_115438"
FT                   /product="mCG115438, transcript variant mCT116538"
FT                   /note="gene_id=mCG115438.1 transcript_id=mCT116538.1
FT                   created on 14-AUG-2002"
FT   mRNA            complement(join(69001..70603,72049..72204,74281..74342,
FT                   74995..75063,78869..79112,91225..91356,97491..97620,
FT                   101750..101982,121192..121371,132607..132822,
FT                   150503..150682,216374..216464))
FT                   /locus_tag="mCG_115438"
FT                   /product="mCG115438, transcript variant mCT171922"
FT                   /note="gene_id=mCG115438.1 transcript_id=mCT171922.0
FT                   created on 14-AUG-2002"
FT   CDS             complement(join(70575..70603,72049..72204,74995..75063,
FT                   78869..79112,91225..91356,97491..97620,101750..101982,
FT                   121192..121371,132607..132822,150503..150682,
FT                   216374..216403))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115438"
FT                   /product="mCG115438, isoform CRA_a"
FT                   /note="gene_id=mCG115438.1 transcript_id=mCT116538.1
FT                   protein_id=mCP69841.1 isoform=CRA_a"
FT                   /protein_id="EDL14235.1"
FT                   /translation="MQWIRGGTGMLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVL
FT                   DASNKDWWWGQIDDEEGWFPASFVRLWVNQEDGVEEGPSDVQNGHLDPNSDCLCLGRPL
FT                   QNRDQMRANVINEIMSTERHYIKHLKDICEVAMVMHVGGYLKQCRKRRDMFSDEQLKVI
FT                   FGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACME
FT                   LSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHSD
FT                   YRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASVLDWEGEDILDRSSELIYTGEM
FT                   AWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVIDIEDGRDDDF
FT                   NVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIGFEISENQKR
FT                   QAAMTVRKASKQKGVNSARSVPPSYPPPQDPLNQGQYLVPDGIAQSQVFEFTEPKRSQS
FT                   PFWQNFSRGLRVWDS"
FT   CDS             complement(join(74317..74342,74995..75063,78869..79112,
FT                   91225..91356,97491..97620,101750..101982,121192..121371,
FT                   132607..132822,150503..150682,216374..216403))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115438"
FT                   /product="mCG115438, isoform CRA_b"
FT                   /note="gene_id=mCG115438.1 transcript_id=mCT171922.0
FT                   protein_id=mCP94841.0 isoform=CRA_b"
FT                   /protein_id="EDL14236.1"
FT                   /translation="MQWIRGGTGMLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVL
FT                   DASNKDWWWGQIDDEEGWFPASFVRLWVNQEDGVEEGPSDVQNGHLDPNSDCLCLGRPL
FT                   QNRDQMRANVINEIMSTERHYIKHLKDICEVAMVMHVGGYLKQCRKRRDMFSDEQLKVI
FT                   FGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACME
FT                   LSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHSD
FT                   YRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASVLDWEGEDILDRSSELIYTGEM
FT                   AWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVIDIEDGRDDDF
FT                   NVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIGFEISENQKR
FT                   QAAMTVRKASKQKVTQRKWHY"
FT   assembly_gap    98098..98382
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    116402..116907
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    117673..117853
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    119590..119619
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    124229..124336
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    145530..145689
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    146911..146985
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    171756..171915
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    173473..173492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    189602..189621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    200660..200831
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    205277..205296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    206352..206371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    217208..219392
FT                   /estimated_length=2185
FT                   /gap_type="unknown"
FT   gene            complement(223237..225292)
FT                   /pseudo
FT                   /locus_tag="mCG_115429"
FT                   /note="gene_id=mCG115429.1"
FT   mRNA            complement(join(223237..223723,224482..225292))
FT                   /pseudo
FT                   /locus_tag="mCG_115429"
FT                   /note="gene_id=mCG115429.1 transcript_id=mCT116533.1
FT                   created on 14-AUG-2002"
FT   assembly_gap    228753..228897
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    238379..238645
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    240893..240969
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    243310..244269
FT                   /estimated_length=960
FT                   /gap_type="unknown"
FT   assembly_gap    245917..245983
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    249380..249947
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   assembly_gap    261821..261894
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    275112..275296
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    278124..297787
FT                   /estimated_length=19664
FT                   /gap_type="unknown"
FT   assembly_gap    299278..300100
FT                   /estimated_length=823
FT                   /gap_type="unknown"
FT   assembly_gap    302061..307546
FT                   /estimated_length=5486
FT                   /gap_type="unknown"
FT   assembly_gap    313380..315903
FT                   /estimated_length=2524
FT                   /gap_type="unknown"
FT   assembly_gap    321460..321618
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   gene            complement(346246..348236)
FT                   /pseudo
FT                   /locus_tag="mCG_61476"
FT                   /note="gene_id=mCG61476.2"
FT   mRNA            complement(346246..348236)
FT                   /pseudo
FT                   /locus_tag="mCG_61476"
FT                   /note="gene_id=mCG61476.2 transcript_id=mCT61659.2 created
FT                   on 19-AUG-2002"
FT   assembly_gap    358303..358420
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    360205..366114
FT                   /estimated_length=5910
FT                   /gap_type="unknown"
FT   assembly_gap    371607..371708
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    373358..373554
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    375397..378678
FT                   /estimated_length=3282
FT                   /gap_type="unknown"
FT   assembly_gap    394998..395133
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   gene            complement(406128..407906)
FT                   /pseudo
FT                   /locus_tag="mCG_1030961"
FT                   /note="gene_id=mCG1030961.1"
FT   mRNA            complement(406128..407906)
FT                   /pseudo
FT                   /locus_tag="mCG_1030961"
FT                   /note="gene_id=mCG1030961.1 transcript_id=mCT148665.1
FT                   created on 20-AUG-2002"
FT   assembly_gap    409646..410355
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   assembly_gap    415918..415937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    423937..423956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    431935..432158
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    435108..435235
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    438023..439237
FT                   /estimated_length=1215
FT                   /gap_type="unknown"
FT   gene            <442355..444348
FT                   /locus_tag="mCG_1031005"
FT                   /note="gene_id=mCG1031005.1"
FT   mRNA            <442355..444348
FT                   /locus_tag="mCG_1031005"
FT                   /product="mCG1031005"
FT                   /note="gene_id=mCG1031005.1 transcript_id=mCT148709.1
FT                   created on 19-AUG-2002"
FT   CDS             <442984..443595
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031005"
FT                   /product="mCG1031005"
FT                   /note="gene_id=mCG1031005.1 transcript_id=mCT148709.1
FT                   protein_id=mCP69712.1"
FT                   /protein_id="EDL14234.1"
FT                   /translation="KNKTTRVQFPKVPSTCELEQGREGGGRMWRDSPKVARGTKESPNA
FT                   FSGQCCHLLNCWQVSFKGVSQGDDQFLEVEIALSSVIPSLLVLNEPLMLHWRNLIQQTT
FT                   QYGHDTLQKTSTKYKERKRIKVKRQEYFQNVYTREGRAQKVNKMKARKHAVCQGPHACV
FT                   TWYWSSVHGHLLSLPCGKRMNSVTQPGGRGKRGRVLDTLR"
FT   gene            complement(447221..466983)
FT                   /gene="2810002O09Rik"
FT                   /locus_tag="mCG_1031118"
FT                   /note="gene_id=mCG1031118.1"
FT   mRNA            complement(join(447221..450702,466754..466983))
FT                   /gene="2810002O09Rik"
FT                   /locus_tag="mCG_1031118"
FT                   /product="RIKEN cDNA 2810002O09"
FT                   /note="gene_id=mCG1031118.1 transcript_id=mCT148822.1
FT                   created on 23-AUG-2002"
FT   CDS             complement(447225..450614)
FT                   /codon_start=1
FT                   /gene="2810002O09Rik"
FT                   /locus_tag="mCG_1031118"
FT                   /product="RIKEN cDNA 2810002O09"
FT                   /note="gene_id=mCG1031118.1 transcript_id=mCT148822.1
FT                   protein_id=mCP69721.1"
FT                   /protein_id="EDL14233.1"
FT                   /translation="MESQQDEAVQTKGASTSSDAQDQGAEKGAKNKTTEATEGPTSEPP
FT                   LSGPGRLKKTAMKLFGGKKGICTLPSFFGGGRSKGSGKVSSKKSLNKSKTHDGLSEASQ
FT                   GPEDVVIEETDLSTPLSKSSAQFPSSQSANGALEIGSKHKTSGTEAIEKAGVEKVPSVH
FT                   KPKKSLKSFFSSIRRHRKGKTSGADQSVPGAKELEGARTRSHEHVSSISLPSSEEIFRD
FT                   TRKENAKPQDAPGPKMSPAQVHFSPTTEKAACKNPEKLTRTCASEFMQPKPVLEGGSLE
FT                   EPHTSETEGKVVAGEVNPPNGPVGDQLSLLFGDVTSLKSFDSLTGCGDIIAEQDMDSMT
FT                   DSMASGGQRANRDGTKRSSCLVTYQGGGEEMALPDDDDNDDEEEEEEEEEEEEEEEEEE
FT                   EEEEEEELLEDEEEVKDGEENDDLEYLWASAQIYPRFNMNLGYHTAISPSHQGYMLLDP
FT                   VQSYPNLGLGELLTPQSDQQESAPNSDEGYYDSTTPGFEDDSGEALGLAHRDCLPRDSY
FT                   SGDALYEFYEPDDSLEHSPPGDDCLYDLRGRNSEMLDPFLNLEPFSSRPPGAMETEEER
FT                   LVTIQKQLLYWELRREQREAQEACAREAHAREAYARDTHTRESYGRNVRARETQALEAH
FT                   SQEGRVQETKVRQEKPALEYQMRPLGPSVMGLVAGTSGGSQTSHRGTTSAFPATSSSEP
FT                   DWRDFRPLEKRFEGTCSKKDQSTCLMQLFQSDAMFEPDMQEANFGGSPRKAYPSYSPPE
FT                   EPEEEEEEKEGNATVSFSQALVEFTSNGNLFTSMSYSSDSDSSFTQNLPELPPMVTFDI
FT                   ADVERDGEGKCEENPEFNNDEDLTASLEAFELGYYHKHAFNSYHSRFYQGLPWGVSSLP
FT                   RYLGLPGVHPRPPPAAMALNRRSRSLDNAESLELELSSSHLAQGYMESDELQAHQEDSD
FT                   EEGEEEEGEWGRDSPLSLYTEPPGVYDWPPWAHCPLPVGPGLAWMSPNQLYEPFNQSSY
FT                   VQATCCVPPVAMPVSVPGRTPGDSVSQLARPSHLPLPMGPCYNLQSQASQSGRAKPRDV
FT                   LLPVDEPSCSSISGANSQSQAKPVGITHGIPQLPRVRPEPFQLQPNHYRASNLDLSKER
FT                   GEQGASLSTSYSSTAMNGNLAK"
FT   assembly_gap    471052..471472
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   assembly_gap    475390..475409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    477645..479048
FT                   /estimated_length=1404
FT                   /gap_type="unknown"
FT   assembly_gap    480840..481527
FT                   /estimated_length=688
FT                   /gap_type="unknown"
FT   assembly_gap    491076..491095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(492366..500317)
FT                   /gene="Asb12"
FT                   /locus_tag="mCG_115428"
FT                   /note="gene_id=mCG115428.0"
FT   mRNA            complement(join(492366..492632,493029..493877,
FT                   500172..500317))
FT                   /gene="Asb12"
FT                   /locus_tag="mCG_115428"
FT                   /product="ankyrin repeat and SOCS box-containing protein
FT                   12"
FT                   /note="gene_id=mCG115428.0 transcript_id=mCT116532.0
FT                   created on 08-AUG-2002"
FT   CDS             complement(join(492502..492632,493029..493824))
FT                   /codon_start=1
FT                   /gene="Asb12"
FT                   /locus_tag="mCG_115428"
FT                   /product="ankyrin repeat and SOCS box-containing protein
FT                   12"
FT                   /note="gene_id=mCG115428.0 transcript_id=mCT116532.0
FT                   protein_id=mCP69835.1"
FT                   /db_xref="GOA:Q3KNI9"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1917642"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KNI9"
FT                   /protein_id="EDL14232.1"
FT                   /translation="MNLMDIAKIFSLLQPEKEEEDTGTGEKQALNQAVYDNDSCTLDHL
FT                   LHQERYKRFINSRSGWGIPGTPLRLAASYGHLNCVKVLLEHGADVDSLDVKAQTPLFTA
FT                   VSHGHLECVRMLLEAGACPSGSIYNNCSPVLTASRDGAFAILQELLGHGAEANVKAKLP
FT                   VWASNIASCSGPLYLAAVYGHLDCFRLLLLYGADPDYNCTDQGLLSRVPQPRTLLEICL
FT                   HHNCEPEYIQLLIDFGANIYLPSLPVDPTSQDDKGIKLLLQARATPRSLLSQTRLVIRR
FT                   SLCRANQSQATDQLDIPPVLISYLKHQ"
FT   assembly_gap    532115..532698
FT                   /estimated_length=584
FT                   /gap_type="unknown"
FT   assembly_gap    546938..546957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    548575..549445
FT                   /estimated_length=871
FT                   /gap_type="unknown"
FT   assembly_gap    570288..570453
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    571294..571313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            580295..580788
FT                   /locus_tag="mCG_53103"
FT                   /note="gene_id=mCG53103.1"
FT   mRNA            580295..580788
FT                   /locus_tag="mCG_53103"
FT                   /product="mCG53103"
FT                   /note="gene_id=mCG53103.1 transcript_id=mCT53286.1 created
FT                   on 20-AUG-2002"
FT   CDS             580299..580757
FT                   /codon_start=1
FT                   /locus_tag="mCG_53103"
FT                   /product="mCG53103"
FT                   /note="gene_id=mCG53103.1 transcript_id=mCT53286.1
FT                   protein_id=mCP26748.0"
FT                   /db_xref="GOA:A0A1B0GT24"
FT                   /db_xref="InterPro:IPR005454"
FT                   /db_xref="InterPro:IPR005455"
FT                   /db_xref="MGI:MGI:5804915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1B0GT24"
FT                   /protein_id="EDL14231.1"
FT                   /translation="MQSIEDVSHEVWQDCVKMCLQSELCSDAAIITNCPPWLLASFTEG
FT                   NFTQITQEEIQTLLAREGREKLFLQGITLAGIKCLLIRDNLLTQGNSMDLRTKGQSRSS
FT                   QAVTIVQIESVFLVVMGKKGTEGGPLNLKAFEVAGYMREAILKKMAHS"
FT   assembly_gap    587963..587982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    590187..590730
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    591721..594943
FT                   /estimated_length=3223
FT                   /gap_type="unknown"
FT   assembly_gap    619248..619267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    647149..647476
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    649935..649967
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            650774..651325
FT                   /pseudo
FT                   /locus_tag="mCG_54686"
FT                   /note="gene_id=mCG54686.2"
FT   mRNA            650774..651325
FT                   /pseudo
FT                   /locus_tag="mCG_54686"
FT                   /note="gene_id=mCG54686.2 transcript_id=mCT54869.2 created
FT                   on 16-AUG-2002"
FT   assembly_gap    655924..663522
FT                   /estimated_length=7599
FT                   /gap_type="unknown"
FT   gene            complement(<663572..676613)
FT                   /locus_tag="mCG_115432"
FT                   /note="gene_id=mCG115432.0"
FT   mRNA            complement(join(<663572..663752,676523..676613))
FT                   /locus_tag="mCG_115432"
FT                   /product="mCG115432"
FT                   /note="gene_id=mCG115432.0 transcript_id=mCT116534.0
FT                   created on 14-AUG-2002"
FT   CDS             complement(join(<663572..663752,676523..676575))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115432"
FT                   /product="mCG115432"
FT                   /note="gene_id=mCG115432.0 transcript_id=mCT116534.0
FT                   protein_id=mCP69837.1"
FT                   /protein_id="EDL14230.1"
FT                   /translation="MADEQEIMCKLESIKEIRNFRNKTLQMEKIKARLKAEFEALESEE
FT                   RHLKEYKQEMDLLLQEKMAHVEELRLIHADINV"
FT   assembly_gap    689593..689612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(699777..701150)
FT                   /pseudo
FT                   /locus_tag="mCG_50205"
FT                   /note="gene_id=mCG50205.2"
FT   mRNA            complement(699777..701150)
FT                   /pseudo
FT                   /locus_tag="mCG_50205"
FT                   /note="gene_id=mCG50205.2 transcript_id=mCT50388.2 created
FT                   on 19-AUG-2002"
FT   assembly_gap    709638..716594
FT                   /estimated_length=6957
FT                   /gap_type="unknown"
FT   assembly_gap    719888..719907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    746132..746151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(749986..750658)
FT                   /locus_tag="mCG_16220"
FT                   /note="gene_id=mCG16220.0"
FT   mRNA            complement(join(749986..750203,750377..750658))
FT                   /locus_tag="mCG_16220"
FT                   /product="mCG16220"
FT                   /note="gene_id=mCG16220.0 transcript_id=mCT16479.1 created
FT                   on 14-AUG-2002"
FT   CDS             complement(join(750108..750203,750377..750634))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16220"
FT                   /product="mCG16220"
FT                   /note="gene_id=mCG16220.0 transcript_id=mCT16479.1
FT                   protein_id=mCP20626.2"
FT                   /protein_id="EDL14229.1"
FT                   /translation="MVKATKKRHNLIQDVVPSTTTSKPKRVMNCLIPDAVPSTWTSEPK
FT                   TVDTCLTPDVEPSTSTAEPKTVKICLHQFQSKCSKKIRRPKVPTMKNKKTLGRMLKKKA
FT                   SKNNIAPKRRFDL"
FT   assembly_gap    760644..774491
FT                   /estimated_length=13848
FT                   /gap_type="unknown"
FT   assembly_gap    775598..776494
FT                   /estimated_length=897
FT                   /gap_type="unknown"
FT   assembly_gap    780048..780756
FT                   /estimated_length=709
FT                   /gap_type="unknown"
FT   assembly_gap    800740..800759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(801290..806323)
FT                   /pseudo
FT                   /locus_tag="mCG_50529"
FT                   /note="gene_id=mCG50529.1"
FT   mRNA            complement(join(801290..801770,802437..802481,
FT                   802536..802755,805226..806323))
FT                   /pseudo
FT                   /locus_tag="mCG_50529"
FT                   /note="gene_id=mCG50529.1 transcript_id=mCT50712.1 created
FT                   on 20-AUG-2002"
FT   assembly_gap    811578..811597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    819933..820086
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    827884..827926
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    834837..838455
FT                   /estimated_length=3619
FT                   /gap_type="unknown"
FT   assembly_gap    844686..844705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    850048..850573
FT                   /estimated_length=526
FT                   /gap_type="unknown"
FT   assembly_gap    851638..851657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    853050..853069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    857492..857511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    863405..863839
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    865899..867010
FT                   /estimated_length=1112
FT                   /gap_type="unknown"
FT   assembly_gap    876567..877424
FT                   /estimated_length=858
FT                   /gap_type="unknown"
FT   assembly_gap    883904..887374
FT                   /estimated_length=3471
FT                   /gap_type="unknown"
FT   assembly_gap    891269..891288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    896161..896260
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   gene            909918..939037
FT                   /locus_tag="mCG_2522"
FT                   /note="gene_id=mCG2522.2"
FT   mRNA            join(909918..910692,933329..933468,935421..935655,
FT                   936240..936346,937526..939037)
FT                   /locus_tag="mCG_2522"
FT                   /product="mCG2522"
FT                   /note="gene_id=mCG2522.2 transcript_id=mCT1922.2 created on
FT                   14-AUG-2002"
FT   CDS             join(910088..910692,933329..933468,935421..935655,
FT                   936240..936346,937526..938946)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2522"
FT                   /product="mCG2522"
FT                   /note="gene_id=mCG2522.2 transcript_id=mCT1922.2
FT                   protein_id=mCP20019.2"
FT                   /db_xref="GOA:G3X9I7"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR021869"
FT                   /db_xref="MGI:MGI:2442133"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9I7"
FT                   /protein_id="EDL14228.1"
FT                   /translation="MTATAAVETPKMEKSASKEEKQQPKQEDSTDRGNADPEEWANSES
FT                   DPEQMSCKSGHTSYQATDIQLKKKEMPSKPHRPLCRSPCLDRPSFSQSSILQDGKLDLE
FT                   KEYQAKMDFALKLGYAEEQIQSVLNKLGPESLINDVLAELVRLGNKGDSEAQVNLSLLL
FT                   PRGASSREIASPELSLEDEIDNSDNLRPIVIDGSNVAMSHGNKEEFSCRGIQLAVDWFL
FT                   DKGHKDITVFVPAWRKEQSRPDAPITDQDILRKLEKEKILVFTPSRRVQGRRVVCYDDR
FT                   FIVKLAFDSDGIIVSNDNYRDLQVEKPEWKKFIEERLLMYSFVNDKFMPPDDPLGRHGP
FT                   SLENFLRKRPVVPEHKKQPCPYGKKCTYGHKCKYYHPERANQPQRSVADELRISAKLST
FT                   VKIMSEDTLAKCGAGMSTAKGEITSEIKRVASKRQSDPSIRSVAVEPEEWLSIARKPEA
FT                   SSVPSLVTALSVPTIPPPKSHAVGALNTRSASSPVPGSSHFPHQKASLEHMVSMQYPPI
FT                   LVTNSHGTPINYTEQYPKFETMGDHDYYSVLSDFSKLSINNMHNHEYYMAEANQGVYVR
FT                   NPGLCTDSHMSHTRNDNYSSYNNLYLAVADAHPEGTLKLHRSASHNHLQPFSHGYHEAL
FT                   ARVQSYGSEDSKQAPHKQSVPHLAVHTQNPATGAHSSCPGDYTMPPSIHPVGPSQPGRA
FT                   LVMTRMDSISDSRLYDSNPMRQRRPPLCREQHASWDPLPCTADSYGYHSYPLGNSLMQP
FT                   CYEPVMVRSMPEKMEQLWRNPWVGMCNDSREHMIPEHQYQTYKNLCNIFPSNIVLAVME
FT                   KNPHTADAQQLAALIVAKLRAAR"
FT   gene            complement(946287..967980)
FT                   /gene="Las1l"
FT                   /locus_tag="mCG_2521"
FT                   /note="gene_id=mCG2521.2"
FT   mRNA            complement(join(946287..946625,948348..948498,
FT                   957894..958102,961385..961494,962359..962405,
FT                   962957..963238,964275..964356,966195..966264,
FT                   966928..967053,967711..967973))
FT                   /gene="Las1l"
FT                   /locus_tag="mCG_2521"
FT                   /product="LAS1-like (S. cerevisiae), transcript variant
FT                   mCT171939"
FT                   /note="gene_id=mCG2521.2 transcript_id=mCT171939.0 created
FT                   on 10-SEP-2002"
FT   mRNA            complement(join(946287..946625,948348..948496,
FT                   951285..951922,957894..958102,961385..961494,
FT                   962359..962405,962957..963238,964275..964356,
FT                   966195..966264,966928..967053,967711..967973))
FT                   /gene="Las1l"
FT                   /locus_tag="mCG_2521"
FT                   /product="LAS1-like (S. cerevisiae), transcript variant
FT                   mCT1920"
FT                   /note="gene_id=mCG2521.2 transcript_id=mCT1920.2 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(946496..946625,948348..948498,
FT                   957894..958102,961385..961494,962359..962405,
FT                   962957..963238,964275..964356,966195..966264,
FT                   966928..967053,967711..967901))
FT                   /codon_start=1
FT                   /gene="Las1l"
FT                   /locus_tag="mCG_2521"
FT                   /product="LAS1-like (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG2521.2 transcript_id=mCT171939.0
FT                   protein_id=mCP94858.0 isoform=CRA_a"
FT                   /protein_id="EDL14225.1"
FT                   /translation="MDRVWRAWDGQSFKENQPESPSARGIVVSWLSRAEWEQVTVYLFC
FT                   DDHKLQQYALNRITVWRSRLGNELPLAVASTADLVRCKLIDAAGTLGTDELRLLYGMAL
FT                   VRFVNLISERKTKCSNLPLKYLAQEVNIPDWIVELRHNLTHKKMPHINECRRGCYFVLN
FT                   WLQKTYWSRQLEGSLKETWELDEDQLDAEDPEEEEREIIADDVLEEIPEPQDDDKDEEL
FT                   AVEDDANTKGNEEVASHPEPSSRHKELYEKARELLVSYEEEQFKVLEKHRHLLQAIKVW
FT                   NNLSPRVQCILEELKSISWENRENIDLNEVLVPKPFSQFWQPLLRGLHSQTFTQALLER
FT                   MFSELSTVGSTGIRPTYILRWTVELIVANTKTEDVRWGTFPLGRLPGQTEDPAELMLDN
FT                   YDTMYLLDQPVIEHRLEPQKSKSSTLSLCCGGSNTNSSSSSSSGNMEGLLWNQGQMHGL
FT                   KAGLQLF"
FT   CDS             complement(join(946496..946625,948348..948496,
FT                   951285..951922,957894..958102,961385..961494,
FT                   962359..962405,962957..963238,964275..964356,
FT                   966195..966264,966928..967053,967711..967901))
FT                   /codon_start=1
FT                   /gene="Las1l"
FT                   /locus_tag="mCG_2521"
FT                   /product="LAS1-like (S. cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG2521.2 transcript_id=mCT1920.2
FT                   protein_id=mCP20018.2 isoform=CRA_c"
FT                   /protein_id="EDL14227.1"
FT                   /translation="MDRVWRAWDGQSFKENQPESPSARGIVVSWLSRAEWEQVTVYLFC
FT                   DDHKLQQYALNRITVWRSRLGNELPLAVASTADLVRCKLIDAAGTLGTDELRLLYGMAL
FT                   VRFVNLISERKTKCSNLPLKYLAQEVNIPDWIVELRHNLTHKKMPHINECRRGCYFVLN
FT                   WLQKTYWSRQLEGSLKETWELDEDQLDAEDPEEEEREIIADDVLEEIPEPQDDDKDEEL
FT                   AVEDDANTKGNEEVASHPEPSSRHKELYEKARELLVSYEEEQFKVLEKHRHLLQAIKVW
FT                   NNLSPRVQCILEELKSISWENRENIDLNEVLVPKPFSQFWQPLLRGLHSQTFTQALLER
FT                   MFSELSTVGSTGIRPTYILRWTVELIVANTKTVFKAMGQVLPDEEQEKLLRVCSIYTQN
FT                   GENGLAKAIEGSSSSSTGKAPYTLDTLHEDLQPPGTNCESEESIQQKEQGNLKDVKQEE
FT                   KKENEEEEKEEEEMEEEEEEEEEEKEEEEEEQEQEEHQEEEQEEEEEEENQKVFQDQME
FT                   ADVEESDDVEEEEEVDDEEEDEDDDYDDDEEEDRMEVGAFSLAQGSSVFENTRTTSRKR
FT                   EALQGSAWQDVRWGTFPLGRLPGQTEDPAELMLDNYDTMYLLDQPVIEHRLEPQKSKSS
FT                   TLSLCCGGSNTNSSSSSSSGNMEGLLWNQGQMHGLKAGLQLF"
FT   mRNA            complement(join(951668..951924,957893..958102,
FT                   959546..961494,962359..962405,962957..963238,
FT                   964275..964356,966195..966264,966928..967053,
FT                   967711..967980))
FT                   /gene="Las1l"
FT                   /locus_tag="mCG_2521"
FT                   /product="LAS1-like (S. cerevisiae), transcript variant
FT                   mCT173158"
FT                   /note="gene_id=mCG2521.2 transcript_id=mCT173158.0 created
FT                   on 10-SEP-2002"
FT   assembly_gap    957279..957828
FT                   /estimated_length=550
FT                   /gap_type="unknown"
FT   assembly_gap    958447..959545
FT                   /estimated_length=1099
FT                   /gap_type="unknown"
FT   CDS             complement(join(961369..961494,962359..962405,
FT                   962957..963238,964275..964356,966195..966264,
FT                   966928..967053,967711..967901))
FT                   /codon_start=1
FT                   /gene="Las1l"
FT                   /locus_tag="mCG_2521"
FT                   /product="LAS1-like (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG2521.2 transcript_id=mCT173158.0
FT                   protein_id=mCP96077.0 isoform=CRA_b"
FT                   /protein_id="EDL14226.1"
FT                   /translation="MDRVWRAWDGQSFKENQPESPSARGIVVSWLSRAEWEQVTVYLFC
FT                   DDHKLQQYALNRITVWRSRLGNELPLAVASTADLVRCKLIDAAGTLGTDELRLLYGMAL
FT                   VRFVNLISERKTKCSNLPLKYLAQEVNIPDWIVELRHNLTHKKMPHINECRRGCYFVLN
FT                   WLQKTYWSRQLEGSLKETWELDEDQLDAEDPEEEEREIIADDVLEEIPEPQDDDKDEEL
FT                   AVEDDANTKGNEEVASHPEPSSRHKELYEKARELLVSYEEEQFKVLEKHRHLLQAIKVW
FT                   NNLSPRVQCILEELKSISWENRFVTW"
FT   assembly_gap    963914..963933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    972347..972590
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    974904..975553
FT                   /estimated_length=650
FT                   /gap_type="unknown"
FT   assembly_gap    978914..979280
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    983788..984140
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   gene            <994544..998091
FT                   /locus_tag="mCG_140933"
FT                   /note="gene_id=mCG140933.0"
FT   mRNA            join(<994544..994772,994908..995038,995113..995390,
FT                   995439..995927,996578..996702,997099..997216,
FT                   997561..997725,997803..998091)
FT                   /locus_tag="mCG_140933"
FT                   /product="mCG140933"
FT                   /note="gene_id=mCG140933.0 transcript_id=mCT172308.0
FT                   created on 19-AUG-2002"
FT   CDS             join(<994674..994772,994908..995038,995113..995390,
FT                   995439..995716)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140933"
FT                   /product="mCG140933"
FT                   /note="gene_id=mCG140933.0 transcript_id=mCT172308.0
FT                   protein_id=mCP95227.0"
FT                   /protein_id="EDL14224.1"
FT                   /translation="VGTTIKNRIIDGTIGHGAPGLNTLRMIIGMWTKAKLDCQPWERHS
FT                   NLQCKETQERAGSRTGSESSQTGASATSGNIKSLEKKTLNKKEDCHSPTSKLPKSHQPP
FT                   SVMPAPAPPSKGNVWVKGSCNFPAQSQSSDSEHKSPTSGGGKVSPAHPSEDGLSRKNEK
FT                   KNGWDEWSKDNWKELDRKGGKWKDQYSRPAPDPKQSEGNPASKFSSASKYAALSPCMVK
FT                   MRMRERTTPRRPSHLCFLLVSILEHSREKKSNLHLDKTK"
FT   assembly_gap    999353..999485
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    1002427..1003442
FT                   /estimated_length=1016
FT                   /gap_type="unknown"
FT   assembly_gap    1008369..1008457
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    1037396..1037658
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    1050033..1051152
FT                   /estimated_length=1120
FT                   /gap_type="unknown"
FT   assembly_gap    1054218..1054237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1054672..1054691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1059635..1059852
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    1061403..1063507
FT                   /estimated_length=2105
FT                   /gap_type="unknown"
FT   assembly_gap    1068646..1069068
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   assembly_gap    1070080..1071061
FT                   /estimated_length=982
FT                   /gap_type="unknown"
FT   assembly_gap    1079172..1079366
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    1082816..1083211
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    1084255..1084486
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    1093546..1093847
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   gene            1097998..1170108
FT                   /gene="Msn"
FT                   /locus_tag="mCG_2520"
FT                   /note="gene_id=mCG2520.2"
FT   mRNA            join(1097998..1098185,1143721..1143804,1152477..1152572,
FT                   1154381..1155896)
FT                   /gene="Msn"
FT                   /locus_tag="mCG_2520"
FT                   /product="moesin, transcript variant mCT185406"
FT                   /note="gene_id=mCG2520.2 transcript_id=mCT185406.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(1098037..1098185,1143721..1143804,1152477..1152572,
FT                   1154381..1154655,1156152..1156235,1157321..1157467,
FT                   1159704..1159800,1161945..1162108,1165607..1165737,
FT                   1166995..1167088,1167546..1167770,1168091..1170108)
FT                   /gene="Msn"
FT                   /locus_tag="mCG_2520"
FT                   /product="moesin, transcript variant mCT1919"
FT                   /note="gene_id=mCG2520.2 transcript_id=mCT1919.2 created on
FT                   13-JUN-2003"
FT   mRNA            join(1098037..1098185,1143721..1143804,1152477..1153816)
FT                   /gene="Msn"
FT                   /locus_tag="mCG_2520"
FT                   /product="moesin, transcript variant mCT185407"
FT                   /note="gene_id=mCG2520.2 transcript_id=mCT185407.0 created
FT                   on 13-JUN-2003"
FT   CDS             join(1098174..1098185,1143721..1143804,1152477..1152572,
FT                   1154381..1154655,1156152..1156235,1157321..1157467,
FT                   1159704..1159800,1161945..1162108,1165607..1165737,
FT                   1166995..1167017)
FT                   /codon_start=1
FT                   /gene="Msn"
FT                   /locus_tag="mCG_2520"
FT                   /product="moesin, isoform CRA_c"
FT                   /note="gene_id=mCG2520.2 transcript_id=mCT1919.2
FT                   protein_id=mCP20016.2 isoform=CRA_c"
FT                   /protein_id="EDL14223.1"
FT                   /translation="MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFF
FT                   GLQYQDTKAFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFL
FT                   QVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKL
FT                   NKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDA
FT                   LGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   ALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERALLENEKKKRELAEKEKEKI
FT                   EREKEELMEKLKQIEEQTKKAQQGLQKWQS"
FT   CDS             join(1098174..1098185,1143721..1143804,1152477..1152572,
FT                   1154381..1154659)
FT                   /codon_start=1
FT                   /gene="Msn"
FT                   /locus_tag="mCG_2520"
FT                   /product="moesin, isoform CRA_a"
FT                   /note="gene_id=mCG2520.2 transcript_id=mCT185406.0
FT                   protein_id=mCP106665.0 isoform=CRA_a"
FT                   /protein_id="EDL14221.1"
FT                   /translation="MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFF
FT                   GLQYQDTKAFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFL
FT                   QVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQR"
FT   CDS             join(1098174..1098185,1143721..1143804,1152477..1152608)
FT                   /codon_start=1
FT                   /gene="Msn"
FT                   /locus_tag="mCG_2520"
FT                   /product="moesin, isoform CRA_b"
FT                   /note="gene_id=mCG2520.2 transcript_id=mCT185407.0
FT                   protein_id=mCP106664.0 isoform=CRA_b"
FT                   /protein_id="EDL14222.1"
FT                   /translation="MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFF
FT                   GLQYQDTKAFSTWLKLNKKVITYYLEKFSR"
FT   assembly_gap    1109802..1109821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1117867..1117886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1138389..1138408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1163817..1164195
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    1165834..1166945
FT                   /estimated_length=1112
FT                   /gap_type="unknown"
FT   assembly_gap    1170317..1170388
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    1177387..1177472
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    1179018..1179681
FT                   /estimated_length=664
FT                   /gap_type="unknown"
FT   assembly_gap    1182826..1183179
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    1188343..1188362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1190168..1190301
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    1192738..1193559
FT                   /estimated_length=822
FT                   /gap_type="unknown"
FT   assembly_gap    1201343..1201430
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   gene            complement(1225361..>1226823)
FT                   /locus_tag="mCG_116214"
FT                   /note="gene_id=mCG116214.1"
FT   mRNA            complement(join(1225361..1226218,1226697..>1226823))
FT                   /locus_tag="mCG_116214"
FT                   /product="mCG116214"
FT                   /note="gene_id=mCG116214.1 transcript_id=mCT117331.1
FT                   created on 14-AUG-2002"
FT   CDS             complement(join(1225928..1226218,1226697..>1226822))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116214"
FT                   /product="mCG116214"
FT                   /note="gene_id=mCG116214.1 transcript_id=mCT117331.1
FT                   protein_id=mCP70013.1"
FT                   /protein_id="EDL14220.1"
FT                   /translation="GLRKKKQYNSVTGKTEVKVKREVGRAWPGHSFCREELSSPASTVF
FT                   PSSGPPNVFSISVGLPAEIWSSNHLFPSTEEATLFLGTLDTVFLFSCAVGLFISGIIGD
FT                   QLNLRRVLSFGMCSSVFVVFVFGILTEWLYFYNK"
FT   assembly_gap    1234703..1234722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1240920..1244591
FT                   /locus_tag="mCG_147482"
FT                   /note="gene_id=mCG147482.0"
FT   mRNA            join(1240920..1240951,1241368..1244591)
FT                   /locus_tag="mCG_147482"
FT                   /product="mCG147482"
FT                   /note="gene_id=mCG147482.0 transcript_id=mCT187745.0
FT                   created on 13-JAN-2004"
FT   CDS             1242872..1243090
FT                   /codon_start=1
FT                   /locus_tag="mCG_147482"
FT                   /product="mCG147482"
FT                   /note="gene_id=mCG147482.0 transcript_id=mCT187745.0
FT                   protein_id=mCP108722.0"
FT                   /db_xref="GOA:Q3TDG6"
FT                   /db_xref="MGI:MGI:3641813"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TDG6"
FT                   /protein_id="EDL14219.1"
FT                   /translation="MRKGNQVRQSRLRPQEITVSILLNKLSIFSPVSIYLICLILKHIL
FT                   VTFIYVQGIKYRVLYKLGKCSATEFYL"
FT   assembly_gap    1245998..1246017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1247336..1247355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1247970..1294961)
FT                   /gene="Vsig4"
FT                   /locus_tag="mCG_116211"
FT                   /note="gene_id=mCG116211.1"
FT   mRNA            complement(join(1247970..1248659,1248983..1249004,
FT                   1250644..1250748,1292015..1292371,1294839..1294961))
FT                   /gene="Vsig4"
FT                   /locus_tag="mCG_116211"
FT                   /product="V-set and immunoglobulin domain containing 4"
FT                   /note="gene_id=mCG116211.1 transcript_id=mCT117328.1
FT                   created on 14-AUG-2002"
FT   CDS             complement(join(1248491..1248659,1248983..1249004,
FT                   1250644..1250748,1292015..1292371,1294839..1294893))
FT                   /codon_start=1
FT                   /gene="Vsig4"
FT                   /locus_tag="mCG_116211"
FT                   /product="V-set and immunoglobulin domain containing 4"
FT                   /note="gene_id=mCG116211.1 transcript_id=mCT117328.1
FT                   protein_id=mCP69866.1"
FT                   /protein_id="EDL14218.1"
FT                   /translation="MEISSGLLFLGHLIVLTYGHPTLKTLESVTGTWKGDVKIQCIYDP
FT                   LRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQ
FT                   MDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKWRNLPIFAIIFIISLCCIVAVTIPYI
FT                   LFRCRTFQQEYVYGVSRVFARKTSNSEETTRVTTIATDEPDSQALISDYSDDPCLSQEY
FT                   QITIRSTMSIPAC"
FT   assembly_gap    1251917..1252132
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    1258846..1259484
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   assembly_gap    1260896..1260915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1262395..1263730
FT                   /estimated_length=1336
FT                   /gap_type="unknown"
FT   assembly_gap    1265650..1283349
FT                   /estimated_length=17700
FT                   /gap_type="unknown"
FT   assembly_gap    1288808..1289052
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    1299402..1299421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1307749..>1353422)
FT                   /gene="B230358A15Rik"
FT                   /locus_tag="mCG_142385"
FT                   /note="gene_id=mCG142385.0"
FT   mRNA            complement(join(1307749..1309383,1314154..1314253,
FT                   1315884..1316099,1321378..1321508,1321696..1321777,
FT                   1323089..1323150,1323387..1323462,1330520..1330644,
FT                   1339846..1339973,1353306..>1353422))
FT                   /gene="B230358A15Rik"
FT                   /locus_tag="mCG_142385"
FT                   /product="RIKEN cDNA B230358A15"
FT                   /note="gene_id=mCG142385.0 transcript_id=mCT180066.0
FT                   created on 10-FEB-2003"
FT   CDS             complement(join(1309372..1309383,1314154..1314253,
FT                   1315884..1316099,1321378..1321508,1321696..1321777,
FT                   1323089..1323150,1323387..1323462,1330520..1330644,
FT                   1339846..1339973,1353306..>1353420))
FT                   /codon_start=1
FT                   /gene="B230358A15Rik"
FT                   /locus_tag="mCG_142385"
FT                   /product="RIKEN cDNA B230358A15"
FT                   /note="gene_id=mCG142385.0 transcript_id=mCT180066.0
FT                   protein_id=mCP102988.0"
FT                   /protein_id="EDL14217.1"
FT                   /translation="YKDGHSFQIVNEETFAREVLPKYFKHNKITSFIRQLNMYGFRKVF
FT                   ALQTEKTSQENKISIEFQHPLFKRGEACLLANIKRKVPTIKIEGASLYSDEFQKIVTEM
FT                   QEFKDMQRKMDAKYTQMKQDYSNLYHEVTNLRKKYCAQQQLLTRVLHFILDLMSENHTV
FT                   LKKRKRSLSFISEDSDSEWDHQYFRIPEDKKEAMEILKDGYELVEDKYKSLLDRVMPIL
FT                   KESKKLISSGDQPSGDDGEHPKVPVQDKPMNEESLTIQLDLTIPVLPEQITEESVEQEP
FT                   KDISLELDLSSQDSILMKDKSDNLYNNIINRDKKDMHHTEGNLLELNSLLSRKALNYDS
FT                   DHFSETII"
FT   assembly_gap    1311027..1312161
FT                   /estimated_length=1135
FT                   /gap_type="unknown"
FT   assembly_gap    1314768..1314787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1317990..1318702
FT                   /estimated_length=713
FT                   /gap_type="unknown"
FT   assembly_gap    1327038..1327057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1333737..1334130
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    1336147..1336304
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    1337942..1338062
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    1343741..1343760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1354263..1354282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1356858..1357080
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    1364523..1365572
FT                   /estimated_length=1050
FT                   /gap_type="unknown"
FT   assembly_gap    1369235..1369512
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    1377458..1381808
FT                   /estimated_length=4351
FT                   /gap_type="unknown"
FT   assembly_gap    1390346..1413373
FT                   /estimated_length=23028
FT                   /gap_type="unknown"
FT   assembly_gap    1423224..1424100
FT                   /estimated_length=877
FT                   /gap_type="unknown"
FT   assembly_gap    1437911..1441034
FT                   /estimated_length=3124
FT                   /gap_type="unknown"
FT   assembly_gap    1442289..1442497
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    1448152..1448171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1451729..1451748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1454951..1573485
FT                   /gene="Heph"
FT                   /locus_tag="mCG_116210"
FT                   /note="gene_id=mCG116210.0"
FT   mRNA            join(1454951..1455203,1459119..1459313,1462435..1462635,
FT                   1465370..1465614,1469351..1469563,1470139..1470321,
FT                   1472218..1472472,1474764..1474932,1483453..1483589,
FT                   1485650..1485781,1497251..1497459,1498390..1498540,
FT                   1499910..1500122,1526907..1527120,1528798..1528937,
FT                   1529691..1529822,1552843..1552949,1553835..1554060,
FT                   1556510..1556649,1557039..1557201,1569982..1570026,
FT                   1572571..1573485)
FT                   /gene="Heph"
FT                   /locus_tag="mCG_116210"
FT                   /product="hephaestin, transcript variant mCT117327"
FT                   /note="gene_id=mCG116210.0 transcript_id=mCT117327.0
FT                   created on 08-AUG-2002"
FT   mRNA            join(<1455086..1455203,1459119..1459313,1462435..1462635,
FT                   1465370..1465614,1469351..1469563,1470139..1470321,
FT                   1472218..1472472,1474764..1474932,1483453..1483589,
FT                   1485650..1485781,1497251..1497459,1498390..1498540,
FT                   1499910..1500122,1526907..1527120,1528798..1528937,
FT                   1529691..1529822,1552843..1552949,1553835..1554060,
FT                   1556510..1556649,1557039..1557201,1569982..1570026,
FT                   1572574..1573485)
FT                   /gene="Heph"
FT                   /locus_tag="mCG_116210"
FT                   /product="hephaestin, transcript variant mCT190758"
FT                   /note="gene_id=mCG116210.0 transcript_id=mCT190758.0
FT                   created on 08-MAR-2004"
FT   assembly_gap    1455272..1455473
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   mRNA            join(<1455952..1456177,1459119..1459313,1462435..1462635,
FT                   1465370..1465614,1469351..1469563,1470139..1470321,
FT                   1472218..1472472,1474764..1474932,1483453..1483589,
FT                   1485650..1485781,1497251..1497459,1498390..1498540,
FT                   1499910..1500122,1526907..1527120,1528798..1528937,
FT                   1529691..1529822,1552843..1552949,1553835..1554060,
FT                   1556510..1556649,1557039..1557201,1569982..1570026,
FT                   1572571..1573485)
FT                   /gene="Heph"
FT                   /locus_tag="mCG_116210"
FT                   /product="hephaestin, transcript variant mCT190757"
FT                   /note="gene_id=mCG116210.0 transcript_id=mCT190757.0
FT                   created on 08-MAR-2004"
FT   assembly_gap    1456646..1456884
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    1458158..1458214
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   CDS             join(<1459312..1459313,1462435..1462635,1465370..1465614,
FT                   1469351..1469563,1470139..1470321,1472218..1472472,
FT                   1474764..1474932,1483453..1483589,1485650..1485781,
FT                   1497251..1497459,1498390..1498540,1499910..1500122,
FT                   1526907..1527120,1528798..1528937,1529691..1529822,
FT                   1552843..1552949,1553835..1554060,1556510..1556649,
FT                   1557039..1557201,1569982..1570026,1572571..1572803)
FT                   /codon_start=1
FT                   /gene="Heph"
FT                   /locus_tag="mCG_116210"
FT                   /product="hephaestin, isoform CRA_a"
FT                   /note="gene_id=mCG116210.0 transcript_id=mCT190757.0
FT                   protein_id=mCP111702.0 isoform=CRA_a"
FT                   /protein_id="EDL14214.1"
FT                   /translation="IFHFLFLKVLWAMKAGHLLWALLLMHSLWSIPTDGAIRNYYLGIQ
FT                   DMQWNYAPKGRNVITNQTLNNDTVASSFLKSGKNRIGSSYKKTVYKEYSDGTYTEEIAK
FT                   PAWLGFLGPLLQAEVGDVILIHLKNFASRPYTIHPHGVFYEKDSEGSLYPDGSSGYLKA
FT                   DDSVPPGGSHVYNWSIPESHAPTEADPACLTWIYHSHVDAPRDIATGLIGPLITCKRGT
FT                   LDGNSPPQRKDVDHNFFLLFSVIDENLSWHLDDNIATYCSDPASVDKEDGAFQDSNRMH
FT                   AINGFVFGNLPELSMCAQKHVAWHLFGMGNEIDVHTAFFHGQMLSIRGHHTDVANIFPA
FT                   TFVTAEMVPQKSGTWLISCEVNSHLRSGMQAFYKVDSCSMDPPVDQLTGKVRQYFIQAH
FT                   EIQWDYGPIGYDGRTGKSLREPGSGPDKYFQKSSSRIGGTYWKVRYEAFQDETFQERVH
FT                   QEEETHLGILGPVIRAEVGDTIQVVFYNRASQPFSIQPHGVFYEKNSEGTVYNDGTSHP
FT                   KVAKSFEKVTYYWTVPPHAGPTAQDPACLTWMYFSAADPTRDTNSGLVGPLLVCKAGAL
FT                   GADGKQKGVDKEFFLLFTVFDENESWYNNANQAAGMLDSRLLSEDVEGFQDSNRMHAIN
FT                   GFLFSNLPRLDMCKGDTVAWHLLGLGTETDVHGVMFEGNTVQLQGMRKGAVMLFPHTFV
FT                   TAIMQPDNPGIFEIYCQAGSHREEGMQAIYNVSQCSSHQDSPRQHYQASRVYYIMAEEI
FT                   EWDYCPDRSWELEWHNTSEKDSYGHVFLSNKDGLLGSKYKKAVFREYTDGTFRIPRPRS
FT                   GPEEHLGILGPLIRGEVGDILTVVFKNKASRPYSIHAHGVLESNTGGPQAAEPGEVLTY
FT                   QWNIPERSGPGPSDSACVSWIYYSAVDPIKDMYSGLVGPLVICRNGILEPNGGRNDMDR
FT                   EFALLFLIFDENQSWYLKENIATYGPQESSHVNLKDATFLESNKMHAINGKLYANLRGL
FT                   TVYQGERVAWYMLAMGQDTDIHTVHFHAESFLYQNGQSYRADVVDLFPGTFEVVEMVAS
FT                   NPGTWLMHCHVTDHVHAGMETIFTVLSHEEHFSTMTTITKEIGKAVILRDIGGDNVKML
FT                   GMNIPIKDVEILSSALIAICVLLLLIALALGGVVWYQHRQRKLRRNRRSILDDSFKLLS
FT                   LKQ"
FT   CDS             join(<1459312..1459313,1462435..1462635,1465370..1465614,
FT                   1469351..1469563,1470139..1470321,1472218..1472472,
FT                   1474764..1474932,1483453..1483589,1485650..1485781,
FT                   1497251..1497459,1498390..1498540,1499910..1500122,
FT                   1526907..1527120,1528798..1528937,1529691..1529822,
FT                   1552843..1552949,1553835..1554060,1556510..1556649,
FT                   1557039..1557201,1569982..1570026,1572574..1572803)
FT                   /codon_start=1
FT                   /gene="Heph"
FT                   /locus_tag="mCG_116210"
FT                   /product="hephaestin, isoform CRA_b"
FT                   /note="gene_id=mCG116210.0 transcript_id=mCT190758.0
FT                   protein_id=mCP111703.0 isoform=CRA_b"
FT                   /protein_id="EDL14215.1"
FT                   /translation="IFHFLFLKVLWAMKAGHLLWALLLMHSLWSIPTDGAIRNYYLGIQ
FT                   DMQWNYAPKGRNVITNQTLNNDTVASSFLKSGKNRIGSSYKKTVYKEYSDGTYTEEIAK
FT                   PAWLGFLGPLLQAEVGDVILIHLKNFASRPYTIHPHGVFYEKDSEGSLYPDGSSGYLKA
FT                   DDSVPPGGSHVYNWSIPESHAPTEADPACLTWIYHSHVDAPRDIATGLIGPLITCKRGT
FT                   LDGNSPPQRKDVDHNFFLLFSVIDENLSWHLDDNIATYCSDPASVDKEDGAFQDSNRMH
FT                   AINGFVFGNLPELSMCAQKHVAWHLFGMGNEIDVHTAFFHGQMLSIRGHHTDVANIFPA
FT                   TFVTAEMVPQKSGTWLISCEVNSHLRSGMQAFYKVDSCSMDPPVDQLTGKVRQYFIQAH
FT                   EIQWDYGPIGYDGRTGKSLREPGSGPDKYFQKSSSRIGGTYWKVRYEAFQDETFQERVH
FT                   QEEETHLGILGPVIRAEVGDTIQVVFYNRASQPFSIQPHGVFYEKNSEGTVYNDGTSHP
FT                   KVAKSFEKVTYYWTVPPHAGPTAQDPACLTWMYFSAADPTRDTNSGLVGPLLVCKAGAL
FT                   GADGKQKGVDKEFFLLFTVFDENESWYNNANQAAGMLDSRLLSEDVEGFQDSNRMHAIN
FT                   GFLFSNLPRLDMCKGDTVAWHLLGLGTETDVHGVMFEGNTVQLQGMRKGAVMLFPHTFV
FT                   TAIMQPDNPGIFEIYCQAGSHREEGMQAIYNVSQCSSHQDSPRQHYQASRVYYIMAEEI
FT                   EWDYCPDRSWELEWHNTSEKDSYGHVFLSNKDGLLGSKYKKAVFREYTDGTFRIPRPRS
FT                   GPEEHLGILGPLIRGEVGDILTVVFKNKASRPYSIHAHGVLESNTGGPQAAEPGEVLTY
FT                   QWNIPERSGPGPSDSACVSWIYYSAVDPIKDMYSGLVGPLVICRNGILEPNGGRNDMDR
FT                   EFALLFLIFDENQSWYLKENIATYGPQESSHVNLKDATFLESNKMHAINGKLYANLRGL
FT                   TVYQGERVAWYMLAMGQDTDIHTVHFHAESFLYQNGQSYRADVVDLFPGTFEVVEMVAS
FT                   NPGTWLMHCHVTDHVHAGMETIFTVLSHEEHFSTMTTITKEIGKVILRDIGGDNVKMLG
FT                   MNIPIKDVEILSSALIAICVLLLLIALALGGVVWYQHRQRKLRRNRRSILDDSFKLLSL
FT                   KQ"
FT   CDS             join(1462469..1462635,1465370..1465614,1469351..1469563,
FT                   1470139..1470321,1472218..1472472,1474764..1474932,
FT                   1483453..1483589,1485650..1485781,1497251..1497459,
FT                   1498390..1498540,1499910..1500122,1526907..1527120,
FT                   1528798..1528937,1529691..1529822,1552843..1552949,
FT                   1553835..1554060,1556510..1556649,1557039..1557201,
FT                   1569982..1570026,1572571..1572803)
FT                   /codon_start=1
FT                   /gene="Heph"
FT                   /locus_tag="mCG_116210"
FT                   /product="hephaestin, isoform CRA_c"
FT                   /note="gene_id=mCG116210.0 transcript_id=mCT117327.0
FT                   protein_id=mCP69844.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q9Z0Z4"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR024715"
FT                   /db_xref="InterPro:IPR027154"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="MGI:MGI:1332240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z0Z4"
FT                   /protein_id="EDL14216.1"
FT                   /translation="MKAGHLLWALLLMHSLWSIPTDGAIRNYYLGIQDMQWNYAPKGRN
FT                   VITNQTLNNDTVASSFLKSGKNRIGSSYKKTVYKEYSDGTYTEEIAKPAWLGFLGPLLQ
FT                   AEVGDVILIHLKNFASRPYTIHPHGVFYEKDSEGSLYPDGSSGYLKADDSVPPGGSHVY
FT                   NWSIPESHAPTEADPACLTWIYHSHVDAPRDIATGLIGPLITCKRGTLDGNSPPQRKDV
FT                   DHNFFLLFSVIDENLSWHLDDNIATYCSDPASVDKEDGAFQDSNRMHAINGFVFGNLPE
FT                   LSMCAQKHVAWHLFGMGNEIDVHTAFFHGQMLSIRGHHTDVANIFPATFVTAEMVPQKS
FT                   GTWLISCEVNSHLRSGMQAFYKVDSCSMDPPVDQLTGKVRQYFIQAHEIQWDYGPIGYD
FT                   GRTGKSLREPGSGPDKYFQKSSSRIGGTYWKVRYEAFQDETFQERVHQEEETHLGILGP
FT                   VIRAEVGDTIQVVFYNRASQPFSIQPHGVFYEKNSEGTVYNDGTSHPKVAKSFEKVTYY
FT                   WTVPPHAGPTAQDPACLTWMYFSAADPTRDTNSGLVGPLLVCKAGALGADGKQKGVDKE
FT                   FFLLFTVFDENESWYNNANQAAGMLDSRLLSEDVEGFQDSNRMHAINGFLFSNLPRLDM
FT                   CKGDTVAWHLLGLGTETDVHGVMFEGNTVQLQGMRKGAVMLFPHTFVTAIMQPDNPGIF
FT                   EIYCQAGSHREEGMQAIYNVSQCSSHQDSPRQHYQASRVYYIMAEEIEWDYCPDRSWEL
FT                   EWHNTSEKDSYGHVFLSNKDGLLGSKYKKAVFREYTDGTFRIPRPRSGPEEHLGILGPL
FT                   IRGEVGDILTVVFKNKASRPYSIHAHGVLESNTGGPQAAEPGEVLTYQWNIPERSGPGP
FT                   SDSACVSWIYYSAVDPIKDMYSGLVGPLVICRNGILEPNGGRNDMDREFALLFLIFDEN
FT                   QSWYLKENIATYGPQESSHVNLKDATFLESNKMHAINGKLYANLRGLTVYQGERVAWYM
FT                   LAMGQDTDIHTVHFHAESFLYQNGQSYRADVVDLFPGTFEVVEMVASNPGTWLMHCHVT
FT                   DHVHAGMETIFTVLSHEEHFSTMTTITKEIGKAVILRDIGGDNVKMLGMNIPIKDVEIL
FT                   SSALIAICVLLLLIALALGGVVWYQHRQRKLRRNRRSILDDSFKLLSLKQ"
FT   assembly_gap    1465933..1465952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1479023..1479042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1489931..1489950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1521570..1521714
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    1540847..1543070
FT                   /estimated_length=2224
FT                   /gap_type="unknown"
FT   assembly_gap    1633721..1633740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1636427..1636446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1639475..1639494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1653669..1660434
FT                   /estimated_length=6766
FT                   /gap_type="unknown"
FT   assembly_gap    1661363..1661539
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    1664227..1664520
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    1665819..1665838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1681877..1682738
FT                   /estimated_length=862
FT                   /gap_type="unknown"
FT   assembly_gap    1698494..1698513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1713570..1717627
FT                   /locus_tag="mCG_22200"
FT                   /note="gene_id=mCG22200.2"
FT   mRNA            join(1713570..1714587,1715206..1715331,1716386..1716652)
FT                   /locus_tag="mCG_22200"
FT                   /product="mCG22200, transcript variant mCT172827"
FT                   /note="gene_id=mCG22200.2 transcript_id=mCT172827.0 created
FT                   on 03-SEP-2002"
FT   mRNA            join(1713571..1714587,1715206..1715331,1716386..1716519,
FT                   1716970..1717627)
FT                   /locus_tag="mCG_22200"
FT                   /product="mCG22200, transcript variant mCT20584"
FT                   /note="gene_id=mCG22200.2 transcript_id=mCT20584.2 created
FT                   on 03-SEP-2002"
FT   CDS             join(1714129..1714587,1715206..1715331,1716386..1716519,
FT                   1716970..1717618)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22200"
FT                   /product="mCG22200, isoform CRA_b"
FT                   /note="gene_id=mCG22200.2 transcript_id=mCT20584.2
FT                   protein_id=mCP23037.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V3A3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1923456"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V3A3"
FT                   /protein_id="EDL14213.1"
FT                   /translation="MDAPTTDVPPEDFQSPGTMGFGDELTPEALSVPSGFDDLITSTTS
FT                   QVLQAASNAGRNGMLSKMDKLADHMSNSGDLADTSGPLDLEIVSQDEQVQFWLVVGYTI
FT                   VVFAAIIGNWVLNHIIMKYKRVHTATGLFVVNISVTNMMLALLSSPFTMVRYLCNSLVF
FT                   GKMTCHLSRFAQYSCAYVTVMSMAAISLDRHRVMLYPLKARITPMQGNVCIIIIWIVST
FT                   CAALPHAVYQKLYQVEFGNTTEESACLPSFPYTSKSTWKYLDLGTFLLFFILPLLVLVA
FT                   VYGHVAKKLWIHDAVDDINIHTYICQRGKKKQTLKMLMTVVLLYTISWLPLNVYLVLLS
FT                   SESISSHNGLYFFLHWLAISSSCYNPYIYCWLSDSFRIEVQKVIMEIQKMLLDKISRLR
FT                   GEHRRLSSVSHSQTPGSVDPNPGVPKFPRFRDFDELPSPPPSPTVEISFLHSVPRV"
FT   CDS             join(1714129..1714587,1715206..1715331,1716386..1716523)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22200"
FT                   /product="mCG22200, isoform CRA_a"
FT                   /note="gene_id=mCG22200.2 transcript_id=mCT172827.0
FT                   protein_id=mCP95746.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D359"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1923456"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D359"
FT                   /protein_id="EDL14212.1"
FT                   /translation="MDAPTTDVPPEDFQSPGTMGFGDELTPEALSVPSGFDDLITSTTS
FT                   QVLQAASNAGRNGMLSKMDKLADHMSNSGDLADTSGPLDLEIVSQDEQVQFWLVVGYTI
FT                   VVFAAIIGNWVLNHIIMKYKRVHTATGLFVVNISVTNMMLALLSSPFTMVRYLCNSLVF
FT                   GKMTCHLSRFAQYSCAYVTVMSMAAISLDRHRVMLYPLKARITPMQGNVCIIIIWIVST
FT                   CAALPHAVYQKLYQVEFG"
FT   gene            <1718277..1719561
FT                   /locus_tag="mCG_1031112"
FT                   /note="gene_id=mCG1031112.1"
FT   mRNA            join(<1718277..1719405,1719459..1719561)
FT                   /locus_tag="mCG_1031112"
FT                   /product="mCG1031112"
FT                   /note="gene_id=mCG1031112.1 transcript_id=mCT148816.1
FT                   created on 16-AUG-2002"
FT   CDS             <1718510..1718848
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031112"
FT                   /product="mCG1031112"
FT                   /note="gene_id=mCG1031112.1 transcript_id=mCT148816.1
FT                   protein_id=mCP70037.1"
FT                   /protein_id="EDL14211.1"
FT                   /translation="PLSISFSLLLLYLLLIFLSHFLLYFHFCFTVIFLIVFNKNVTMAS
FT                   YPVSTVISPGWLVRYGQVSRSGNEGVRVSCQLLCFHLVKRCGGFFLGGVQMFLVNYHNC
FT                   YSVEFLFR"
FT   assembly_gap    1719418..1719437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1723154..1723173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1751487..1751665
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    1757854..1758123
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    1767768..1767787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1785686..1785836
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    1794842..1794997
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    1799874..1799893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1814622..1815211
FT                   /estimated_length=590
FT                   /gap_type="unknown"
FT   assembly_gap    1817660..1817770
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    1827706..1827858
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    1834527..1834546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1836894..1836913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1839388..1839407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1858543..1858926
FT                   /estimated_length=384
FT                   /gap_type="unknown"
FT   assembly_gap    1861419..1862002
FT                   /estimated_length=584
FT                   /gap_type="unknown"
FT   assembly_gap    1865592..1865699
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   gene            complement(1879295..1881768)
FT                   /pseudo
FT                   /locus_tag="mCG_112946"
FT                   /note="gene_id=mCG112946.1"
FT   mRNA            complement(join(1879295..1879949,1881670..1881768))
FT                   /pseudo
FT                   /locus_tag="mCG_112946"
FT                   /note="gene_id=mCG112946.1 transcript_id=mCT114023.1
FT                   created on 14-AUG-2002"
FT   assembly_gap    1893980..1894184
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    1897011..1897527
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    1903029..1903075
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    1913796..1914159
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    1917197..1917216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1922505..1922524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1926936..1926955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1928105..1928124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1934159..1934308
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    1938923..1938942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1944001..1944020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1949538..1949557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1951314..1951333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1952555..1952574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1956334..>1957776)
FT                   /locus_tag="mCG_1031110"
FT                   /note="gene_id=mCG1031110.1"
FT   mRNA            complement(join(1956334..1956563,1956643..1957469,
FT                   1957639..>1957776))
FT                   /locus_tag="mCG_1031110"
FT                   /product="mCG1031110"
FT                   /note="gene_id=mCG1031110.1 transcript_id=mCT148814.1
FT                   created on 15-AUG-2002"
FT   CDS             complement(join(1957401..1957469,1957639..1957776))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031110"
FT                   /product="mCG1031110"
FT                   /note="gene_id=mCG1031110.1 transcript_id=mCT148814.1
FT                   protein_id=mCP70030.1"
FT                   /protein_id="EDL14210.1"
FT                   /translation="MVKATKKTHYLTQDVVPSTSASKPKTVKICHRQPCPKCSKKIRNP
FT                   KVQKPKKKSKETRSKQGNTVKHS"
FT   assembly_gap    1960671..1960690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1969465..1969484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1971352..1971512
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    1976416..1976435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1979813..1979871
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    1988929..1989065
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    1991512..1991531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2012671..2012690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2028237..2034675
FT                   /estimated_length=6439
FT                   /gap_type="unknown"
FT   gene            complement(2038576..2039592)
FT                   /pseudo
FT                   /locus_tag="mCG_1030999"
FT                   /note="gene_id=mCG1030999.1"
FT   mRNA            complement(2038576..2039592)
FT                   /pseudo
FT                   /locus_tag="mCG_1030999"
FT                   /note="gene_id=mCG1030999.1 transcript_id=mCT148703.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    2042654..2046982
FT                   /estimated_length=4329
FT                   /gap_type="unknown"
FT   assembly_gap    2048609..2048628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2055161..2055942
FT                   /estimated_length=782
FT                   /gap_type="unknown"
FT   gene            2063232..>2069014
FT                   /locus_tag="mCG_112945"
FT                   /note="gene_id=mCG112945.2"
FT   mRNA            join(2063232..2063412,2066553..2067042,2067246..2067371,
FT                   2067755..2067888,2068294..>2069014)
FT                   /locus_tag="mCG_112945"
FT                   /product="mCG112945"
FT                   /note="gene_id=mCG112945.2 transcript_id=mCT114022.2
FT                   created on 18-APR-2003"
FT   CDS             join(2066653..2067042,2067246..2067371,2067755..2067888,
FT                   2068294..2069014)
FT                   /codon_start=1
FT                   /locus_tag="mCG_112945"
FT                   /product="mCG112945"
FT                   /note="gene_id=mCG112945.2 transcript_id=mCT114022.2
FT                   protein_id=mCP69941.2"
FT                   /db_xref="GOA:Q80T54"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000611"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2676330"
FT                   /db_xref="UniProtKB/TrEMBL:Q80T54"
FT                   /protein_id="EDL14209.1"
FT                   /translation="MNTSFKGVSPFLSQMESAIDWLGENISWVPSIEDQSCNHTTQNGT
FT                   NISSAEWGGPTGSVRRWLGGNPHIMAKIVLTFAYAVIIVISLFGNSLVCQVFVKHKEIK
FT                   KSTGLLIFNLAISDILIILLNSPFALARFLSGQWVFGRIMCHVSRFAQYCSLHVSTLTL
FT                   MAVAMDRHRVILHPMKPRLTHSQCLFVVAMIWSIAVFLALPHAIYQNLFTLVNMDGDTR
FT                   SYCLPSFPGPSILVSKYVDLGTFILLYILPLLVIVVTYSHLGKRLWIQNAIGDASARQL
FT                   MAHYQKRKKSIRMLILIVLVFAVCWFPLNFYVVLISSAGVENDSVLFYAFHWFAMSSTC
FT                   YNPFIYCWLNRSFRAKLRSISSFRMQSLFVCSNSQVQQIKPQESHELRELQTSSLLRVP
FT                   LAVPEPQVFEDPSLATGDNSQVSVQGEWEDPDPTLDEEPGPSTRDTYFCIHMQTSSH"
FT   assembly_gap    2103429..2103463
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    2107210..2107254
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    2113000..2113019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2130234..2130253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2133196..2133215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2139669..2141359
FT                   /estimated_length=1691
FT                   /gap_type="unknown"
FT   gene            complement(2151906..2153296)
FT                   /pseudo
FT                   /locus_tag="mCG_1030998"
FT                   /note="gene_id=mCG1030998.1"
FT   mRNA            complement(2151906..2153296)
FT                   /pseudo
FT                   /locus_tag="mCG_1030998"
FT                   /note="gene_id=mCG1030998.1 transcript_id=mCT148702.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    2160161..2161738
FT                   /estimated_length=1578
FT                   /gap_type="unknown"
FT   assembly_gap    2165797..2165912
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    2169036..2169055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2175056..2176574
FT                   /estimated_length=1519
FT                   /gap_type="unknown"
FT   assembly_gap    2177630..2178263
FT                   /estimated_length=634
FT                   /gap_type="unknown"
FT   assembly_gap    2179286..2180688
FT                   /estimated_length=1403
FT                   /gap_type="unknown"
FT   assembly_gap    2183142..2183423
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    2193511..2193604
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    2197978..2197997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2211918..2214284
FT                   /estimated_length=2367
FT                   /gap_type="unknown"
FT   assembly_gap    2215356..2215375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2218767..2218786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2223067..2223104
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    2229716..2229735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2233834..2233863
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    2240577..2240710
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    2247927..2247946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2256250..2257397
FT                   /estimated_length=1148
FT                   /gap_type="unknown"
FT   assembly_gap    2258709..2258813
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    2262552..2263615
FT                   /estimated_length=1064
FT                   /gap_type="unknown"
FT   assembly_gap    2264905..2265343
FT                   /estimated_length=439
FT                   /gap_type="unknown"
FT   assembly_gap    2270455..2270521
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    2272877..2272896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2281568..2281587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2285342..2285699
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    2286942..2287061
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    2290718..2296106
FT                   /estimated_length=5389
FT                   /gap_type="unknown"
FT   assembly_gap    2301851..2302173
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    2305293..2305371
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    2307608..2307627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2318923..2318942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2319401..2320545
FT                   /locus_tag="mCG_1031108"
FT                   /note="gene_id=mCG1031108.1"
FT   mRNA            join(<2319401..2319471,2319562..2320545)
FT                   /locus_tag="mCG_1031108"
FT                   /product="mCG1031108"
FT                   /note="gene_id=mCG1031108.1 transcript_id=mCT148812.1
FT                   created on 15-AUG-2002"
FT   CDS             <2319646..2319819
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031108"
FT                   /product="mCG1031108"
FT                   /note="gene_id=mCG1031108.1 transcript_id=mCT148812.1
FT                   protein_id=mCP70021.0"
FT                   /protein_id="EDL14208.1"
FT                   /translation="YLDSFTYHILSLNSDISSIIISIILNFYYLMLYYNFIHSSVDKIG
FT                   LLSILIIINTLL"
FT   gene            complement(2325252..>2363962)
FT                   /gene="Eda2r"
FT                   /locus_tag="mCG_4519"
FT                   /note="gene_id=mCG4519.2"
FT   mRNA            complement(join(2325252..2326276,2328203..2328367,
FT                   2329867..2329952,2330471..2330649,2348310..2348407,
FT                   2357907..2358003,2363847..>2363962))
FT                   /gene="Eda2r"
FT                   /locus_tag="mCG_4519"
FT                   /product="ectodysplasin A2 isoform receptor, transcript
FT                   variant mCT3475"
FT                   /note="gene_id=mCG4519.2 transcript_id=mCT3475.2 created on
FT                   11-SEP-2002"
FT   CDS             complement(join(2325900..2326276,2328203..2328367,
FT                   2329867..2329952,2330471..2330649,2348310..2348407,
FT                   2357907..>2357907))
FT                   /codon_start=1
FT                   /gene="Eda2r"
FT                   /locus_tag="mCG_4519"
FT                   /product="ectodysplasin A2 isoform receptor, isoform CRA_b"
FT                   /note="gene_id=mCG4519.2 transcript_id=mCT3475.2
FT                   protein_id=mCP18212.2 isoform=CRA_b"
FT                   /protein_id="EDL14207.1"
FT                   /translation="VFFIMDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHC
FT                   IVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQ
FT                   DQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREATLVALVGSLLVVFALAFLGLFF
FT                   LYCKQIFNRHCQCRDSLQYEAEKTVEEDSLFPVPPGQETSPEFPANEGILEIKPLNSIL
FT                   DDDCSSTRGFPTQESFTMASCASESHSQWVHTPIECTELDLQKFSSSIPSTGPETLREN
FT                   TAEHSGDRLELYVPFEVPSL"
FT   assembly_gap    2326409..2327699
FT                   /estimated_length=1291
FT                   /gap_type="unknown"
FT   mRNA            complement(join(2328121..2328367,2329867..2329952,
FT                   2330471..2330649,2348310..2348407,2357907..2358003,
FT                   2363847..>2363962))
FT                   /gene="Eda2r"
FT                   /locus_tag="mCG_4519"
FT                   /product="ectodysplasin A2 isoform receptor, transcript
FT                   variant mCT173162"
FT                   /note="gene_id=mCG4519.2 transcript_id=mCT173162.0 created
FT                   on 11-SEP-2002"
FT   CDS             complement(join(2328162..2328367,2329867..2329952,
FT                   2330471..2330649,2348310..2348407,2357907..>2357907))
FT                   /codon_start=1
FT                   /gene="Eda2r"
FT                   /locus_tag="mCG_4519"
FT                   /product="ectodysplasin A2 isoform receptor, isoform CRA_a"
FT                   /note="gene_id=mCG4519.2 transcript_id=mCT173162.0
FT                   protein_id=mCP96081.0 isoform=CRA_a"
FT                   /protein_id="EDL14206.1"
FT                   /translation="VFFIMDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHC
FT                   IVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQ
FT                   DQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREATLVALVGSLLVVFALAFLGLFF
FT                   LYCKQIFNRHCQCSKYIYLIFHMNQE"
FT   assembly_gap    2342460..2342479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2349230..2349802
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    2379500..2379519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2383471..2383518
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    2387417..2387436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2398118..2398137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2401597..2402517
FT                   /estimated_length=921
FT                   /gap_type="unknown"
FT   assembly_gap    2407786..2408417
FT                   /estimated_length=632
FT                   /gap_type="unknown"
FT   assembly_gap    2442005..2442409
FT                   /estimated_length=405
FT                   /gap_type="unknown"
FT   assembly_gap    2459873..2460615
FT                   /estimated_length=743
FT                   /gap_type="unknown"
FT   assembly_gap    2461731..2461982
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    2477739..2477758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2480967..2481182
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    2482721..2483307
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    2486233..2487202
FT                   /estimated_length=970
FT                   /gap_type="unknown"
FT   assembly_gap    2497819..2497903
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    2521615..2521735
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    2533193..2533212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2534969..2534988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2537182..2537232
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    2538462..2538526
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    2544567..2545215
FT                   /estimated_length=649
FT                   /gap_type="unknown"
FT   assembly_gap    2560690..2560920
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    2569270..2572818
FT                   /estimated_length=3549
FT                   /gap_type="unknown"
FT   assembly_gap    2583273..2583438
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    2588323..2588342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2597436..2598190
FT                   /estimated_length=755
FT                   /gap_type="unknown"
FT   assembly_gap    2600119..2601717
FT                   /estimated_length=1599
FT                   /gap_type="unknown"
FT   assembly_gap    2607409..2607590
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    2620334..2621036
FT                   /estimated_length=703
FT                   /gap_type="unknown"
FT   assembly_gap    2623732..2624486
FT                   /estimated_length=755
FT                   /gap_type="unknown"
FT   assembly_gap    2642888..2642907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2645508..2645769
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    2647608..2647756
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    2650629..2650824
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    2664491..2665710
FT                   /estimated_length=1220
FT                   /gap_type="unknown"
FT   assembly_gap    2674212..2674449
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    2677978..2678494
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    2701782..2701801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2703424..2710856
FT                   /estimated_length=7433
FT                   /gap_type="unknown"
FT   assembly_gap    2715413..2715461
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    2723047..2723066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2728291..2729329
FT                   /estimated_length=1039
FT                   /gap_type="unknown"
FT   assembly_gap    2730490..2730613
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    2737019..2737038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2739813..2739850
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    2746933..2746981
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    2771042..2771909
FT                   /estimated_length=868
FT                   /gap_type="unknown"
FT   assembly_gap    2782061..2782367
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   gene            2803600..2804990
FT                   /pseudo
FT                   /locus_tag="mCG_1030997"
FT                   /note="gene_id=mCG1030997.1"
FT   mRNA            2803600..2804990
FT                   /pseudo
FT                   /locus_tag="mCG_1030997"
FT                   /note="gene_id=mCG1030997.1 transcript_id=mCT148701.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    2810828..2816746
FT                   /estimated_length=5919
FT                   /gap_type="unknown"
FT   assembly_gap    2821393..2821497
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    2827260..2827291
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    2843985..2844249
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    2849441..2849527
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    2853047..2853066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2856176..2856195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2857844..2857863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2864344..2865438
FT                   /estimated_length=1095
FT                   /gap_type="unknown"
FT   assembly_gap    2875715..2877180
FT                   /estimated_length=1466
FT                   /gap_type="unknown"
FT   assembly_gap    2877510..2877875
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    2880989..2881042
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    2881661..2881680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2886411..2891707
FT                   /estimated_length=5297
FT                   /gap_type="unknown"
FT   assembly_gap    2905832..2905851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2907221..2907240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2914585..2914604
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2918116..2925416
FT                   /estimated_length=7301
FT                   /gap_type="unknown"
FT   assembly_gap    2937461..2937480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2950614..2950956
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    2952527..2952546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2960856..2960875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2967542..2968154
FT                   /estimated_length=613
FT                   /gap_type="unknown"
FT   assembly_gap    2973946..2974206
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    2977545..2977564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2982967..2982986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2987561..2987782
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    2989724..2989743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2995974..2996068
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    3013384..3013740
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   assembly_gap    3019731..3019841
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    3035373..3035392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3048802..3048884
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            complement(3049386..3050677)
FT                   /pseudo
FT                   /locus_tag="mCG_1030996"
FT                   /note="gene_id=mCG1030996.1"
FT   mRNA            complement(3049386..3050677)
FT                   /pseudo
FT                   /locus_tag="mCG_1030996"
FT                   /note="gene_id=mCG1030996.1 transcript_id=mCT148700.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    3052843..3052862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3059645..3059664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3063313..3063332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3087564..3087617
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    3092017..3092555
FT                   /estimated_length=539
FT                   /gap_type="unknown"
FT   gene            3092644..3260838
FT                   /gene="Ar"
FT                   /locus_tag="mCG_56083"
FT                   /note="gene_id=mCG56083.2"
FT   mRNA            join(3092644..3094280,3193843..3193995,3228882..3228998,
FT                   3247462..3247749,3253202..3253346,3257100..3257230,
FT                   3258076..3258233,3258949..3260838)
FT                   /gene="Ar"
FT                   /locus_tag="mCG_56083"
FT                   /product="androgen receptor"
FT                   /note="gene_id=mCG56083.2 transcript_id=mCT56266.2 created
FT                   on 08-AUG-2002"
FT   CDS             join(3092771..3094280,3193843..3193995,3228882..3228998,
FT                   3247462..3247749,3253202..3253346,3257100..3257230,
FT                   3258076..3258233,3258949..3259104)
FT                   /codon_start=1
FT                   /gene="Ar"
FT                   /locus_tag="mCG_56083"
FT                   /product="androgen receptor"
FT                   /note="gene_id=mCG56083.2 transcript_id=mCT56266.2
FT                   protein_id=mCP26400.1"
FT                   /protein_id="EDL14205.1"
FT                   /translation="MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREAIQNPGPRHPEAA
FT                   NIAPPGACLQQRQETSPRRRRRQQHTEDGSPQAHIRGPTGYLALEEEQQPSQQQAASEG
FT                   HPESSCLPEPGAATAPGKGLPQQPPAPPDQDDSAAPSTLSLLGPTFPGLSSCSADIKDI
FT                   LNEAGTMQLLQQQQQQQQHQQQHQQHQQQQEVISEGSSARAREATGAPSSSKDSYLGGN
FT                   STISDSAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYASLLGGPPAVRPTPCAPLP
FT                   ECKGLPLDEGPGKSTEETAEYSSFKGGYAKGLEGESLGCSGSSEAGSSGTLEIPSSLSL
FT                   YKSGALDEAAAYQNRDYYNFPLALSGPPHPPPPTHPHARIKLENPLDYGSAWAAAAAQC
FT                   RYGDLGSLHGGSVAGPSTGSPPATTSSSWHTLFTAEEGQLYGPGGGGGSSSPSDAGPVA
FT                   PYGYTRPPQGLTSQESDYSASEVWYPGGVVNRVPYPSPNCVKSEMGLDSTRDHVLPIDY
FT                   YFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKN
FT                   CPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGENSNAGSPTEDPSQKMTVSHIEGYEC
FT                   QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNL
FT                   HVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRM
FT                   RHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKR
FT                   KNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPK
FT                   ILSGKVKPIYFHTQ"
FT   assembly_gap    3094281..3094438
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    3122181..3122932
FT                   /estimated_length=752
FT                   /gap_type="unknown"
FT   assembly_gap    3125420..3125439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3129948..3129967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3137767..3137786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3138726..3138963
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    3145658..3145874
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    3154222..3154656
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    3156990..3157529
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   assembly_gap    3162643..3162792
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    3166330..3171533
FT                   /estimated_length=5204
FT                   /gap_type="unknown"
FT   assembly_gap    3178642..3178661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3183952..3184173
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    3185893..3185912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3188046..3188065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3218966..3219060
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    3228617..3228636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3230551..3230871
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    3235437..3235505
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   gene            <3262319..>3265441
FT                   /locus_tag="mCG_1030994"
FT                   /note="gene_id=mCG1030994.1"
FT   mRNA            <3262319..>3265441
FT                   /locus_tag="mCG_1030994"
FT                   /product="mCG1030994"
FT                   /note="gene_id=mCG1030994.1 transcript_id=mCT148698.1
FT                   created on 19-AUG-2002"
FT   CDS             <3265112..>3265441
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030994"
FT                   /product="mCG1030994"
FT                   /note="gene_id=mCG1030994.1 transcript_id=mCT148698.1
FT                   protein_id=mCP69853.1"
FT                   /protein_id="EDL14204.1"
FT                   /translation="HAYTTLEINLAVGGNRQCNQECNVILIEIRIKSGCGESKERKHSI
FT                   FFSKETNLFCLKLLSLGLQFSQRLLVSTGQQDQPQALVFCSLFVILESFVALNTIKNGR
FT                   NLFVGI"
FT   assembly_gap    3291347..3291366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3299344..3299363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3305401..3307871
FT                   /estimated_length=2471
FT                   /gap_type="unknown"
FT   assembly_gap    3310069..3310088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3314505..3314524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3316135..3316154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3319982..3320989
FT                   /estimated_length=1008
FT                   /gap_type="unknown"
FT   assembly_gap    3326824..3326843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3328722..3329154
FT                   /estimated_length=433
FT                   /gap_type="unknown"
FT   assembly_gap    3337733..3338043
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    3342455..3342474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3348216..3348235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3366892..3369722
FT                   /estimated_length=2831
FT                   /gap_type="unknown"
FT   assembly_gap    3388859..3388892
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    3389685..3389957
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    3402348..3402462
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    3404562..3411805
FT                   /estimated_length=7244
FT                   /gap_type="unknown"
FT   assembly_gap    3426669..3427217
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   assembly_gap    3440007..3442402
FT                   /estimated_length=2396
FT                   /gap_type="unknown"
FT   assembly_gap    3445703..3445722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3456275..3456294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3473870..3473889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3483511..3483593
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    3486849..3486868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3497691..3829015)
FT                   /gene="Ophn1"
FT                   /locus_tag="mCG_140871"
FT                   /note="gene_id=mCG140871.1"
FT   mRNA            complement(join(3497691..3498581,3499762..3499803,
FT                   3503806..3503856,3504892..3505057,3518519..3518842,
FT                   3537744..3537891,3566628..3566787,3580743..3580848,
FT                   3581586..3581644,3584745..3584829,3635751..3635825,
FT                   3638040..3638102,3638609..3638642,3641618..3641696,
FT                   3644783..3644874,3649817..3649917,3652079..3652208,
FT                   3653845..3653949,3665107..3665217,3671467..3671568,
FT                   3702779..3702850,3720003..3720064,3742284..3742379,
FT                   3828076..3828248,3828375..>3828980))
FT                   /gene="Ophn1"
FT                   /locus_tag="mCG_140871"
FT                   /product="oligophrenin 1, transcript variant mCT190745"
FT                   /note="gene_id=mCG140871.1 transcript_id=mCT190745.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(3498428..3498581,3499762..3499803,
FT                   3503806..3503856,3504892..3505057,3518519..3518842,
FT                   3537744..3537891,3566628..3566787,3580743..3580848,
FT                   3581586..3581644,3584745..3584829,3635751..3635825,
FT                   3638040..3638102,3638609..3638642,3641618..3641696,
FT                   3644783..3644874,3649817..3649917,3652079..3652208,
FT                   3653845..3653949,3665107..3665217,3671467..3671568,
FT                   3720003..3720064,3742284..3742379,3828076..3828248,
FT                   3828375..3828493,3828692..3829015))
FT                   /gene="Ophn1"
FT                   /locus_tag="mCG_140871"
FT                   /product="oligophrenin 1, transcript variant mCT171924"
FT                   /note="gene_id=mCG140871.1 transcript_id=mCT171924.0
FT                   created on 14-AUG-2002"
FT   mRNA            complement(join(3498428..3498581,3499762..3499803,
FT                   3503806..3503856,3504892..3505057,3518519..3518842,
FT                   3537744..3537891,3566628..3566787,3580743..3580848,
FT                   3581586..3581644,3584745..3584829,3635751..3635825,
FT                   3638040..3638102,3638609..3638642,3641618..3641696,
FT                   3644783..3644874,3649817..3649917,3652079..3652208,
FT                   3653845..3653949,3665107..3665217,3671467..3671568,
FT                   3702779..3702850,3720003..3720064,3742284..3742379,
FT                   3828076..3828248,3828375..3828493,3828692..3829002))
FT                   /gene="Ophn1"
FT                   /locus_tag="mCG_140871"
FT                   /product="oligophrenin 1, transcript variant mCT171923"
FT                   /note="gene_id=mCG140871.1 transcript_id=mCT171923.0
FT                   created on 14-AUG-2002"
FT   CDS             complement(join(3499770..3499803,3503806..3503856,
FT                   3504892..3505057,3518519..3518842,3537744..3537891,
FT                   3566628..3566787,3580743..3580848,3581586..3581644,
FT                   3584745..3584829,3635751..3635825,3638040..3638102,
FT                   3638609..3638642,3641618..3641696,3644783..3644874,
FT                   3649817..3649917,3652079..3652208,3653845..3653949,
FT                   3665107..3665217,3671467..3671568,3702779..3702850,
FT                   3720003..3720064,3742284..3742379,3828076..3828248,
FT                   3828375..>3828493))
FT                   /codon_start=1
FT                   /gene="Ophn1"
FT                   /locus_tag="mCG_140871"
FT                   /product="oligophrenin 1, isoform CRA_b"
FT                   /note="gene_id=mCG140871.1 transcript_id=mCT190745.0
FT                   protein_id=mCP111717.0 isoform=CRA_b"
FT                   /protein_id="EDL14202.1"
FT                   /translation="AAPCRRQKTLVSTPGHPQPPPDYALQLHTSGRSQEFHWNSPSAIL
FT                   IMGHPPLEFSDCYLDSPDFRQRLKYYEEELERTNKFIKDVIKDGSALISAMRNYSSAVQ
FT                   KFSQTLQSFQFDFIGDTLTDDEINIAESFKEFAELLNEVENERMMMVQNASDLLIKPLE
FT                   TFRKEQIGFTKERKKKFEKDGERFYSLLDRHLHLSSKKKESQLLEADLQVDKERHNFFE
FT                   SSLDYVYQIQEVQESKKFNIVEPVLAFLHSLFISNSLTVELTQDFLPYKQQLQLSLQNT
FT                   RNHFSSTREEMEELKKRMKEAPQTCKLPGQPTIEGYLYTQEKWALGISWAKYYCRYEKE
FT                   TRMLTMIPMEQKPGAKQGPVDLTLKYCVRRKTESIDKRFCFDIETNERPGTITLQAPSE
FT                   ANRRLWMEAMDGKEPIYHTPITKQEEMELNEVGFKFVRKCINFIETKGIKTEGLYRTVG
FT                   SNIQVQKLLYAFFDPKCPGDVDFHNSDWDIKTITSSLKFYLRNLSEPVMTYKLHKELVS
FT                   AAKSDNLDYRLGAIHSLVYKLPEKNREMLELLIKHLVNVCEHSKENLMTPSNMGVIFGP
FT                   TLMRAQEDTVAAMMNIKFQNIVVEILIEHFGKIYLGPPEDSQVPPVPPPRVTARRHKPI
FT                   TISKRLLREKTVFYTSSLDENKDESHHQTPNGTITSNLDPPKLLQHLKPPMQKSGETDP
FT                   GRKSPSRPVSDCQSEPCLETDVGRLLFRLQDGGTKATPKASNGPVPGSGHTKTSSFHIR
FT                   RPAPRPMAHHKEGDTDGFSKVRPPGEKQTIIRPPVRPPDPPCRSITPQKPEPKPETGSG
FT                   NADEIPSSVVASRTRFFETASRKTGSSQGKLPGDES"
FT   CDS             complement(join(3499770..3499803,3503806..3503856,
FT                   3504892..3505057,3518519..3518842,3537744..3537891,
FT                   3566628..3566787,3580743..3580848,3581586..3581644,
FT                   3584745..3584829,3635751..3635825,3638040..3638102,
FT                   3638609..3638642,3641618..3641696,3644783..3644874,
FT                   3649817..3649917,3652079..3652208,3653845..3653949,
FT                   3665107..3665217,3671467..3671568,3720003..3720064,
FT                   3742284..3742379,3828076..3828229))
FT                   /codon_start=1
FT                   /gene="Ophn1"
FT                   /locus_tag="mCG_140871"
FT                   /product="oligophrenin 1, isoform CRA_a"
FT                   /note="gene_id=mCG140871.1 transcript_id=mCT171924.0
FT                   protein_id=mCP94842.0 isoform=CRA_a"
FT                   /protein_id="EDL14201.1"
FT                   /translation="MGHPPLEFSDCYLDSPDFRQRLKYYEEELERTNKFIKDVIKDGSA
FT                   LISAMRNYSSAVQKFSQTLQSFQFDFIGDTLTDDEINIAESFKEFAELLNEVENERMMM
FT                   ERKKKFEKDGERFYSLLDRHLHLSSKKKESQLLEADLQVDKERHNFFESSLDYVYQIQE
FT                   VQESKKFNIVEPVLAFLHSLFISNSLTVELTQDFLPYKQQLQLSLQNTRNHFSSTREEM
FT                   EELKKRMKEAPQTCKLPGQPTIEGYLYTQEKWALGISWAKYYCRYEKETRMLTMIPMEQ
FT                   KPGAKQGPVDLTLKYCVRRKTESIDKRFCFDIETNERPGTITLQAPSEANRRLWMEAMD
FT                   GKEPIYHTPITKQEEMELNEVGFKFVRKCINFIETKGIKTEGLYRTVGSNIQVQKLLYA
FT                   FFDPKCPGDVDFHNSDWDIKTITSSLKFYLRNLSEPVMTYKLHKELVSAAKSDNLDYRL
FT                   GAIHSLVYKLPEKNREMLELLIKHLVNVCEHSKENLMTPSNMGVIFGPTLMRAQEDTVA
FT                   AMMNIKFQNIVVEILIEHFGKIYLGPPEDSQVPPVPPPRVTARRHKPITISKRLLREKT
FT                   VFYTSSLDENKDESHHQTPNGTITSNLDPPKLLQHLKPPMQKSGETDPGRKSPSRPVSD
FT                   CQSEPCLETDVGRLLFRLQDGGTKATPKASNGPVPGSGHTKTSSFHIRRPAPRPMAHHK
FT                   EGDTDGFSKVRPPGEKQTIIRPPVRPPDPPCRSITPQKPEPKPETGSGNADEIPSSVVA
FT                   SRTRFFETASRKTGSSQGKLPGDES"
FT   CDS             complement(join(3499770..3499803,3503806..3503856,
FT                   3504892..3505057,3518519..3518842,3537744..3537891,
FT                   3566628..3566787,3580743..3580848,3581586..3581644,
FT                   3584745..3584829,3635751..3635825,3638040..3638102,
FT                   3638609..3638642,3641618..3641696,3644783..3644874,
FT                   3649817..3649917,3652079..3652208,3653845..3653949,
FT                   3665107..3665217,3671467..3671568,3702779..3702850,
FT                   3720003..3720064,3742284..3742379,3828076..3828229))
FT                   /codon_start=1
FT                   /gene="Ophn1"
FT                   /locus_tag="mCG_140871"
FT                   /product="oligophrenin 1, isoform CRA_c"
FT                   /note="gene_id=mCG140871.1 transcript_id=mCT171923.0
FT                   protein_id=mCP94843.0 isoform=CRA_c"
FT                   /protein_id="EDL14203.1"
FT                   /translation="MGHPPLEFSDCYLDSPDFRQRLKYYEEELERTNKFIKDVIKDGSA
FT                   LISAMRNYSSAVQKFSQTLQSFQFDFIGDTLTDDEINIAESFKEFAELLNEVENERMMM
FT                   VQNASDLLIKPLETFRKEQIGFTKERKKKFEKDGERFYSLLDRHLHLSSKKKESQLLEA
FT                   DLQVDKERHNFFESSLDYVYQIQEVQESKKFNIVEPVLAFLHSLFISNSLTVELTQDFL
FT                   PYKQQLQLSLQNTRNHFSSTREEMEELKKRMKEAPQTCKLPGQPTIEGYLYTQEKWALG
FT                   ISWAKYYCRYEKETRMLTMIPMEQKPGAKQGPVDLTLKYCVRRKTESIDKRFCFDIETN
FT                   ERPGTITLQAPSEANRRLWMEAMDGKEPIYHTPITKQEEMELNEVGFKFVRKCINFIET
FT                   KGIKTEGLYRTVGSNIQVQKLLYAFFDPKCPGDVDFHNSDWDIKTITSSLKFYLRNLSE
FT                   PVMTYKLHKELVSAAKSDNLDYRLGAIHSLVYKLPEKNREMLELLIKHLVNVCEHSKEN
FT                   LMTPSNMGVIFGPTLMRAQEDTVAAMMNIKFQNIVVEILIEHFGKIYLGPPEDSQVPPV
FT                   PPPRVTARRHKPITISKRLLREKTVFYTSSLDENKDESHHQTPNGTITSNLDPPKLLQH
FT                   LKPPMQKSGETDPGRKSPSRPVSDCQSEPCLETDVGRLLFRLQDGGTKATPKASNGPVP
FT                   GSGHTKTSSFHIRRPAPRPMAHHKEGDTDGFSKVRPPGEKQTIIRPPVRPPDPPCRSIT
FT                   PQKPEPKPETGSGNADEIPSSVVASRTRFFETASRKTGSSQGKLPGDES"
FT   assembly_gap    3516220..3516239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3524146..3526174
FT                   /estimated_length=2029
FT                   /gap_type="unknown"
FT   assembly_gap    3527830..3529373
FT                   /estimated_length=1544
FT                   /gap_type="unknown"
FT   assembly_gap    3534279..3534298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3546749..3547504
FT                   /estimated_length=756
FT                   /gap_type="unknown"
FT   assembly_gap    3549643..3551411
FT                   /estimated_length=1769
FT                   /gap_type="unknown"
FT   assembly_gap    3553176..3553203
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    3555637..3555656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3558528..3558547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3576582..3576601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3577872..3578075
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    3579280..3579487
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    3587040..3587188
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    3600344..3600363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3613268..3613287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3619606..3619625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3655976..3655995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3660093..3660267
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    3661474..3661580
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    3663631..3663650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3679269..3684707
FT                   /estimated_length=5439
FT                   /gap_type="unknown"
FT   assembly_gap    3692960..3693263
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    3705565..3705584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3709698..3709717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3733525..3733601
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    3741890..3741909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3746369..3746388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3755136..3755155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3760305..3760324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3762554..3763248
FT                   /estimated_length=695
FT                   /gap_type="unknown"
FT   assembly_gap    3765285..3765337
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    3776183..3776202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3790303..3790534
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    3808368..3808575
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    3829845..3829939
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    3839989..3840746
FT                   /estimated_length=758
FT                   /gap_type="unknown"
FT   assembly_gap    3842269..3842288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3850263..3850385
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    3861883..3862753
FT                   /estimated_length=871
FT                   /gap_type="unknown"
FT   assembly_gap    3863509..3863528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3871758..3871864
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   gene            <3875462..3885638
FT                   /gene="Yipf6"
FT                   /locus_tag="mCG_11175"
FT                   /note="gene_id=mCG11175.3"
FT   mRNA            join(<3875462..3875970,3877455..3877583,3877804..3877882,
FT                   3878469..3878511,3880456..3880584,3881156..3881313,
FT                   3882551..3884751)
FT                   /gene="Yipf6"
FT                   /locus_tag="mCG_11175"
FT                   /product="Yip1 domain family, member 6, transcript variant
FT                   mCT190747"
FT                   /note="gene_id=mCG11175.3 transcript_id=mCT190747.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3875734..3875970,3877455..3877583,3877804..3877882,
FT                   3878469..3878511,3880456..3880584,3881156..3881313,
FT                   3882551..3882666)
FT                   /codon_start=1
FT                   /gene="Yipf6"
FT                   /locus_tag="mCG_11175"
FT                   /product="Yip1 domain family, member 6, isoform CRA_b"
FT                   /note="gene_id=mCG11175.3 transcript_id=mCT190747.0
FT                   protein_id=mCP111701.0 isoform=CRA_b"
FT                   /protein_id="EDL14200.1"
FT                   /translation="ARARASEATGAPELGWAPQQPVSGAGGDAVLTRPRADQPRSPRLR
FT                   FRRDAWEGSSWRFIKMAEAEDSPGEQEAAASKPLFAGLSDVSISQDIPIEGEITIPSRA
FT                   RAQEHDSSTLNESIRRTIMRDLKAVGRKFMHVLYPRKSNALLRDWDLWGPLILCVTLAL
FT                   MLQKSSIDGKNDGGGPEFAEVFVIIWFGAVTITLNSKLLGGNISFFQSLCVLGYCILPL
FT                   NIAMLICRLLLLAGQGPINFMIRLFVVLLMFAWSVVASTAFLADSQPPNRKALAVYPVF
FT                   LFYFVISWMILTFTP"
FT   mRNA            join(3875845..3875970,3877455..3877583,3877804..3877882,
FT                   3878469..3878511,3880456..3880584,3881156..3881313,
FT                   3882551..3883003,3884918..3885009,3885397..3885638)
FT                   /gene="Yipf6"
FT                   /locus_tag="mCG_11175"
FT                   /product="Yip1 domain family, member 6, transcript variant
FT                   mCT11048"
FT                   /note="gene_id=mCG11175.3 transcript_id=mCT11048.2 created
FT                   on 14-AUG-2002"
FT   CDS             join(3875914..3875970,3877455..3877583,3877804..3877882,
FT                   3878469..3878511,3880456..3880584,3881156..3881313,
FT                   3882551..3882666)
FT                   /codon_start=1
FT                   /gene="Yipf6"
FT                   /locus_tag="mCG_11175"
FT                   /product="Yip1 domain family, member 6, isoform CRA_a"
FT                   /note="gene_id=mCG11175.3 transcript_id=mCT11048.2
FT                   protein_id=mCP22262.2 isoform=CRA_a"
FT                   /protein_id="EDL14199.1"
FT                   /translation="MAEAEDSPGEQEAAASKPLFAGLSDVSISQDIPIEGEITIPSRAR
FT                   AQEHDSSTLNESIRRTIMRDLKAVGRKFMHVLYPRKSNALLRDWDLWGPLILCVTLALM
FT                   LQKSSIDGKNDGGGPEFAEVFVIIWFGAVTITLNSKLLGGNISFFQSLCVLGYCILPLN
FT                   IAMLICRLLLLAGQGPINFMIRLFVVLLMFAWSVVASTAFLADSQPPNRKALAVYPVFL
FT                   FYFVISWMILTFTP"
FT   assembly_gap    3886185..3886487
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    3898847..3899042
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   gene            complement(3900065..3900503)
FT                   /locus_tag="mCG_1030936"
FT                   /note="gene_id=mCG1030936.1"
FT   mRNA            complement(3900065..3900503)
FT                   /locus_tag="mCG_1030936"
FT                   /product="mCG1030936"
FT                   /note="gene_id=mCG1030936.1 transcript_id=mCT148640.1
FT                   created on 20-AUG-2002"
FT   CDS             complement(3900082..3900486)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030936"
FT                   /product="mCG1030936"
FT                   /note="gene_id=mCG1030936.1 transcript_id=mCT148640.1
FT                   protein_id=mCP69777.1"
FT                   /protein_id="EDL14198.1"
FT                   /translation="MPLKGKSGSGEGGKGSAASGSDSSDKKSWGPKGGGNAVKVRHILC
FT                   EKHGKIMEAMEKLKSRMRFSEVATQYSEDKARQEGDLGWMTRGSMVGPFQEAAFAVPIV
FT                   GWISLCLQTHQLRQNLDIILLWLKGENKIT"
FT   assembly_gap    3901106..3901251
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    3904251..3904270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3913486..3914535
FT                   /estimated_length=1050
FT                   /gap_type="unknown"
FT   assembly_gap    3920701..3921198
FT                   /estimated_length=498
FT                   /gap_type="unknown"
FT   assembly_gap    3925887..3925906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3933383..3933402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3959300..3959335
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    3960724..3960945
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    3963887..3963906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3968074..3968282
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    3971483..3971502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3984750..3985454
FT                   /estimated_length=705
FT                   /gap_type="unknown"
FT   gene            3997794..4011466
FT                   /gene="Stard8"
FT                   /locus_tag="mCG_11174"
FT                   /note="gene_id=mCG11174.2"
FT   mRNA            join(3997794..3997865,4000431..4000512,4001460..4001523,
FT                   4002624..4004029,4004655..4004828,4005640..4005799,
FT                   4006254..4006452,4006813..4007023,4007288..4007402,
FT                   4008340..4008564,4009507..4009718,4009821..4009997,
FT                   4010150..4011466)
FT                   /gene="Stard8"
FT                   /locus_tag="mCG_11174"
FT                   /product="START domain containing 8"
FT                   /note="gene_id=mCG11174.2 transcript_id=mCT11047.2 created
FT                   on 14-AUG-2002"
FT   CDS             join(4001467..4001523,4002624..4004029,4004655..4004828,
FT                   4005640..4005799,4006254..4006452,4006813..4007023,
FT                   4007288..4007402,4008340..4008564,4009507..4009718,
FT                   4009821..4009997,4010150..4010267)
FT                   /codon_start=1
FT                   /gene="Stard8"
FT                   /locus_tag="mCG_11174"
FT                   /product="START domain containing 8"
FT                   /note="gene_id=mCG11174.2 transcript_id=mCT11047.2
FT                   protein_id=mCP22261.2"
FT                   /protein_id="EDL14197.1"
FT                   /translation="MTLNNCASMKLEVHFQCKQDDDSEEEEQCTISSHWAFEQESKCGS
FT                   LMGSSALLAPPSPSLLGTSSCESVLTELSAASLPAISASLSPESADQPLLGLVPSPSNQ
FT                   PFLSPPQGQEGSQDKVKKHYSRSFLKHLESLRRKEKGDSRQTEPEQCLATSEKATKASS
FT                   FRTCRGFLSAGFHRAKNRVTTSARVRDGETQKAWEAWPVATFRHPQPIRRRDYLVHVPG
FT                   DHKPGTFPRSLSIESLCPDEGRHLADWQSSRCWGYEGRRGSCGSTGSHASTYDNLPELY
FT                   PAEPIQAEAEAEAEEGEGSYAHLDDILEHVWGLQQRVELWSQTMYPDLRPGDKEEEEEE
FT                   EEEEEEATSSVEVATVEVEGQDEDLAQAESQAHRGFPTQVKEEVPLIVLDQAPNVVEPL
FT                   VQAEAEAPAQAQDLEQEANSTAEPISASSLSVEEGHSISDTAVSSSELDSSGNSMNEAD
FT                   AADAPAGLQASVPRERRDSGVGASLTRPCRKLRWHSFQNSHRPSLNSESLEINRQFAGQ
FT                   INLLHKGSLLRLTGFMEKYTVPHKQAWVWSMPKFMKRNKTPDYRGHHVFGVPPLIHVQR
FT                   TGQPLPQSIQQAMRYLRSQCLDQVGIFRKSGVKSRIQSLRQMNENSPDNVCYEGQSAYD
FT                   VADLLKQYFRDLPEPIFTSKLTTTFLQIYQLLPKEQWLAAAQAATLLLPDENREVLQTL
FT                   LYFLSDIASAEENQMTAGNLAVCLAPSIFHLNVSKKDSSSPRIKSKRSLVGRPGPRDLS
FT                   ENMAATQGLSHMISDCKKLFQVPQDMVVQLCGSYSAAELSPPGPALAELRQAQAAGVSL
FT                   SLYMEESVQELLRDAAERFKGWTNVPGPQHTELACRKMGTRFECWKASTEVAAPPAVVL
FT                   HRVLRERALWDEDLLRAQVLEALMPGVELYHYVTDSMAPHPCRDFVVLRMWRSDLPRGG
FT                   CLLVSQSLDPEQPVPESGVRALMLTSQYLMEPCGLGRSRLTHICRADLRGRSPDWYNKV
FT                   FGHLCAMEVAKIRDSFPTLQAAGPETKL"
FT   assembly_gap    4011470..4011489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4014162..4016141
FT                   /estimated_length=1980
FT                   /gap_type="unknown"
FT   gene            complement(4018304..4019581)
FT                   /pseudo
FT                   /locus_tag="mCG_115533"
FT                   /note="gene_id=mCG115533.1"
FT   mRNA            complement(4018304..4019581)
FT                   /pseudo
FT                   /locus_tag="mCG_115533"
FT                   /note="gene_id=mCG115533.1 transcript_id=mCT116639.1
FT                   created on 14-AUG-2002"
FT   assembly_gap    4021773..4021792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4034986..4035548
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    4037789..4038213
FT                   /estimated_length=425
FT                   /gap_type="unknown"
FT   assembly_gap    4039926..4040530
FT                   /estimated_length=605
FT                   /gap_type="unknown"
FT   assembly_gap    4062054..4062649
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    4066027..4066355
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    4070598..4070617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4073420..4086347
FT                   /gene="Efnb1"
FT                   /locus_tag="mCG_51675"
FT                   /note="gene_id=mCG51675.3"
FT   mRNA            join(4073420..4074273,4082599..4082876,4083785..4083877,
FT                   4084059..4084184,4084422..4084931,4085860..4086266)
FT                   /gene="Efnb1"
FT                   /locus_tag="mCG_51675"
FT                   /product="ephrin B1, transcript variant mCT173648"
FT                   /note="gene_id=mCG51675.3 transcript_id=mCT173648.0 created
FT                   on 24-SEP-2002"
FT   mRNA            join(4073429..4074273,4082599..4082876,4083785..4083877,
FT                   4084059..4084184,4084422..4086347)
FT                   /gene="Efnb1"
FT                   /locus_tag="mCG_51675"
FT                   /product="ephrin B1, transcript variant mCT51858"
FT                   /note="gene_id=mCG51675.3 transcript_id=mCT51858.2 created
FT                   on 24-SEP-2002"
FT   CDS             join(4074146..4074273,4082599..4082876,4083785..4083877,
FT                   4084059..4084184,4084422..4084834)
FT                   /codon_start=1
FT                   /gene="Efnb1"
FT                   /locus_tag="mCG_51675"
FT                   /product="ephrin B1, isoform CRA_a"
FT                   /note="gene_id=mCG51675.3 transcript_id=mCT51858.2
FT                   protein_id=mCP42252.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q544L9"
FT                   /db_xref="InterPro:IPR001799"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR019765"
FT                   /db_xref="InterPro:IPR031328"
FT                   /db_xref="InterPro:IPR034255"
FT                   /db_xref="MGI:MGI:102708"
FT                   /db_xref="UniProtKB/TrEMBL:Q544L9"
FT                   /protein_id="EDL14195.1"
FT                   /translation="MARPGQRWLSKWLVAMVVLTLCRLATPLAKNLEPVSWSSLNPKFL
FT                   SGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKP
FT                   HQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMK
FT                   VGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAG
FT                   GGGSGDSDSFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSL
FT                   STLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPAN
FT                   IYYKV"
FT   CDS             join(4074146..4074273,4082599..4082876,4083785..4083877,
FT                   4084059..4084184,4084422..4084834)
FT                   /codon_start=1
FT                   /gene="Efnb1"
FT                   /locus_tag="mCG_51675"
FT                   /product="ephrin B1, isoform CRA_a"
FT                   /note="gene_id=mCG51675.3 transcript_id=mCT173648.0
FT                   protein_id=mCP96567.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544L9"
FT                   /db_xref="InterPro:IPR001799"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR019765"
FT                   /db_xref="InterPro:IPR031328"
FT                   /db_xref="InterPro:IPR034255"
FT                   /db_xref="MGI:MGI:102708"
FT                   /db_xref="UniProtKB/TrEMBL:Q544L9"
FT                   /protein_id="EDL14196.1"
FT                   /translation="MARPGQRWLSKWLVAMVVLTLCRLATPLAKNLEPVSWSSLNPKFL
FT                   SGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKP
FT                   HQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMK
FT                   VGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAG
FT                   GGGSGDSDSFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSL
FT                   STLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPAN
FT                   IYYKV"
FT   assembly_gap    4074859..4074953
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    4080788..4080807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4089097..4089116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4097050..4097070
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    4113800..4113836
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    4121560..4121929
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    4131687..4133281
FT                   /estimated_length=1595
FT                   /gap_type="unknown"
FT   assembly_gap    4135941..4136685
FT                   /estimated_length=745
FT                   /gap_type="unknown"
FT   assembly_gap    4141557..4141896
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    4144359..4144378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4159557..4159576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4170031..4170050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4176133..4176313
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    4180985..4181581
FT                   /estimated_length=597
FT                   /gap_type="unknown"
FT   assembly_gap    4198723..4198742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4206706..4206739
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    4227861..4227880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4229043..4230789
FT                   /estimated_length=1747
FT                   /gap_type="unknown"
FT   assembly_gap    4232429..4232491
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    4234390..4234467
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    4247579..4247598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4251382..4251401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4258858..4258877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4267610..4267925
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    4272788..4272811
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    4274540..4274749
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    4277974..4277993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4287124..4287143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4289806..4289958
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    4292856..4292914
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    4300131..4300249
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    4308637..4308656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4311861..4311899
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    4322741..4323846
FT                   /estimated_length=1106
FT                   /gap_type="unknown"
FT   assembly_gap    4328203..4328439
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    4333578..4333728
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    4334942..4335914
FT                   /estimated_length=973
FT                   /gap_type="unknown"
FT   assembly_gap    4339002..4340108
FT                   /estimated_length=1107
FT                   /gap_type="unknown"
FT   gene            complement(4345872..>4355148)
FT                   /locus_tag="mCG_145215"
FT                   /note="gene_id=mCG145215.0"
FT   mRNA            complement(join(4345872..4346206,4346789..4346919,
FT                   4347935..4348069,4355055..>4355148))
FT                   /locus_tag="mCG_145215"
FT                   /product="mCG145215"
FT                   /note="gene_id=mCG145215.0 transcript_id=mCT184639.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(4346045..4346206,4346789..>4346839))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145215"
FT                   /product="mCG145215"
FT                   /note="gene_id=mCG145215.0 transcript_id=mCT184639.0
FT                   protein_id=mCP106214.0"
FT                   /protein_id="EDL14194.1"
FT                   /translation="KNCWQQCRLLSPRNSNSAATARSRRSSSRASGPAVPGHYLETSSA
FT                   HPVQNHAAVLQRHHQDYGASSNPVC"
FT   assembly_gap    4351110..4351129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4353165..4353835
FT                   /estimated_length=671
FT                   /gap_type="unknown"
FT   assembly_gap    4359508..4359741
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    4360542..4360736
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    4372207..4372278
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    4374267..4374665
FT                   /estimated_length=399
FT                   /gap_type="unknown"
FT   assembly_gap    4379468..4379609
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    4381948..4382186
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    4383526..4383862
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    4385579..4385650
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    4387176..4387904
FT                   /estimated_length=729
FT                   /gap_type="unknown"
FT   assembly_gap    4392906..4392925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4394022..4394473
FT                   /estimated_length=452
FT                   /gap_type="unknown"
FT   gene            complement(4401440..4406389)
FT                   /gene="Pja1"
FT                   /locus_tag="mCG_3733"
FT                   /note="gene_id=mCG3733.2"
FT   mRNA            complement(join(4401440..4403369,4403482..4404119,
FT                   4406285..4406389))
FT                   /gene="Pja1"
FT                   /locus_tag="mCG_3733"
FT                   /product="praja1, RING-H2 motif containing, transcript
FT                   variant mCT171577"
FT                   /note="gene_id=mCG3733.2 transcript_id=mCT171577.0 created
FT                   on 29-OCT-2002"
FT   mRNA            complement(join(4401541..4403290,4403928..4404119,
FT                   4406285..4406389))
FT                   /gene="Pja1"
FT                   /locus_tag="mCG_3733"
FT                   /product="praja1, RING-H2 motif containing, transcript
FT                   variant mCT2775"
FT                   /note="gene_id=mCG3733.2 transcript_id=mCT2775.2 created on
FT                   29-OCT-2002"
FT   mRNA            complement(join(4401817..4402204,4403555..4404119,
FT                   4406285..4406369))
FT                   /gene="Pja1"
FT                   /locus_tag="mCG_3733"
FT                   /product="praja1, RING-H2 motif containing, transcript
FT                   variant mCT175272"
FT                   /note="gene_id=mCG3733.2 transcript_id=mCT175272.0 created
FT                   on 29-OCT-2002"
FT   mRNA            complement(join(4401817..4402782,4403520..4404119,
FT                   4406285..4406369))
FT                   /gene="Pja1"
FT                   /locus_tag="mCG_3733"
FT                   /product="praja1, RING-H2 motif containing, transcript
FT                   variant mCT175273"
FT                   /note="gene_id=mCG3733.2 transcript_id=mCT175273.0 created
FT                   on 29-OCT-2002"
FT   CDS             complement(join(4402193..4402204,4403555..4404106))
FT                   /codon_start=1
FT                   /gene="Pja1"
FT                   /locus_tag="mCG_3733"
FT                   /product="praja1, RING-H2 motif containing, isoform CRA_c"
FT                   /note="gene_id=mCG3733.2 transcript_id=mCT175272.0
FT                   protein_id=mCP98191.0 isoform=CRA_c"
FT                   /protein_id="EDL14192.1"
FT                   /translation="MSHQERIASQRRTTAEVPMHRSTANQSKRSRSPFASTRRRWDDSE
FT                   SSGASLAVESEDYSRYPPREYRASGSRRGLAYGHIDTVVARDSEEEGAGPVDRLPVRGK
FT                   AGKFKDDPEKGARSSRFTSVNHDAKEECGKVESPPAARCSARRAELSKQNGSSASQISS
FT                   AEGRAAAKGNNSLERERQNLPPLF"
FT   CDS             complement(join(4402273..4403290,4403928..4404106))
FT                   /codon_start=1
FT                   /gene="Pja1"
FT                   /locus_tag="mCG_3733"
FT                   /product="praja1, RING-H2 motif containing, isoform CRA_d"
FT                   /note="gene_id=mCG3733.2 transcript_id=mCT2775.2
FT                   protein_id=mCP1341.2 isoform=CRA_d"
FT                   /db_xref="GOA:B1AXU4"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR031227"
FT                   /db_xref="MGI:MGI:1101765"
FT                   /db_xref="UniProtKB/TrEMBL:B1AXU4"
FT                   /protein_id="EDL14193.1"
FT                   /translation="MSHQERIASQRRTTAEVPMHRSTANQSKRSRSPFASTRRRWDDSE
FT                   SSGASLAVESEDYSSTSRWRDAADAEEAHAEGLARRGRGEAASSSEPRYAEDQDARSEQ
FT                   AKADKVPRRRRTMADPDFWAYTDDYYRYYEEDSDSDKEWMAALRRKYRSREQPQSSSGE
FT                   SWELLPGKEELERQQAGAGSLASAGSNGSGYPEEVQDPSLQEEEQASLEEGEIPWLRYN
FT                   ENESSSEGDNESTHELIQPGMFMLDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEA
FT                   ISYVDPQFLTYMALEERLAQAMETALAHLESLAVDVEVANPPASKESIDALPEILVTED
FT                   HGAVGQEMCCPICCSEYVKGEVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPPPL"
FT   CDS             complement(join(4402273..4403369,4403482..4404106))
FT                   /codon_start=1
FT                   /gene="Pja1"
FT                   /locus_tag="mCG_3733"
FT                   /product="praja1, RING-H2 motif containing, isoform CRA_b"
FT                   /note="gene_id=mCG3733.2 transcript_id=mCT171577.0
FT                   protein_id=mCP94496.0 isoform=CRA_b"
FT                   /protein_id="EDL14191.1"
FT                   /translation="MSHQERIASQRRTTAEVPMHRSTANQSKRSRSPFASTRRRWDDSE
FT                   SSGASLAVESEDYSRYPPREYRASGSRRGLAYGHIDTVVARDSEEEGAGPVDRLPVRGK
FT                   AGKFKDDPEKGARSSRFTSVNHDAKEECGKVESPPAARCSARRAELSKQNGSSASQISS
FT                   AEGRAAAKGNNSLERERQNLPARPSRAPCEYLWWWGKHPKECRGTVRNVATPNCMKPKV
FT                   FFDTDDDDDVPHSTSRWRDAADAEEAHAEGLARRGRGEAASSSEPRYAEDQDARSEQAK
FT                   ADKVPRRRRTMADPDFWAYTDDYYRYYEEDSDSDKEWMAALRRKYRSREQPQSSSGESW
FT                   ELLPGKEELERQQAGAGSLASAGSNGSGYPEEVQDPSLQEEEQASLEEGEIPWLRYNEN
FT                   ESSSEGDNESTHELIQPGMFMLDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEAIS
FT                   YVDPQFLTYMALEERLAQAMETALAHLESLAVDVEVANPPASKESIDALPEILVTEDHG
FT                   AVGQEMCCPICCSEYVKGEVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPPPL"
FT   CDS             complement(join(4402695..4402782,4403520..4404106))
FT                   /codon_start=1
FT                   /gene="Pja1"
FT                   /locus_tag="mCG_3733"
FT                   /product="praja1, RING-H2 motif containing, isoform CRA_a"
FT                   /note="gene_id=mCG3733.2 transcript_id=mCT175273.0
FT                   protein_id=mCP98192.0 isoform=CRA_a"
FT                   /protein_id="EDL14190.1"
FT                   /translation="MSHQERIASQRRTTAEVPMHRSTANQSKRSRSPFASTRRRWDDSE
FT                   SSGASLAVESEDYSRYPPREYRASGSRRGLAYGHIDTVVARDSEEEGAGPVDRLPVRGK
FT                   AGKFKDDPEKGARSSRFTSVNHDAKEECGKVESPPAARCSARRAELSKQNGSSASQISS
FT                   AEGRAAAKGNNSLERERQNLPARPSRAPCEYLWVIMSLPMSSYSLGCSCWMETTTWKMT
FT                   PA"
FT   assembly_gap    4403389..4403467
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    4405256..4405297
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    4406575..4406594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4409529..4409650
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    4412425..4412836
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    4414763..4414782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4428446..4428529
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    4435378..4435490
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    4442769..4442788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4446534..4446720
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    4451718..4451737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4456432..4456460
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    4466453..4466909
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   assembly_gap    4469276..4469304
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    4476581..4476600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4486402..4486504
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    4497655..4497674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4499531..4499677
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    4504154..4504501
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    4523737..4524365
FT                   /estimated_length=629
FT                   /gap_type="unknown"
FT   assembly_gap    4526567..4527490
FT                   /estimated_length=924
FT                   /gap_type="unknown"
FT   assembly_gap    4530402..4530533
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    4552993..4553122
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    4557980..4557999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4569347..4569482
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    4597608..4597655
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    4604073..4604117
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    4606330..4606349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4613795..4613873
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   gene            complement(4623003..4623319)
FT                   /pseudo
FT                   /locus_tag="mCG_50851"
FT                   /note="gene_id=mCG50851.2"
FT   mRNA            complement(4623003..4623319)
FT                   /pseudo
FT                   /locus_tag="mCG_50851"
FT                   /note="gene_id=mCG50851.2 transcript_id=mCT51034.2 created
FT                   on 19-AUG-2002"
FT   assembly_gap    4623667..4623766
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    4625698..4625717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4629502..4629521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4634942..4635122
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    4639770..4639789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4641562..4641581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4647646..4647977
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    4651230..4651249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4664192..4664211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4666986..4667005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4668207..4668226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4682597..4682753
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    4688979..4690981
FT                   /estimated_length=2003
FT                   /gap_type="unknown"
FT   assembly_gap    4696600..4696758
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   gene            complement(4697002..>4697851)
FT                   /locus_tag="mCG_1031093"
FT                   /note="gene_id=mCG1031093.1"
FT   mRNA            complement(4697002..>4697851)
FT                   /locus_tag="mCG_1031093"
FT                   /product="mCG1031093"
FT                   /note="gene_id=mCG1031093.1 transcript_id=mCT148797.1
FT                   created on 15-AUG-2002"
FT   CDS             complement(4697211..>4697561)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031093"
FT                   /product="mCG1031093"
FT                   /note="gene_id=mCG1031093.1 transcript_id=mCT148797.1
FT                   protein_id=mCP69826.1"
FT                   /protein_id="EDL14189.1"
FT                   /translation="LVPKPGTLTCPKAGNLSLPCACFLATLCLPLFYPRSFPNSWVTLC
FT                   LLPGNFMLTSILSEVLPKLLGSQVSLTMNLPCQQPLTAESSELGGGVGSPYGPPIVTPA
FT                   LDQQERRDHQSF"
FT   assembly_gap    4697852..4697871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4708144..4708738
FT                   /estimated_length=595
FT                   /gap_type="unknown"
FT   assembly_gap    4725144..4725179
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    4729573..4729712
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    4730786..4731740
FT                   /estimated_length=955
FT                   /gap_type="unknown"
FT   assembly_gap    4733390..4733975
FT                   /estimated_length=586
FT                   /gap_type="unknown"
FT   assembly_gap    4737439..4737458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4748089..4748108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4749743..4750964
FT                   /estimated_length=1222
FT                   /gap_type="unknown"
FT   gene            4751052..4777665
FT                   /locus_tag="mCG_48617"
FT                   /note="gene_id=mCG48617.2"
FT   mRNA            join(4751052..4751345,4775627..4775798,4776198..4777665)
FT                   /locus_tag="mCG_48617"
FT                   /product="mCG48617"
FT                   /note="gene_id=mCG48617.2 transcript_id=mCT48800.2 created
FT                   on 13-AUG-2002"
FT   CDS             join(4751061..4751345,4775627..4775798,4776198..4776583)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48617"
FT                   /product="mCG48617"
FT                   /note="gene_id=mCG48617.2 transcript_id=mCT48800.2
FT                   protein_id=mCP37247.2"
FT                   /protein_id="EDL14188.1"
FT                   /translation="MFRGAWMWPGKDAAALTICCCCCCWAPRQSDKPCADSERAQRWRL
FT                   SLASLLFFTVLLADHLWLCAGARPRARELSSAMRPPWGAGRERQPVPPRAAVYKAWLCS
FT                   EYFSVTQQECQNWVPCKQYCLEVQTRCPFILPDNEEMVYGGLPGFICTGLMDTSPKRPE
FT                   TKCCDVQWVSCESEKKKFKDSEPPKTHHQQFHHSYFHHYHHQYHHYHPRHEPPSRVSNK
FT                   PSLLPVSGGSRLSPSRIRLCVLVLILLHTVVSFSSSQSGGGLGLETLPALEEGLTQEE"
FT   assembly_gap    4751348..4751920
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    4754875..4754894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4756474..4756672
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    4762997..4763126
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    4764619..4764732
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    4768507..4768562
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    4788879..4788974
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    4799673..4800332
FT                   /estimated_length=660
FT                   /gap_type="unknown"
FT   assembly_gap    4809718..4809913
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    4825058..4825077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4829949..4829976
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    4834616..4834968
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    4836619..4838558
FT                   /estimated_length=1940
FT                   /gap_type="unknown"
FT   assembly_gap    4844616..4863573
FT                   /estimated_length=18958
FT                   /gap_type="unknown"
FT   assembly_gap    4865245..4865264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4866626..4866645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4868002..4868107
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    4874713..4875214
FT                   /estimated_length=502
FT                   /gap_type="unknown"
FT   assembly_gap    4882698..4882742
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    4902004..4902348
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    4903850..4903869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4908221..4908562
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   gene            4908563..5322480
FT                   /gene="Eda"
FT                   /locus_tag="mCG_116783"
FT                   /note="gene_id=mCG116783.1"
FT   mRNA            join(4908563..4909149,5231869..5231974,5303363..5303386,
FT                   5311187..5311366,5312967..5313001,5313875..5313926,
FT                   5316561..5316691,5318347..5319081,5319460..5322480)
FT                   /gene="Eda"
FT                   /locus_tag="mCG_116783"
FT                   /product="ectodysplasin-A, transcript variant mCT117908"
FT                   /note="gene_id=mCG116783.1 transcript_id=mCT117908.1
FT                   created on 18-JUL-2003"
FT   mRNA            join(4908563..4910706,4910738..4912488)
FT                   /gene="Eda"
FT                   /locus_tag="mCG_116783"
FT                   /product="ectodysplasin-A, transcript variant mCT148663"
FT                   /note="gene_id=mCG116783.1 transcript_id=mCT148663.2
FT                   created on 18-JUL-2003"
FT   CDS             join(4908754..4909149,5231869..5231974,5303363..5303386,
FT                   5311187..5311366,5312967..5313001,5313875..5313926,
FT                   5316561..5316691,5318347..5318598)
FT                   /codon_start=1
FT                   /gene="Eda"
FT                   /locus_tag="mCG_116783"
FT                   /product="ectodysplasin-A, isoform CRA_b"
FT                   /note="gene_id=mCG116783.1 transcript_id=mCT117908.1
FT                   protein_id=mCP69860.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UV69"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="MGI:MGI:1195272"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UV69"
FT                   /protein_id="EDL14186.1"
FT                   /translation="MGYPEVERREPLPAAAPRERGSQGCGCRGAPARAGEGNSCRLFLG
FT                   FFGLSLALHLLTLCCYLELRSELRRERGTESRLGGPGAPGTSGTLSSPGSLDPVGPITR
FT                   HLGQPSFQQQPLEPGEDPLPPDSQDRHQMALLNFFFPDEKAYSEEESRRVRRNKRSKSG
FT                   EGADGPVKNKKKGKKAGPPGPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGP
FT                   PGPQGPPGLQGPSGAADKTGTRENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNP
FT                   KVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGK
FT                   TNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS"
FT   CDS             4908754..4909416
FT                   /codon_start=1
FT                   /gene="Eda"
FT                   /locus_tag="mCG_116783"
FT                   /product="ectodysplasin-A, isoform CRA_a"
FT                   /note="gene_id=mCG116783.1 transcript_id=mCT148663.2
FT                   protein_id=mCP69795.1 isoform=CRA_a"
FT                   /protein_id="EDL14185.1"
FT                   /translation="MGYPEVERREPLPAAAPRERGSQGCGCRGAPARAGEGNSCRLFLG
FT                   FFGLSLALHLLTLCCYLELRSELRRERGTESRLGGPGAPGTSGTLSSPGSLDPVGPITR
FT                   HLGQPSFQQQPLEPGEDPLPPDSQDRHQVSHLGGAAALEAPSPARLGGGLGLRAQGTLP
FT                   LRAKFQGRSWEWAGVLGRGCPGQVVLGSCLGSSRPSPVPWSWKAQPARAAPGEVWAA"
FT   assembly_gap    4910707..4910737
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    4912614..4912633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4916831..4917758
FT                   /estimated_length=928
FT                   /gap_type="unknown"
FT   assembly_gap    4918657..4919336
FT                   /estimated_length=680
FT                   /gap_type="unknown"
FT   assembly_gap    4920441..4920585
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    4934176..4934195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4937587..4937606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4939318..4939494
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    4940818..4941171
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    4942404..4942476
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    4953485..4954498
FT                   /estimated_length=1014
FT                   /gap_type="unknown"
FT   assembly_gap    4962946..4963306
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    4968276..4968413
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    4983201..4983245
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    4989508..4989647
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    4992840..4992859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4993239..4995213)
FT                   /pseudo
FT                   /locus_tag="mCG_1031091"
FT                   /note="gene_id=mCG1031091.1"
FT   mRNA            complement(4993239..4995213)
FT                   /pseudo
FT                   /locus_tag="mCG_1031091"
FT                   /note="gene_id=mCG1031091.1 transcript_id=mCT148795.1
FT                   created on 15-AUG-2002"
FT   assembly_gap    5016911..5017124
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    5017752..5017826
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    5024627..5024785
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    5034176..5038136
FT                   /estimated_length=3961
FT                   /gap_type="unknown"
FT   assembly_gap    5049106..5049514
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    5052465..5052594
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    5056465..5056484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5069825..5069863
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    5076718..5076870
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    5097685..5100098
FT                   /estimated_length=2414
FT                   /gap_type="unknown"
FT   gene            5106927..5108563
FT                   /locus_tag="mCG_147486"
FT                   /note="gene_id=mCG147486.0"
FT   mRNA            5106927..5108563
FT                   /locus_tag="mCG_147486"
FT                   /product="mCG147486"
FT                   /note="gene_id=mCG147486.0 transcript_id=mCT187749.0
FT                   created on 13-JAN-2004"
FT   CDS             5106939..5107337
FT                   /codon_start=1
FT                   /locus_tag="mCG_147486"
FT                   /product="mCG147486"
FT                   /note="gene_id=mCG147486.0 transcript_id=mCT187749.0
FT                   protein_id=mCP108725.0"
FT                   /protein_id="EDL14187.1"
FT                   /translation="MNIVEHVSFLSVGPSSGYMLRRGIAGFSGSTMSNFLRNCQTDFQS
FT                   GCTSLQSHQQWRSVPLSPHPHQHLLSPEFLILAILTDVRWNPRFVLICISLMIKDVEHF
FT                   FSGASLPFGIPQLRILCLALYPICNRAI"
FT   assembly_gap    5109381..5109400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5119959..5120080
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    5134016..5134081
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    5149053..5149146
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    5154451..5154470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5216264..5216346
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    5220630..5224273
FT                   /estimated_length=3644
FT                   /gap_type="unknown"
FT   assembly_gap    5241353..5241372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5249924..5249943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5251060..5251079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5259343..5259362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5296780..5297178
FT                   /estimated_length=399
FT                   /gap_type="unknown"
FT   assembly_gap    5307624..5307985
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    5309673..5309806
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    5311392..5311517
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    5313799..5313818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5317069..5317088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5319082..5319459
FT                   /estimated_length=378
FT                   /gap_type="unknown"
FT   gene            complement(5323951..5364903)
FT                   /gene="Dgat2l4"
FT                   /locus_tag="mCG_140930"
FT                   /note="gene_id=mCG140930.1"
FT   mRNA            complement(join(5323951..5324661,5324861..5325060,
FT                   5325852..5326026,5326250..5326454,5326680..5326750,
FT                   5327307..5327417,5346049..5346197,5364544..5364903))
FT                   /gene="Dgat2l4"
FT                   /locus_tag="mCG_140930"
FT                   /product="diacylglycerol O-acyltransferase 2-like 4"
FT                   /note="gene_id=mCG140930.1 transcript_id=mCT172301.1
FT                   created on 11-JUN-2003"
FT   CDS             complement(join(5324507..5324661,5324861..5325060,
FT                   5325852..5326026,5326250..5326454,5326680..5326750,
FT                   5327307..5327349))
FT                   /codon_start=1
FT                   /gene="Dgat2l4"
FT                   /locus_tag="mCG_140930"
FT                   /product="diacylglycerol O-acyltransferase 2-like 4"
FT                   /note="gene_id=mCG140930.1 transcript_id=mCT172301.1
FT                   protein_id=mCP95220.1"
FT                   /protein_id="EDL14184.1"
FT                   /translation="MLTWLAFDWKTPERGGRRFTCVRKWRLWKHYSDYFPLKMVKTKDI
FT                   SPDRNYILVCHPHGLMAHSCFGHFATDTTGFSKTFPGITPYMLTLGAFFWVPFLRDYVM
FT                   STGSCSVSRSSMDFLLTQKGTGNMLVVVVGGLAECRYSTPGSTTLFLKKRQGFVRTALK
FT                   HGVSLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQKMVHIYPCAFYGRGLTKNSWGLL
FT                   PYSQPVTTVVGEPLPLPKIENPSEEIVAKYHTLYIDALRKLFDQHKTKFGISETQELVI
FT                   V"
FT   assembly_gap    5349687..5349706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5350750..5351460
FT                   /pseudo
FT                   /locus_tag="mCG_1030958"
FT                   /note="gene_id=mCG1030958.1"
FT   mRNA            join(5350750..5351302,5351335..5351460)
FT                   /pseudo
FT                   /locus_tag="mCG_1030958"
FT                   /note="gene_id=mCG1030958.1 transcript_id=mCT148662.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    5351304..5351323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5353893..5357342
FT                   /estimated_length=3450
FT                   /gap_type="unknown"
FT   assembly_gap    5363103..5363603
FT                   /estimated_length=501
FT                   /gap_type="unknown"
FT   assembly_gap    5365526..5365545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5374541..5374926
FT                   /estimated_length=386
FT                   /gap_type="unknown"
FT   assembly_gap    5380562..5380920
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    5382787..5383114
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    5386373..5386529
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    5387744..5387763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5393357..5393453
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    5401166..5401880
FT                   /estimated_length=715
FT                   /gap_type="unknown"
FT   assembly_gap    5413483..5413537
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   gene            5416570..5438443
FT                   /gene="Igbp1"
FT                   /locus_tag="mCG_12203"
FT                   /note="gene_id=mCG12203.1"
FT   mRNA            join(5416570..5416776,5417125..5417418,5425215..5425410,
FT                   5427358..5427437,5428107..5428219,5437873..5438443)
FT                   /gene="Igbp1"
FT                   /locus_tag="mCG_12203"
FT                   /product="immunoglobulin (CD79A) binding protein 1"
FT                   /note="gene_id=mCG12203.1 transcript_id=mCT12675.1 created
FT                   on 13-AUG-2002"
FT   CDS             join(5416586..5416776,5417125..5417418,5425215..5425410,
FT                   5427358..5427437,5428107..5428219,5437873..5438021)
FT                   /codon_start=1
FT                   /gene="Igbp1"
FT                   /locus_tag="mCG_12203"
FT                   /product="immunoglobulin (CD79A) binding protein 1"
FT                   /note="gene_id=mCG12203.1 transcript_id=mCT12675.1
FT                   protein_id=mCP16384.2"
FT                   /protein_id="EDL14183.1"
FT                   /translation="MAASEDELLLPRLPELFETSKKLLEDVEVATEPTGSRTIQDKVSK
FT                   GLELLEKAAGMLSQLDLFSRNEDLEEIASTDLKYLMVPALQGALTMKQVNPSKRLDHLQ
FT                   RAREHFVHFLTQCHCYHVAEFQLPQTKTNSAENNTASSSMAYPNLVAMASQRQAKIERY
FT                   KQKKEVEHRLSALKSAVESGQADDERVREYHLLHLRRWIAVSLEELESIDQEIKILKEK
FT                   DSPREETACHSSLPEKPPMKPFILTRNKAQAKVFGTGYPSLATMTVSDWYEQHQKYGVL
FT                   PDRGIAKPASADFQRAAQQQEDQEQKDEESEEKALHRMREWDDWKDTHPRGYGNRQNMG
FT                   "
FT   assembly_gap    5432970..5433212
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    5441726..5442823
FT                   /estimated_length=1098
FT                   /gap_type="unknown"
FT   gene            <5447344..5468099
FT                   /locus_tag="mCG_12200"
FT                   /note="gene_id=mCG12200.3"
FT   mRNA            join(<5447344..5447515,5462211..5462321,5462845..5462915,
FT                   5463276..5463480,5464822..5464996,5467002..5467213,
FT                   5467652..5468092)
FT                   /locus_tag="mCG_12200"
FT                   /product="mCG12200, transcript variant mCT12672"
FT                   /note="gene_id=mCG12200.3 transcript_id=mCT12672.2 created
FT                   on 06-SEP-2002"
FT   CDS             join(5447344..5447515,5462211..5462321,5462845..5462915,
FT                   5463276..5463480,5464822..5464996,5467002..5467213,
FT                   5467652..5467806)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12200"
FT                   /product="mCG12200, isoform CRA_a"
FT                   /note="gene_id=mCG12200.3 transcript_id=mCT12672.2
FT                   protein_id=mCP16381.2 isoform=CRA_a"
FT                   /protein_id="EDL14181.1"
FT                   /translation="MRRDKSKEPAIAPSERLGASGWAPCNSEAMAAFSCLDLQEGLRTL
FT                   SILQWIPVYVLLGTLSILGMPYLLLFTTLWPLSVLFLVWIAYDWNTHIQDGRRSAWVRN
FT                   WTLWKYFQSYFPVKLVKTHDLSPKHNYIILSHPHGILSYGAFINFATESTGFSRVFPSI
FT                   TPFLATLEGIFWIPFVRDYLMSLGICPVSKLSLTHKLTQKDSGNAVIIVPGGASESLLS
FT                   RPGVSMIYLKKRQGFVKLALKTGAYLVPSYSFGENETYNQETFAEGTWLRFFQKNIQKI
FT                   GKRILGINLCTIHGRGLTRGSWGFLPFNHPITTVVGEPLPVPKIPDPDKETVEKYLELY
FT                   ISALRKLFDQHKAEYGLSKTHELKIL"
FT   mRNA            join(<5447345..5447515,5462211..5462321,5462845..5466391,
FT                   5467002..5467213,5467652..5468099)
FT                   /locus_tag="mCG_12200"
FT                   /product="mCG12200, transcript variant mCT190756"
FT                   /note="gene_id=mCG12200.3 transcript_id=mCT190756.0 created
FT                   on 08-MAR-2004"
FT   assembly_gap    5448578..5448889
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   CDS             <5463273..5463752
FT                   /codon_start=1
FT                   /locus_tag="mCG_12200"
FT                   /product="mCG12200, isoform CRA_b"
FT                   /note="gene_id=mCG12200.3 transcript_id=mCT190756.0
FT                   protein_id=mCP111712.0 isoform=CRA_b"
FT                   /protein_id="EDL14182.1"
FT                   /translation="QLVKTHDLSPKHNYIILSHPHGILSYGAFINFATESTGFSRVFPS
FT                   ITPFLATLEGIFWIPFVRDYLMSLGKYNKSSCSEFELKMHTPIIPDSHSVIEGLTYFFL
FT                   KSSFSIRSMCPSIKFCATYEKQLVGQQGTSQAFMSFQDPLKRVIRRLSVEMESRY"
FT   assembly_gap    5472735..5472773
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   gene            <5494516..5500411
FT                   /locus_tag="mCG_116788"
FT                   /note="gene_id=mCG116788.1"
FT   mRNA            join(<5494516..5494617,5495674..5495781,5496035..5496105,
FT                   5496904..5497108,5497727..5497898,5499551..5499750,
FT                   5499939..5500411)
FT                   /locus_tag="mCG_116788"
FT                   /product="mCG116788"
FT                   /note="gene_id=mCG116788.1 transcript_id=mCT117914.1
FT                   created on 13-AUG-2002"
FT   CDS             join(<5494518..5494617,5495674..5495781,5496035..5496105,
FT                   5496904..5497108,5497727..5497898,5499551..5499750,
FT                   5499939..5500093)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116788"
FT                   /product="mCG116788"
FT                   /note="gene_id=mCG116788.1 transcript_id=mCT117914.1
FT                   protein_id=mCP69920.0"
FT                   /protein_id="EDL14180.1"
FT                   /translation="TSLRVLGIMSCSMKTEHLQSLSLLQWPLSYVAMFWIVQPLLICLL
FT                   FTPLWPLPTVYFVWLLLDWKTPDKGGRRSDWVRNWNVWNHIRDYFPITILKTKDLSPSE
FT                   NYIMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPIIRDYIMAKGL
FT                   CSVSQASIDYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLLLKKRKGFVRTALQHGAHL
FT                   VPTFTFGETEVYDQVLFHEDSRMFKFQSLFRRIFGFYCCVFYGQGFHQDCKGLLPYHKP
FT                   IITVVGEALPLPQVKNPSPEIVDKYHALYMDALYKLFEQHKVQYGCSNTQKLIFL"
FT   gene            complement(5515375..5516489)
FT                   /locus_tag="mCG_12206"
FT                   /note="gene_id=mCG12206.1"
FT   mRNA            complement(5515375..5516489)
FT                   /locus_tag="mCG_12206"
FT                   /product="mCG12206"
FT                   /note="gene_id=mCG12206.1 transcript_id=mCT12678.1 created
FT                   on 08-AUG-2002"
FT   CDS             complement(5515394..5516479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12206"
FT                   /product="mCG12206"
FT                   /note="gene_id=mCG12206.1 transcript_id=mCT12678.1
FT                   protein_id=mCP16379.0"
FT                   /db_xref="GOA:Q0VBT7"
FT                   /db_xref="InterPro:IPR000018"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1926594"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VBT7"
FT                   /protein_id="EDL14179.1"
FT                   /translation="MTSADSLLFTSLGPSPSSGDGDCKFNEEFKFILLPLSYAVVFVLG
FT                   LALNAPTLWLFLFRLRPWDATATYMFHLALSDTLYVLSLPTLVYYYAARNHWPFGTGFC
FT                   KFVRFLFYWNLYCSVLFLTCISVHRYMGICHPLRAIRWGRPRFAGLLCLGVWLVVAGCL
FT                   VPNLFFVTTNANGTTILCHDTTLPEEFDHYVYFSSTIMVLLFGFPFLITLVCYGLMARR
FT                   LYRPLPGAGQSSSRLRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLNAECRVLNIVN
FT                   VVYKVTRPLASANSCLDPVLYLFTGDKYRNQLQQLCRGSTPKRRTTASSLALVTLHEES
FT                   ISRWADIHQDSIFPAYEGDRL"
FT   gene            5527694..5540673
FT                   /gene="Arr3"
FT                   /locus_tag="mCG_12202"
FT                   /note="gene_id=mCG12202.1"
FT   mRNA            join(5527694..5527764,5528797..5528824,5529064..5529094,
FT                   5529245..5529305,5529503..5529547,5533927..5534126,
FT                   5534231..5534290,5534969..5535036,5535677..5535812,
FT                   5536008..5536092,5536310..5536382,5536781..5536918,
FT                   5539080..5539163,5539410..5539433,5539605..5539669,
FT                   5540509..5540673)
FT                   /gene="Arr3"
FT                   /locus_tag="mCG_12202"
FT                   /product="arrestin 3, retinal, transcript variant mCT12674"
FT                   /note="gene_id=mCG12202.1 transcript_id=mCT12674.2 created
FT                   on 08-AUG-2002"
FT   mRNA            join(5527694..5527764,5528797..5528824,5529064..5529094,
FT                   5529245..5529305,5529503..5529547,5533927..5534126,
FT                   5534231..5534290,5534969..5535036,5535677..5535812,
FT                   5536008..5536092,5536310..5536382,5536781..5536918,
FT                   5539605..5539669,5540509..5540673)
FT                   /gene="Arr3"
FT                   /locus_tag="mCG_12202"
FT                   /product="arrestin 3, retinal, transcript variant
FT                   mCT171570"
FT                   /note="gene_id=mCG12202.1 transcript_id=mCT171570.0 created
FT                   on 08-AUG-2002"
FT   CDS             join(5527740..5527764,5528797..5528824,5529064..5529094,
FT                   5529245..5529305,5529503..5529547,5533927..5534126,
FT                   5534231..5534290,5534969..5535036,5535677..5535812,
FT                   5536008..5536092,5536310..5536382,5536781..5536918,
FT                   5539080..5539163,5539410..5539433,5539605..5539669,
FT                   5540509..5540567)
FT                   /codon_start=1
FT                   /gene="Arr3"
FT                   /locus_tag="mCG_12202"
FT                   /product="arrestin 3, retinal, isoform CRA_a"
FT                   /note="gene_id=mCG12202.1 transcript_id=mCT12674.2
FT                   protein_id=mCP16383.2 isoform=CRA_a"
FT                   /protein_id="EDL14177.1"
FT                   /translation="MRASSLPSGKIQLASMSTVFKKTSSNGKFSIYLGKRDFVDDVDTV
FT                   EPIDGVVLVDPEYLEGRKLFVRLTCAFRYGRDDLDVIGLTFRKDLYVQTKQVAPAEPTS
FT                   IQGPLTALQERLLHKLGVNAYPFTLQMVANLPCSVTLQPGPEDSGKPCGVDFEVKSFCA
FT                   ENLEEKIPKSDSVQLVVRKVQFSALEPGPGPSAQTIRSFFLSSQPLQLQAWMDREVHYH
FT                   GEAISVHVSINNYTNKVIRRIKIAVVQTTDVVLYSLDKYTKTVFVQEFTETVAANSSFS
FT                   QTFAVTPLLAANCQKQGLALDGKLKHEDTNLASSTILRPGMNKELLGILVSYKVRVNLV
FT                   VSYGGILGGLPASDVGVELPVILIHPKPSPGERAGSEDIVIEEFMQHNSQTQS"
FT   CDS             join(5527740..5527764,5528797..5528824,5529064..5529094,
FT                   5529245..5529305,5529503..5529547,5533927..5534126,
FT                   5534231..5534290,5534969..5535036,5535677..5535812,
FT                   5536008..5536092,5536310..5536382,5536781..5536918,
FT                   5539605..5539669,5540509..5540567)
FT                   /codon_start=1
FT                   /gene="Arr3"
FT                   /locus_tag="mCG_12202"
FT                   /product="arrestin 3, retinal, isoform CRA_b"
FT                   /note="gene_id=mCG12202.1 transcript_id=mCT171570.0
FT                   protein_id=mCP94489.0 isoform=CRA_b"
FT                   /protein_id="EDL14178.1"
FT                   /translation="MRASSLPSGKIQLASMSTVFKKTSSNGKFSIYLGKRDFVDDVDTV
FT                   EPIDGVVLVDPEYLEGRKLFVRLTCAFRYGRDDLDVIGLTFRKDLYVQTKQVAPAEPTS
FT                   IQGPLTALQERLLHKLGVNAYPFTLQMVANLPCSVTLQPGPEDSGKPCGVDFEVKSFCA
FT                   ENLEEKIPKSDSVQLVVRKVQFSALEPGPGPSAQTIRSFFLSSQPLQLQAWMDREVHYH
FT                   GEAISVHVSINNYTNKVIRRIKIAVVQTTDVVLYSLDKYTKTVFVQEFTETVAANSSFS
FT                   QTFAVTPLLAANCQKQGLALDGKLKHEDTNLASSTIDVGVELPVILIHPKPSPGERAGS
FT                   EDIVIEEFMQHNSQTQS"
FT   gene            complement(5545062..>5548122)
FT                   /gene="Pdzd11"
FT                   /locus_tag="mCG_12205"
FT                   /note="gene_id=mCG12205.3"
FT   mRNA            complement(join(5545062..5545609,5545765..5545825,
FT                   5546044..5546142,5546715..5546771,5546977..5547060,
FT                   5547470..5547569,5547998..5548121))
FT                   /gene="Pdzd11"
FT                   /locus_tag="mCG_12205"
FT                   /product="PDZ domain containing 11, transcript variant
FT                   mCT12677"
FT                   /note="gene_id=mCG12205.3 transcript_id=mCT12677.2 created
FT                   on 13-AUG-2002"
FT   mRNA            complement(join(5545066..5545609,5545765..5545825,
FT                   5546044..5546142,5546715..5546771,5546977..5547060,
FT                   5547470..>5548122))
FT                   /gene="Pdzd11"
FT                   /locus_tag="mCG_12205"
FT                   /product="PDZ domain containing 11, transcript variant
FT                   mCT190762"
FT                   /note="gene_id=mCG12205.3 transcript_id=mCT190762.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(5545067..5545609,5545765..5545825,
FT                   5546044..5546142,5546715..5546771,5546977..5547060,
FT                   5547470..5547569,5548068..5548121))
FT                   /gene="Pdzd11"
FT                   /locus_tag="mCG_12205"
FT                   /product="PDZ domain containing 11, transcript variant
FT                   mCT171927"
FT                   /note="gene_id=mCG12205.3 transcript_id=mCT171927.0 created
FT                   on 13-AUG-2002"
FT   mRNA            complement(join(5545068..5545609,5545765..5545825,
FT                   5546715..5546771,5546977..5547060,5547470..5547569,
FT                   5547998..5548121))
FT                   /gene="Pdzd11"
FT                   /locus_tag="mCG_12205"
FT                   /product="PDZ domain containing 11, transcript variant
FT                   mCT171926"
FT                   /note="gene_id=mCG12205.3 transcript_id=mCT171926.0 created
FT                   on 13-AUG-2002"
FT   CDS             complement(join(5545575..5545609,5545765..5545825,
FT                   5546044..5546142,5546715..5546771,5546977..5547060,
FT                   5547470..>5547583))
FT                   /codon_start=1
FT                   /gene="Pdzd11"
FT                   /locus_tag="mCG_12205"
FT                   /product="PDZ domain containing 11, isoform CRA_c"
FT                   /note="gene_id=mCG12205.3 transcript_id=mCT190762.0
FT                   protein_id=mCP111714.0 isoform=CRA_c"
FT                   /protein_id="EDL14176.1"
FT                   /translation="FVLFRALPEMDNRIPYDDYPVVFLPAYENPPAWIPPHERVYHPDY
FT                   NNELTQFLPRIVTLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVL
FT                   AVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH"
FT   CDS             complement(join(5545575..5545609,5545765..5545825,
FT                   5546715..5546771,5546977..5547060,5547470..5547556))
FT                   /codon_start=1
FT                   /gene="Pdzd11"
FT                   /locus_tag="mCG_12205"
FT                   /product="PDZ domain containing 11, isoform CRA_b"
FT                   /note="gene_id=mCG12205.3 transcript_id=mCT171926.0
FT                   protein_id=mCP94846.0 isoform=CRA_b"
FT                   /protein_id="EDL14174.1"
FT                   /translation="MDNRIPYDDYPVVFLPAYENPPAWIPPHERVYHPDYNNELTQFLP
FT                   RIVTLKKPPGAQLGFNIRGGKASQLGIFISKAVEILKTAREISMRVRFFPYNYHRQKER
FT                   TVH"
FT   CDS             complement(join(5545575..5545609,5545765..5545825,
FT                   5546044..5546142,5546715..5546771,5546977..5547060,
FT                   5547470..5547556))
FT                   /codon_start=1
FT                   /gene="Pdzd11"
FT                   /locus_tag="mCG_12205"
FT                   /product="PDZ domain containing 11, isoform CRA_a"
FT                   /note="gene_id=mCG12205.3 transcript_id=mCT12677.2
FT                   protein_id=mCP16386.2 isoform=CRA_a"
FT                   /protein_id="EDL14173.1"
FT                   /translation="MDNRIPYDDYPVVFLPAYENPPAWIPPHERVYHPDYNNELTQFLP
FT                   RIVTLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQD
FT                   IEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH"
FT   CDS             complement(join(5545575..5545609,5545765..5545825,
FT                   5546044..5546142,5546715..5546771,5546977..5547060,
FT                   5547470..5547556))
FT                   /codon_start=1
FT                   /gene="Pdzd11"
FT                   /locus_tag="mCG_12205"
FT                   /product="PDZ domain containing 11, isoform CRA_a"
FT                   /note="gene_id=mCG12205.3 transcript_id=mCT171927.0
FT                   protein_id=mCP94845.0 isoform=CRA_a"
FT                   /protein_id="EDL14175.1"
FT                   /translation="MDNRIPYDDYPVVFLPAYENPPAWIPPHERVYHPDYNNELTQFLP
FT                   RIVTLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQD
FT                   IEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH"
FT   gene            5547919..5648171
FT                   /gene="Kif4"
FT                   /locus_tag="mCG_12204"
FT                   /note="gene_id=mCG12204.2"
FT   mRNA            join(5547919..5548770,5548886..5549000,5556021..5556211,
FT                   5557866..5557958,5560466..5560632,5560859..5560953,
FT                   5585633..5585749,5586570..5586745,5590790..5590851,
FT                   5598168..5598300,5600727..5600785,5600890..5600995,
FT                   5609941..5609997,5611397..5611582,5615759..5615862,
FT                   5616886..5617030,5618319..5618429,5624933..5625016,
FT                   5625681..5625794,5632683..5632838,5632953..5633053,
FT                   5634769..5634898,5636472..5636642,5637162..5637269,
FT                   5638222..5638299,5638828..5638926,5639385..5639561,
FT                   5645542..5645658,5647028..5647150,5647359..5648171)
FT                   /gene="Kif4"
FT                   /locus_tag="mCG_12204"
FT                   /product="kinesin family member 4, transcript variant
FT                   mCT12676"
FT                   /note="gene_id=mCG12204.2 transcript_id=mCT12676.2 created
FT                   on 29-NOV-2004"
FT   CDS             join(5548651..5548770,5548886..5549000,5556021..5556211,
FT                   5557866..5557958,5560466..5560632,5560859..5560953,
FT                   5585633..5585749,5586570..5586745,5590790..5590851,
FT                   5598168..5598300,5600727..5600785,5600890..5600995,
FT                   5609941..5609997,5611397..5611582,5615759..5615862,
FT                   5616886..5617030,5618319..5618429,5624933..5625016,
FT                   5625681..5625794,5632683..5632838,5632953..5633053,
FT                   5634769..5634898,5636472..5636642,5637162..5637269,
FT                   5638222..5638299,5638828..5638926,5639385..5639561,
FT                   5645542..5645658,5647028..5647150,5647359..5647559)
FT                   /codon_start=1
FT                   /gene="Kif4"
FT                   /locus_tag="mCG_12204"
FT                   /product="kinesin family member 4, isoform CRA_a"
FT                   /note="gene_id=mCG12204.2 transcript_id=mCT12676.2
FT                   protein_id=mCP16385.3 isoform=CRA_a"
FT                   /db_xref="GOA:P33174"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033467"
FT                   /db_xref="MGI:MGI:108389"
FT                   /db_xref="PDB:3ZFC"
FT                   /db_xref="PDB:3ZFD"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33174"
FT                   /protein_id="EDL14171.1"
FT                   /translation="MKEEVKGIPVRVALRCRPLVSKEIKEGCQTCLSFVPGEPQVVVGN
FT                   DKSFTYDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTA
FT                   EQEHDSAIGVIPRVIQLLFKEINKKSDFEFTLKVSYLEIYNEEILDLLCSSREKATQIN
FT                   IREDPKEGIKIVGLTEKTVLVASDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISIE
FT                   QRKKNDKNSSFRSKLHLVDLAGSERQKKTKAEGDRLREGININRGLLCLGNVISALGDD
FT                   KKGNFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNK
FT                   PIINIDPQAAELNHLKQQVQQLQILLLQAHGGTLPGDINVEPSENLQSLMEKNQSLVEE
FT                   NEKLSRGLSEAAGQTAQMLERIILTEQANEKMNAKLEELRRHAACKVDLQKLVETLEDQ
FT                   ELKENIEIICNLQQVIAQLSDEAAACMTATIDTAGEADTQVQSSPDTSRSSDVFSTQHA
FT                   LRQAQMSKELIELNKALALKEALAKKMTQNDNQLQPIQFQYQDNIKNLESEVLSLQREK
FT                   EELVLELQTAKKDANQAKLSERRRKRLQELEGQIADLKKKLQEQSKLLKLKESTEHTVS
FT                   KLNQEIRMMKNQRVQLMRQMKEDAEKFRQWKQQKDKEVIQLKERDRKRQYELLKLERNF
FT                   QKQSNVLRRKTEEAAAANKRLKDALQKQKEVAEKRKETQSRGMESTAARMKNWLGNEIE
FT                   VMVSTEEAKRHLNGLLEERKILAQDVAQLKEKRESGENPPLKLRRRTFSYDEIHGQDSG
FT                   AEDSIAKQIESLETELELRSAQIADLQQKLLDAESEDRPKQRWESIATILEAKCAIKYL
FT                   VGELVSSKILVSKLESSLNQSKASCIDVQKMLFEEQNHFAKIETELKEELVKVEQQHQE
FT                   KVLYLLSQLQQSQMTEKQLEESVSEKEQQLLSTLKCQEEELRKMQEVCEQNQQLLQENS
FT                   AIKQKLTLLQVASKQKPHLTRNIFQSPDSSFEYIPPKPKPCRIKEKCLEQSFAVEGLQY
FT                   YSEPSVAEQDNEDSDDHADEEWIPTKLVKVSKKSIQGCSCKGWCGNKQCGCRKQKSDCN
FT                   VSCSCDPTKCRNRHQNQDNSDAIELNQDSENSFKLEDPTEVTSGLSFFHPICATPSSKI
FT                   LKEMCDADQVQLKQPVFVSSSDHPELKSIASESQENKAIGKKKKRALASNTSFFSGCSP
FT                   IQEESH"
FT   assembly_gap    5579463..5584429
FT                   /estimated_length=4967
FT                   /gap_type="unknown"
FT   assembly_gap    5587400..5587488
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   mRNA            join(5588267..5588368,5590790..5590851,5598168..5598300,
FT                   5600727..5600785,5600890..5600995,5609941..5609997,
FT                   5611397..5611582,5615759..5615862,5616886..5617030,
FT                   5618319..5618429,5624933..5625016,5625681..5625794,
FT                   5632683..5632838,5632953..5633053,5634769..5634898,
FT                   5636472..5636642,5637162..5637269,5638222..5638299,
FT                   5638828..5638926,5639385..5639561,5645542..5645658,
FT                   5647028..5647150,5647359..5648171)
FT                   /gene="Kif4"
FT                   /locus_tag="mCG_12204"
FT                   /product="kinesin family member 4, transcript variant
FT                   mCT190761"
FT                   /note="gene_id=mCG12204.2 transcript_id=mCT190761.1 created
FT                   on 29-NOV-2004"
FT   CDS             join(5598199..5598300,5600727..5600785,5600890..5600995,
FT                   5609941..5609997,5611397..5611582,5615759..5615862,
FT                   5616886..5617030,5618319..5618429,5624933..5625016,
FT                   5625681..5625794,5632683..5632838,5632953..5633053,
FT                   5634769..5634898,5636472..5636642,5637162..5637269,
FT                   5638222..5638299,5638828..5638926,5639385..5639561,
FT                   5645542..5645658,5647028..5647150,5647359..5647559)
FT                   /codon_start=1
FT                   /gene="Kif4"
FT                   /locus_tag="mCG_12204"
FT                   /product="kinesin family member 4, isoform CRA_b"
FT                   /note="gene_id=mCG12204.2 transcript_id=mCT190761.1
FT                   protein_id=mCP111713.1 isoform=CRA_b"
FT                   /protein_id="EDL14172.1"
FT                   /translation="MEKNQSLVEENEKLSRGLSEAAGQTAQMLERIILTEQANEKMNAK
FT                   LEELRRHAACKVDLQKLVETLEDQELKENIEIICNLQQVIAQLSDEAAACMTATIDTAG
FT                   EADTQVQSSPDTSRSSDVFSTQHALRQAQMSKELIELNKALALKEALAKKMTQNDNQLQ
FT                   PIQFQYQDNIKNLESEVLSLQREKEELVLELQTAKKDANQAKLSERRRKRLQELEGQIA
FT                   DLKKKLQEQSKLLKLKESTEHTVSKLNQEIRMMKNQRVQLMRQMKEDAEKFRQWKQQKD
FT                   KEVIQLKERDRKRQYELLKLERNFQKQSNVLRRKTEEAAAANKRLKDALQKQKEVAEKR
FT                   KETQSRGMESTAARMKNWLGNEIEVMVSTEEAKRHLNGLLEERKILAQDVAQLKEKRES
FT                   GENPPLKLRRRTFSYDEIHGQDSGAEDSIAKQIESLETELELRSAQIADLQQKLLDAES
FT                   EDRPKQRWESIATILEAKCAIKYLVGELVSSKILVSKLESSLNQSKASCIDVQKMLFEE
FT                   QNHFAKIETELKEELVKVEQQHQEKVLYLLSQLQQSQMTEKQLEESVSEKEQQLLSTLK
FT                   CQEEELRKMQEVCEQNQQLLQENSAIKQKLTLLQVASKQKPHLTRNIFQSPDSSFEYIP
FT                   PKPKPCRIKEKCLEQSFAVEGLQYYSEPSVAEQDNEDSDDHADEEWIPTKLVKVSKKSI
FT                   QGCSCKGWCGNKQCGCRKQKSDCNVSCSCDPTKCRNRHQNQDNSDAIELNQDSENSFKL
FT                   EDPTEVTSGLSFFHPICATPSSKILKEMCDADQVQLKQPVFVSSSDHPELKSIASESQE
FT                   NKAIGKKKKRALASNTSFFSGCSPIQEESH"
FT   gene            5650901..5659799
FT                   /gene="Gdpd2"
FT                   /locus_tag="mCG_4965"
FT                   /note="gene_id=mCG4965.1"
FT   mRNA            join(5650901..5651095,5652972..5653085,5653296..5653399,
FT                   5653694..5653787,5653972..5654031,5654274..5654372,
FT                   5654546..5654639,5654799..5654947,5655070..5655152,
FT                   5655264..5655414,5657151..5657372,5657589..5657737,
FT                   5658365..5658512,5658651..5658733,5659017..5659042,
FT                   5659130..5659799)
FT                   /gene="Gdpd2"
FT                   /locus_tag="mCG_4965"
FT                   /product="glycerophosphodiester phosphodiesterase domain
FT                   containing 2, transcript variant mCT4273"
FT                   /note="gene_id=mCG4965.1 transcript_id=mCT4273.1 created on
FT                   08-AUG-2002"
FT   mRNA            join(<5651084..5651271,5652972..5653085,5653296..5653399,
FT                   5653694..5653787,5653972..5654031,5654274..5654372,
FT                   5654546..5654639,5654799..5654947,5655070..5655152,
FT                   5655264..5655414,5657151..5657372,5657589..5657737,
FT                   5658365..5658512,5658651..5658733,5659017..5659042,
FT                   5659130..5659794)
FT                   /gene="Gdpd2"
FT                   /locus_tag="mCG_4965"
FT                   /product="glycerophosphodiester phosphodiesterase domain
FT                   containing 2, transcript variant mCT190759"
FT                   /note="gene_id=mCG4965.1 transcript_id=mCT190759.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5651086..5651271,5652972..5653085,5653296..5653399,
FT                   5653694..5653787,5653972..5654031,5654274..5654372,
FT                   5654546..5654639,5654799..5654947,5655070..5655152,
FT                   5655264..5655414,5657151..5657372,5657589..5657737,
FT                   5658365..5658512,5658651..5658733,5659017..5659042,
FT                   5659130..5659182)
FT                   /codon_start=1
FT                   /gene="Gdpd2"
FT                   /locus_tag="mCG_4965"
FT                   /product="glycerophosphodiester phosphodiesterase domain
FT                   containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG4965.1 transcript_id=mCT190759.0
FT                   protein_id=mCP111719.0 isoform=CRA_a"
FT                   /protein_id="EDL14169.1"
FT                   /translation="CVKGVRAREGWGLPLGSREAKSGSSREGWSPGGYAAPLSDSLLRV
FT                   FQTGQILIPSSRQLLREALTMADSPGCCSIWARCLHCLYSCHWRKYPKQKMQTSKCDCI
FT                   WFGLLFLTFLLSLGWLYIGLILLNDLHNFNEFLFRHWGHWMDWSLIVLLVVSLLVTYAS
FT                   LLLLLGLLLQLCGQPLHLHSLHKVLLLLIVLLVAAGLVGLDIQWRQEWHSLRLSLQATA
FT                   PFLHIGAVAGITLLAWPVADTFYRIHPRGPKVLLLLLFFGVTLVIYLMPLLFISSPCIM
FT                   KLRDLPPKPGLVGHRGAPMLAPENTLMSLRKTAECGAAVFETDVMVSSDGVPFLMHDER
FT                   LSRTTNVASVFPERISAHSSDFSWAELQRLNAGTWFLERQPFWGAKKLSGSDRKEAENQ
FT                   TIPALEELLKEAAALNLSIMFDLRRPPRNHTYYDTFVNQTLEAVLSANVSQAMVLWLPD
FT                   EDRANVQQRAPRMRQIYGHQGGNWTERPQFLNLPYQDLPALDIKALHQDNISVNLFVVN
FT                   KPWLFSLLWCAGVDSVTTNACQLLQQMQNPLWLLPPQKYLMIWVITDCASILLLLSIFL
FT                   LRGGCAKRNRTGLETAVLLTKINNFASE"
FT   CDS             join(5652981..5653085,5653296..5653399,5653694..5653787,
FT                   5653972..5654031,5654274..5654372,5654546..5654639,
FT                   5654799..5654947,5655070..5655152,5655264..5655414,
FT                   5657151..5657372,5657589..5657737,5658365..5658512,
FT                   5658651..5658733,5659017..5659042,5659130..5659182)
FT                   /codon_start=1
FT                   /gene="Gdpd2"
FT                   /locus_tag="mCG_4965"
FT                   /product="glycerophosphodiester phosphodiesterase domain
FT                   containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG4965.1 transcript_id=mCT4273.1
FT                   protein_id=mCP18500.2 isoform=CRA_b"
FT                   /protein_id="EDL14170.1"
FT                   /translation="MADSPGCCSIWARCLHCLYSCHWRKYPKQKMQTSKCDCIWFGLLF
FT                   LTFLLSLGWLYIGLILLNDLHNFNEFLFRHWGHWMDWSLIVLLVVSLLVTYASLLLLLG
FT                   LLLQLCGQPLHLHSLHKVLLLLIVLLVAAGLVGLDIQWRQEWHSLRLSLQATAPFLHIG
FT                   AVAGITLLAWPVADTFYRIHPRGPKVLLLLLFFGVTLVIYLMPLLFISSPCIMKLRDLP
FT                   PKPGLVGHRGAPMLAPENTLMSLRKTAECGAAVFETDVMVSSDGVPFLMHDERLSRTTN
FT                   VASVFPERISAHSSDFSWAELQRLNAGTWFLERQPFWGAKKLSGSDRKEAENQTIPALE
FT                   ELLKEAAALNLSIMFDLRRPPRNHTYYDTFVNQTLEAVLSANVSQAMVLWLPDEDRANV
FT                   QQRAPRMRQIYGHQGGNWTERPQFLNLPYQDLPALDIKALHQDNISVNLFVVNKPWLFS
FT                   LLWCAGVDSVTTNACQLLQQMQNPLWLLPPQKYLMIWVITDCASILLLLSIFLLRGGCA
FT                   KRNRTGLETAVLLTKINNFASE"
FT   assembly_gap    5661594..5661613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5662479..5670808
FT                   /locus_tag="mCG_145218"
FT                   /note="gene_id=mCG145218.0"
FT   mRNA            join(<5662479..5662586,5669615..5669685,5669980..5670808)
FT                   /locus_tag="mCG_145218"
FT                   /product="mCG145218"
FT                   /note="gene_id=mCG145218.0 transcript_id=mCT184642.0
FT                   created on 05-JUN-2003"
FT   CDS             <5670353..5670532
FT                   /codon_start=1
FT                   /locus_tag="mCG_145218"
FT                   /product="mCG145218"
FT                   /note="gene_id=mCG145218.0 transcript_id=mCT184642.0
FT                   protein_id=mCP106218.0"
FT                   /protein_id="EDL14168.1"
FT                   /translation="DRVSKNRWLSYADQAGLKLTGSTCLCLLSAKIKGLHHHARLLTFF
FT                   FNYVTQNRNLSRNF"
FT   assembly_gap    5680362..5680381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5683046..5733709
FT                   /gene="Dlgh3"
FT                   /locus_tag="mCG_116782"
FT                   /note="gene_id=mCG116782.1"
FT   mRNA            join(<5683046..5683751,5686630..5686683,5686938..5686988,
FT                   5687380..5687504,5687690..5687859,5688146..5688282,
FT                   5688588..5688732,5689393..5689552,5691123..5691279,
FT                   5691695..5691797,5712004..5712118,5721819..5721995,
FT                   5722487..5722562,5725170..5725215,5728034..5728084,
FT                   5728638..5728739,5729505..5729677,5730094..5730203,
FT                   5730509..5730600,5731520..5733709)
FT                   /gene="Dlgh3"
FT                   /locus_tag="mCG_116782"
FT                   /product="discs, large homolog 3 (Drosophila), transcript
FT                   variant mCT190755"
FT                   /note="gene_id=mCG116782.1 transcript_id=mCT190755.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<5683050..5683751,5686630..5686683,5686938..5686988,
FT                   5687380..5687504,5687690..5687859,5688146..5688282,
FT                   5688588..5688732,5689393..5689552,5691123..5691279,
FT                   5691695..5691797,5712004..5712118,5721819..5721995,
FT                   5722487..5722562,5725170..5725215,5728034..5728084,
FT                   5728638..5728739,5729505..5729677,5730094..5730203,
FT                   5730509..5730600,5731520..5731626)
FT                   /codon_start=1
FT                   /gene="Dlgh3"
FT                   /locus_tag="mCG_116782"
FT                   /product="discs, large homolog 3 (Drosophila), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG116782.1 transcript_id=mCT190755.0
FT                   protein_id=mCP111706.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR016313"
FT                   /db_xref="InterPro:IPR019583"
FT                   /db_xref="InterPro:IPR019590"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1888986"
FT                   /db_xref="UniProtKB/TrEMBL:Q80TH1"
FT                   /protein_id="EDL14167.1"
FT                   /translation="LHSDPSWGPEQKRFSPHLAFAWAPDSSLPLGLGPEATTGDTEPPV
FT                   LEGEPWVRGSVGAEAPGRPPGPRPRSARAPPRVPPPSWSEQCECAREPGGGGGGVETGV
FT                   GWGVRAAGGSAMHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGNGAS
FT                   SGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPGWWP
FT                   ECTCTNRDWYEQASPAPLLVNPEALEPSLSVNGSDGMFKYEEIVLERGNSGLGFSIAGG
FT                   IDNPHVPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAG
FT                   PVVRLVVRRRQPPPETIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAA
FT                   QKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSIHLNDMYAPPD
FT                   YASTFTALADNHISHNSSLGYLGAVESKVTYPAPPQVPPTRYSPIPRHMLAEEDFTREP
FT                   RKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNA
FT                   THEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKR
FT                   SLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVI
FT                   PSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGQEDAILSYEPVT
FT                   RQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSR
FT                   EQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYP
FT                   IAIFIKPKSIEALMEMNRRQTYEQANKIFDKAMKLEQEFGEYFTAIVQGDSLEEIYNKI
FT                   KQIIEDQSGHYIWVPSPEKL"
FT   mRNA            join(5683069..5683751,5686630..5686683,5686938..5686988,
FT                   5687380..5687504,5687690..5687859,5688146..5688282,
FT                   5688588..5688732,5689393..5689552,5691123..5691279,
FT                   5691695..5691797,5712004..5712118,5721819..5721995,
FT                   5722487..5722562,5725170..5725215,5726810..5726851,
FT                   5728034..5728084,5728638..5728739,5729505..5729677,
FT                   5730094..5730203,5730509..5730600,5731520..5733709)
FT                   /gene="Dlgh3"
FT                   /locus_tag="mCG_116782"
FT                   /product="discs, large homolog 3 (Drosophila), transcript
FT                   variant mCT117907"
FT                   /note="gene_id=mCG116782.1 transcript_id=mCT117907.0
FT                   created on 08-AUG-2002"
FT   mRNA            join(<5683318..5683751,5686938..5686988,5687380..5687504,
FT                   5687690..5687859,5688146..5688732,5689393..5689552,
FT                   5691123..5691279,5691695..5691797,5712004..5712118,
FT                   5721819..5721995,5722487..5722562,5723360..5723459,
FT                   5726810..5726851,5728034..5728084,5728638..5728739,
FT                   5729505..5729677,5730094..5730203,5730509..5730600,
FT                   5731520..5733709)
FT                   /gene="Dlgh3"
FT                   /locus_tag="mCG_116782"
FT                   /product="discs, large homolog 3 (Drosophila), transcript
FT                   variant mCT190754"
FT                   /note="gene_id=mCG116782.1 transcript_id=mCT190754.0
FT                   created on 08-MAR-2004"
FT   CDS             join(5683395..5683751,5686630..5686683,5686938..5686988,
FT                   5687380..5687504,5687690..5687859,5688146..5688282,
FT                   5688588..5688732,5689393..5689552,5691123..5691279,
FT                   5691695..5691797,5712004..5712118,5721819..5721995,
FT                   5722487..5722562,5725170..5725215,5726810..5726851,
FT                   5728034..5728084,5728638..5728739,5729505..5729677,
FT                   5730094..5730203,5730509..5730600,5731520..5731626)
FT                   /codon_start=1
FT                   /gene="Dlgh3"
FT                   /locus_tag="mCG_116782"
FT                   /product="discs, large homolog 3 (Drosophila), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG116782.1 transcript_id=mCT117907.0
FT                   protein_id=mCP69847.1 isoform=CRA_a"
FT                   /protein_id="EDL14165.1"
FT                   /translation="MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGN
FT                   GASSGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPG
FT                   WWPECTCTNRDWYEQASPAPLLVNPEALEPSLSVNGSDGMFKYEEIVLERGNSGLGFSI
FT                   AGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALK
FT                   EAGPVVRLVVRRRQPPPETIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEG
FT                   GAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSIHLNDMYA
FT                   PPDYASTFTALADNHISHNSSLGYLGAVESKVTYPAPPQVPPTRYSPIPRHMLAEEDFT
FT                   REPRKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNL
FT                   RNATHEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTS
FT                   EKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQI
FT                   GVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGVTSNTSDSE
FT                   SSSKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRP
FT                   RRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCIL
FT                   DVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIFDKAMKLEQEFGEY
FT                   FTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL"
FT   CDS             join(<5688588..5688732,5689393..5689552,5691123..5691279,
FT                   5691695..5691797,5712004..5712118,5721819..5721995,
FT                   5722487..5722562,5723360..5723459,5726810..5726851,
FT                   5728034..5728084,5728638..5728739,5729505..5729677,
FT                   5730094..5730203,5730509..5730600,5731520..5731626)
FT                   /codon_start=1
FT                   /gene="Dlgh3"
FT                   /locus_tag="mCG_116782"
FT                   /product="discs, large homolog 3 (Drosophila), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG116782.1 transcript_id=mCT190754.0
FT                   protein_id=mCP111705.0 isoform=CRA_b"
FT                   /protein_id="EDL14166.1"
FT                   /translation="VNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSIHLNDMYAPPD
FT                   YASTFTALADNHISHNSSLGYLGAVESKVTYPAPPQVPPTRYSPIPRHMLAEEDFTREP
FT                   RKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNA
FT                   THEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKR
FT                   SLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVI
FT                   PSKKRVEKKERARLKTVKFHARTGMIESNRSIKTKRKKSFRLSRKFPFYKSKENMAQEN
FT                   SIQEQGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISE
FT                   FPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSI
FT                   QSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANK
FT                   IFDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL"
FT   assembly_gap    5716393..5716481
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   gene            complement(5753969..5974871)
FT                   /gene="Tex11"
FT                   /locus_tag="mCG_140798"
FT                   /note="gene_id=mCG140798.0"
FT   mRNA            complement(join(5753969..5754380,5755021..5755185,
FT                   5764368..5764488,5765588..5765696,5767147..5767296,
FT                   5791872..5791911,5795278..5795409,5797557..5797615,
FT                   5798224..5798310,5799663..5799703,5819481..5819537,
FT                   5821842..5821927,5832309..5832434,5862472..5862609,
FT                   5867350..5867435,5870485..5870636,5887905..5887983,
FT                   5890991..5891072,5893435..5893530,5901509..5901563,
FT                   5923497..5923582,5931328..5931408,5947695..5947814,
FT                   5947898..5947978,5954244..5954323,5958676..5958760,
FT                   5965694..5965815,5974590..5974651,5974747..5974871))
FT                   /gene="Tex11"
FT                   /locus_tag="mCG_140798"
FT                   /product="testis expressed gene 11, transcript variant
FT                   mCT171579"
FT                   /note="gene_id=mCG140798.0 transcript_id=mCT171579.0
FT                   created on 15-FEB-2003"
FT   mRNA            complement(join(5753983..5754380,5755021..5755185,
FT                   5764368..5764488,5765588..5765696,5767147..5767296,
FT                   5791839..5791911,5795278..5795394,5797545..5797615,
FT                   5798224..5798310,5799663..5799703,5819481..5819537,
FT                   5821842..5821927,5832309..5832433,5849181..5849283,
FT                   5862472..5862609,5867350..5867435,5870485..5870636,
FT                   5887905..5887983,5890991..5891072,5893435..5893530,
FT                   5901509..5901563,5923497..5923582,5931328..5931408,
FT                   5947695..5947814,5947898..5947978,5954244..5954323,
FT                   5958676..5958760,5965694..5965815,5974590..5974651,
FT                   5974747..5974871))
FT                   /gene="Tex11"
FT                   /locus_tag="mCG_140798"
FT                   /product="testis expressed gene 11, transcript variant
FT                   mCT180227"
FT                   /note="gene_id=mCG140798.0 transcript_id=mCT180227.0
FT                   created on 15-FEB-2003"
FT   CDS             complement(join(5754225..5754380,5755021..5755185,
FT                   5764368..5764488,5765588..5765696,5767147..5767296,
FT                   5791872..5791911,5795278..5795409,5797557..5797615,
FT                   5798224..5798310,5799663..5799703,5819481..5819537,
FT                   5821842..5821927,5832309..5832434,5862472..5862609,
FT                   5867350..5867435,5870485..5870636,5887905..5887983,
FT                   5890991..5891072,5893435..5893530,5901509..5901563,
FT                   5923497..5923582,5931328..5931408,5947695..5947814,
FT                   5947898..5947978,5954244..5954323,5958676..5958760,
FT                   5965694..5965815,5974590..5974629))
FT                   /codon_start=1
FT                   /gene="Tex11"
FT                   /locus_tag="mCG_140798"
FT                   /product="testis expressed gene 11, isoform CRA_a"
FT                   /note="gene_id=mCG140798.0 transcript_id=mCT171579.0
FT                   protein_id=mCP94498.0 isoform=CRA_a"
FT                   /protein_id="EDL14162.1"
FT                   /translation="MDRITDFYFLDFRESVKTLIITGNSWRLQEMIDRFFTNISNFNRE
FT                   SLTEIQNIQIEEIAVNLWNWAVTKRVELSVRKNQAAKLCYIACKLVYMHGISVSSEEAI
FT                   QRQILMNIKTGKEWLYTGNAQIADEFFQAAMTDLERLYVRLMQSCYTEANVCVYKMIVE
FT                   KGIFHVLSYQAESAVAQGDFKKASMCVLRCKDMLMRLPNMTKYLHVLCYNLGIEASKRN
FT                   KYKESSFWLGQSYEIGKMDRRSVEPQMLAKTLRLLATIYLNCGGEAYYTKAFIAILIAN
FT                   KEHLHPAGLFLKMRILMKGNSCNEELLEAAKEILYLAMPLEFYLSIIQFLIDNKRESVG
FT                   FRFLRIISDNFKSPEDRKRILLFYIDTLLQKDQDMIAEEKIKDVLKGYQTRSRLSRDLV
FT                   NWLHNILWGKASRSVKVQKYADALHWYSYSLKLYEYDKADLDLIKLKRNMVSCYLSLKQ
FT                   LDKALQVVSALKKSLMDGESEDRGLIEAGVSTLTILSLSIDFALENGQQFVAERALEYL
FT                   CQLSKDPKEVLGGLKCLMRIILPQAFHMPESEYKKKEMGRLWNYLNTALLKFSEYFNEA
FT                   PSTLDYMVNDANWFRKIAWNLAVQSEKDLEAMKNFFMVISYQLSLFCPLDQGLLIAQKT
FT                   CLLVAAAVDLDRGRKAPTICEQNMLLRTALEQIKKWDFSGDDCGVLLLLYEFEVKTKTN
FT                   DPSLSRFVDSVWKMPDLECRTLETMALLAMDKPAYYPTIAHKAMKKLLLMYRKQEPVDV
FT                   LKYSVCMHNLIKLLVADEVWNISLYPLKEVQSHFKNTLSIIRQNEGYPEEEIVWLMIKS
FT                   WNIGILMSSKNKYISAERWAAMALDFLGHLSTLKTSYEAKVNLLYANLMEILDKKTDLR
FT                   STEMTEQLRALIVPPEDQGSVSSTNVAAQNHL"
FT   CDS             complement(join(5754225..5754380,5755021..5755185,
FT                   5764368..5764488,5765588..5765696,5767147..5767296,
FT                   5791839..5791911,5795278..5795394,5797545..5797615,
FT                   5798224..5798310,5799663..5799703,5819481..5819537,
FT                   5821842..5821927,5832309..5832433,5849181..5849283,
FT                   5862472..5862609,5867350..5867435,5870485..5870636,
FT                   5887905..5887983,5890991..5891072,5893435..5893530,
FT                   5901509..5901563,5923497..5923582,5931328..5931408,
FT                   5947695..5947814,5947898..5947978,5954244..5954323,
FT                   5958676..5958760,5965694..5965815,5974590..5974629))
FT                   /codon_start=1
FT                   /gene="Tex11"
FT                   /locus_tag="mCG_140798"
FT                   /product="testis expressed gene 11, isoform CRA_b"
FT                   /note="gene_id=mCG140798.0 transcript_id=mCT180227.0
FT                   protein_id=mCP103149.0 isoform=CRA_b"
FT                   /protein_id="EDL14163.1"
FT                   /translation="MDRITDFYFLDFRESVKTLIITGNSWRLQEMIDRFFTNISNFNRE
FT                   SLTEIQNIQIEEIAVNLWNWAVTKRVELSVRKNQAAKLCYIACKLVYMHGISVSSEEAI
FT                   QRQILMNIKTGKEWLYTGNAQIADEFFQAAMTDLERLYVRLMQSCYTEANVCVYKMIVE
FT                   KGIFHVLSYQAESAVAQGDFKKASMCVLRCKDMLMRLPNMTKYLHVLCYNLGIEASKRN
FT                   KYKESSFWLGQSYEIGKMDRRSVEPQMLAKTLRLLATIYLNCGGEAYYTKAFIAILIAN
FT                   KEHLHPAGLFLKMRILMKGNSCNEELLEAAKEILYLAMPLEFYLSIIQFLIDNKRESVG
FT                   FRFLRIISDNFKSPEDRKRILLFYIDTLLQKDQDMIAEEKIKDVLKGYQTRSRLSRDLV
FT                   NWLHNILWGKASRSVKVQKYADALHWYSYSLKLYEYDKADLDLIKLKRNMVSCYLSLKQ
FT                   LDKAKEAIAEVEQKDPTHVFTRYYIFKIAIMEGDAFRALQVVSALKKSLMDGESEDRGL
FT                   IEAGVSTLTILSLSIDFALENGQQFVAERALEYLCQLSKDPKEVLGGLKCLMRIILPQA
FT                   FHMPESEYKKKEMGRLWNYLNTALLKFSEYFNEAPSTLDYMVNDANWFRKIAWNLAVQS
FT                   EKDLEAMKNFFMVSYKLSLFCPLDQGLLIAQKTCLLVAAAVDLDRGRKAPTICEQNMLL
FT                   RTALEQIKKCKKVWNLLKKTGDFSGDDCGVLLLLYEFEVKTKTNDPSLSRFVDSVWKMP
FT                   DLECRTLETMALLAMDKPAYYPTIAHKAMKKLLLMYRKQEPVDVLKYSVCMHNLIKLLV
FT                   ADEVWNISLYPLKEVQSHFKNTLSIIRQNEGYPEEEIVWLMIKSWNIGILMSSKNKYIS
FT                   AERWAAMALDFLGHLSTLKTSYEAKVNLLYANLMEILDKKTDLRSTEMTEQLRALIVPP
FT                   EDQGSVSSTNVAAQNHL"
FT   assembly_gap    5774484..5779591
FT                   /estimated_length=5108
FT                   /gap_type="unknown"
FT   assembly_gap    5790495..5790514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(5793185..5793528,5795278..5795394,
FT                   5797545..5797615,5798224..5798310,5799663..5799703,
FT                   5819481..5819537,5821842..5821927,5832309..5832433,
FT                   5849181..5849283,5862472..5862609,5867350..5867435,
FT                   5870485..5870636,5887905..5887983,5890991..5891072,
FT                   5893435..5893530,5901509..5901563,5923497..5923582,
FT                   5931328..5931408,5947695..5947814,5947898..5947978,
FT                   5954244..5954323,5958676..5958760,5965694..5965815,
FT                   5974590..5974651,5974747..>5974865))
FT                   /gene="Tex11"
FT                   /locus_tag="mCG_140798"
FT                   /product="testis expressed gene 11, transcript variant
FT                   mCT190753"
FT                   /note="gene_id=mCG140798.0 transcript_id=mCT190753.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(5793475..5793528,5795278..5795394,
FT                   5797545..5797615,5798224..5798310,5799663..5799703,
FT                   5819481..5819537,5821842..5821927,5832309..5832433,
FT                   5849181..5849283,5862472..5862609,5867350..5867435,
FT                   5870485..5870636,5887905..5887983,5890991..5891072,
FT                   5893435..5893530,5901509..5901563,5923497..5923582,
FT                   5931328..5931408,5947695..5947814,5947898..5947978,
FT                   5954244..5954323,5958676..5958760,5965694..5965815,
FT                   5974590..>5974632))
FT                   /codon_start=1
FT                   /gene="Tex11"
FT                   /locus_tag="mCG_140798"
FT                   /product="testis expressed gene 11, isoform CRA_c"
FT                   /note="gene_id=mCG140798.0 transcript_id=mCT190753.0
FT                   protein_id=mCP111716.0 isoform=CRA_c"
FT                   /protein_id="EDL14164.1"
FT                   /translation="KMDRITDFYFLDFRESVKTLIITGNSWRLQEMIDRFFTNISNFNR
FT                   ESLTEIQNIQIEEIAVNLWNWAVTKRVELSVRKNQAAKLCYIACKLVYMHGISVSSEEA
FT                   IQRQILMNIKTGKEWLYTGNAQIADEFFQAAMTDLERLYVRLMQSCYTEANVCVYKMIV
FT                   EKGIFHVLSYQAESAVAQGDFKKASMCVLRCKDMLMRLPNMTKYLHVLCYNLGIEASKR
FT                   NKYKESSFWLGQSYEIGKMDRRSVEPQMLAKTLRLLATIYLNCGGEAYYTKAFIAILIA
FT                   NKEHLHPAGLFLKMRILMKGNSCNEELLEAAKEILYLAMPLEFYLSIIQFLIDNKRESV
FT                   GFRFLRIISDNFKSPEDRKRILLFYIDTLLQKDQDMIAEEKIKDVLKGYQTRSRLSRDL
FT                   VNWLHNILWGKASRSVKVQKYADALHWYSYSLKLYEYDKADLDLIKLKRNMVSCYLSLK
FT                   QLDKAKEAIAEVEQKDPTHVFTRYYIFKIAIMEGDAFRALQVVSALKKSLMDGESEDRG
FT                   LIEAGVSTLTILSLSIDFALENGQQFVAERALEYLCQLSKDPKEVLGGLKCLMRIILPQ
FT                   AFHMPESEYKKKEMGRLWNYLNTALLKFSEYFNEAPSTLDYMVNDANWFRKIAWNLAVQ
FT                   SEKDLEAMKNFFMVSYKLSLFCPLDQGLLIAQKTCLLVAAAVDLDRGRKAPTICEQVST
FT                   KCKRGHQTFWNYRW"
FT   assembly_gap    5800535..5800554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5803864..5804714
FT                   /estimated_length=851
FT                   /gap_type="unknown"
FT   assembly_gap    5812369..5812388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5824083..5824102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5831733..5832164
FT                   /estimated_length=432
FT                   /gap_type="unknown"
FT   assembly_gap    5839111..5839265
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    5845891..5845910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5853764..5853946
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    5863142..5863161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5870888..5870907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5914831..5914850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5925707..5925726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5934678..5936155
FT                   /estimated_length=1478
FT                   /gap_type="unknown"
FT   assembly_gap    5938781..5939846
FT                   /estimated_length=1066
FT                   /gap_type="unknown"
FT   assembly_gap    5941774..5941793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5946638..5946796
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    5956080..5956099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5977396..5978799
FT                   /pseudo
FT                   /locus_tag="mCG_119681"
FT                   /note="gene_id=mCG119681.1"
FT   mRNA            5977396..5978799
FT                   /pseudo
FT                   /locus_tag="mCG_119681"
FT                   /note="gene_id=mCG119681.1 transcript_id=mCT120856.1
FT                   created on 13-AUG-2002"
FT   assembly_gap    5979197..5979245
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    5983885..5984081
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    5987856..5989000
FT                   /estimated_length=1145
FT                   /gap_type="unknown"
FT   assembly_gap    5991524..5991766
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   gene            complement(5993716..6000204)
FT                   /gene="Slc7a3"
FT                   /locus_tag="mCG_119671"
FT                   /note="gene_id=mCG119671.0"
FT   mRNA            complement(join(5993716..5994087,5994195..5994303,
FT                   5994596..5994762,5995203..5995306,5996536..5996638,
FT                   5996733..5996872,5997031..5997253,5997374..5997486,
FT                   5997631..5997808,5997988..5998146,5998723..5999126,
FT                   5999673..5999830,6000124..6000204))
FT                   /gene="Slc7a3"
FT                   /locus_tag="mCG_119671"
FT                   /product="solute carrier family 7 (cationic amino acid
FT                   transporter, y+ system), member 3"
FT                   /note="gene_id=mCG119671.0 transcript_id=mCT120846.1
FT                   created on 08-AUG-2002"
FT   CDS             complement(join(5993957..5994087,5994195..5994303,
FT                   5994596..5994762,5995203..5995306,5996536..5996638,
FT                   5996733..5996872,5997031..5997253,5997374..5997486,
FT                   5997631..5997808,5997988..5998146,5998723..5999092))
FT                   /codon_start=1
FT                   /gene="Slc7a3"
FT                   /locus_tag="mCG_119671"
FT                   /product="solute carrier family 7 (cationic amino acid
FT                   transporter, y+ system), member 3"
FT                   /note="gene_id=mCG119671.0 transcript_id=mCT120846.1
FT                   protein_id=mCP69823.1"
FT                   /protein_id="EDL14161.1"
FT                   /translation="MLWQALRRFGQKLVRRRVLELGMGETRLARCLSTLDLVALGVGST
FT                   LGAGVYVLAGEVAKDKAGPSIVICFLVAALSSVLAGLCYAEFGARVPGSGSAYLYSYVT
FT                   VGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEY
FT                   PDFFALALVLLLTGLLVLGASKSALVTKVFTGMNLLVLSFVIISGFIKGELRNWKLTKE
FT                   DYCLTMSESNGTCSLDSMGSGGFMPFGLEGILRGAATCFYAFVGFDCIATTGEEAQNPQ
FT                   RSIPMGIVISMFICFLAYFGVSSALTLMMPYYKLHPESPLPEAFSYVGWEPARYLVAIG
FT                   SLCALSTSLLGSMFPMPRVMYSMAEDGLLFRVLAKVHSVTHIPIVATLVSGVIAAFMAF
FT                   LFELTDLVDLMSIGTLLAHSLVSICVLILRLEAEKLTVQALFCPVNSIPTLLSGRVVYV
FT                   CSSLLAVLLTVLCLVLTWWTTPLRSGDPVWVTVVVLILGLILAISGVIWRQPQNRTPLH
FT                   FKVPAVPLLPLVSIFVNVYLMMQMTAGTWARFGIWMLIGFAIYFGYGIQHSMKEVKNHQ
FT                   TLPKTRAQTIDLDLTTSCVHSI"
FT   assembly_gap    5995309..5996054
FT                   /estimated_length=746
FT                   /gap_type="unknown"
FT   assembly_gap    6006927..6007187
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   gene            complement(6012192..>6016472)
FT                   /locus_tag="mCG_140934"
FT                   /note="gene_id=mCG140934.0"
FT   mRNA            complement(join(6012192..6012690,6016405..>6016472))
FT                   /locus_tag="mCG_140934"
FT                   /product="mCG140934"
FT                   /note="gene_id=mCG140934.0 transcript_id=mCT172309.0
FT                   created on 15-AUG-2002"
FT   CDS             complement(6012381..>6012548)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140934"
FT                   /product="mCG140934"
FT                   /note="gene_id=mCG140934.0 transcript_id=mCT172309.0
FT                   protein_id=mCP95228.0"
FT                   /protein_id="EDL14160.1"
FT                   /translation="LGLKSEVGVGSAEHGHRNLLDSSVKFSLLYFPPTPSLCSSANSQL
FT                   QCGYILFFFK"
FT   assembly_gap    6014102..6014959
FT                   /estimated_length=858
FT                   /gap_type="unknown"
FT   assembly_gap    6025139..6027949
FT                   /estimated_length=2811
FT                   /gap_type="unknown"
FT   assembly_gap    6029980..6030558
FT                   /estimated_length=579
FT                   /gap_type="unknown"
FT   assembly_gap    6033623..6033642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6034923..6036921
FT                   /estimated_length=1999
FT                   /gap_type="unknown"
FT   assembly_gap    6040167..6040186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6044227..>6109884)
FT                   /locus_tag="mCG_144648"
FT                   /note="gene_id=mCG144648.0"
FT   mRNA            complement(join(6044227..6045169,6045190..6045393,
FT                   6109762..>6109884))
FT                   /locus_tag="mCG_144648"
FT                   /product="mCG144648"
FT                   /note="gene_id=mCG144648.0 transcript_id=mCT184072.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(6044538..>6044858)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144648"
FT                   /product="mCG144648"
FT                   /note="gene_id=mCG144648.0 transcript_id=mCT184072.0
FT                   protein_id=mCP106211.0"
FT                   /protein_id="EDL14159.1"
FT                   /translation="CGELVGPTLLRTRSFGGHLGLTPPYQPLCFVTCSLLPFTQGSFHN
FT                   CFTAVGSLHPSTYLDLRIFLPSFVTLIVHGLGGFLLADLRFWFLHVSDRVLFMEPRLAS
FT                   NS"
FT   assembly_gap    6045170..6045189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6060390..6060445
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    6065241..6065260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6081896..6081915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6089957..6089976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6091923..6093601
FT                   /estimated_length=1679
FT                   /gap_type="unknown"
FT   assembly_gap    6097672..6098182
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   assembly_gap    6100999..6101571
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    6109899..6109918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6111305..6113025
FT                   /locus_tag="mCG_1031086"
FT                   /note="gene_id=mCG1031086.1"
FT   mRNA            join(<6111305..6111806,6112018..6113025)
FT                   /locus_tag="mCG_1031086"
FT                   /product="mCG1031086"
FT                   /note="gene_id=mCG1031086.1 transcript_id=mCT148790.1
FT                   created on 23-AUG-2002"
FT   CDS             <6111344..6111499
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031086"
FT                   /product="mCG1031086"
FT                   /note="gene_id=mCG1031086.1 transcript_id=mCT148790.1
FT                   protein_id=mCP69800.1"
FT                   /protein_id="EDL14158.1"
FT                   /translation="QFPYIYMIYSNYPLPHPFLSPHLMAIYQFLNVHAFDPSVQIPQIY
FT                   PISIFT"
FT   assembly_gap    6111807..6112017
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   gene            complement(6122951..6134867)
FT                   /gene="Snx12"
FT                   /locus_tag="mCG_2194"
FT                   /note="gene_id=mCG2194.3"
FT   mRNA            complement(join(6122951..6124666,6126705..6126829,
FT                   6127787..6127882,6134566..6134867))
FT                   /gene="Snx12"
FT                   /locus_tag="mCG_2194"
FT                   /product="sorting nexin 12, transcript variant mCT171572"
FT                   /note="gene_id=mCG2194.3 transcript_id=mCT171572.1 created
FT                   on 17-JUN-2003"
FT   mRNA            complement(join(6122961..6124666,6126078..6126168,
FT                   6126705..6126829,6127787..6127882,6134566..6134867))
FT                   /gene="Snx12"
FT                   /locus_tag="mCG_2194"
FT                   /product="sorting nexin 12, transcript variant mCT1521"
FT                   /note="gene_id=mCG2194.3 transcript_id=mCT1521.2 created on
FT                   17-JUN-2003"
FT   CDS             complement(join(6124600..6124666,6126705..6126829,
FT                   6127787..6127882,6134566..6134730))
FT                   /codon_start=1
FT                   /gene="Snx12"
FT                   /locus_tag="mCG_2194"
FT                   /product="sorting nexin 12, isoform CRA_a"
FT                   /note="gene_id=mCG2194.3 transcript_id=mCT171572.1
FT                   protein_id=mCP94492.0 isoform=CRA_a"
FT                   /protein_id="EDL14155.1"
FT                   /translation="MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRA
FT                   RFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPF
FT                   RGDEGIFEESFIEERRQGLEQFINKSLGKRIAESGVTLVREIRIRF"
FT   CDS             complement(join(6124643..6124666,6126078..6126168,
FT                   6126705..6126829,6127787..6127882,6134566..6134730))
FT                   /codon_start=1
FT                   /gene="Snx12"
FT                   /locus_tag="mCG_2194"
FT                   /product="sorting nexin 12, isoform CRA_b"
FT                   /note="gene_id=mCG2194.3 transcript_id=mCT1521.2
FT                   protein_id=mCP9943.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TGS7"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="MGI:MGI:1919331"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TGS7"
FT                   /protein_id="EDL14156.1"
FT                   /translation="MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRA
FT                   RFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPF
FT                   RGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVLGE
FT                   KDC"
FT   mRNA            complement(join(6125595..6126168,6126705..6126829,
FT                   6127787..6127882,6134566..6134867))
FT                   /gene="Snx12"
FT                   /locus_tag="mCG_2194"
FT                   /product="sorting nexin 12, transcript variant mCT171573"
FT                   /note="gene_id=mCG2194.3 transcript_id=mCT171573.1 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(6126066..6126168,6126705..6126829,
FT                   6127787..6127882,6134566..6134730))
FT                   /codon_start=1
FT                   /gene="Snx12"
FT                   /locus_tag="mCG_2194"
FT                   /product="sorting nexin 12, isoform CRA_c"
FT                   /note="gene_id=mCG2194.3 transcript_id=mCT171573.1
FT                   protein_id=mCP94491.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q6ZWQ5"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="MGI:MGI:1919331"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWQ5"
FT                   /protein_id="EDL14157.1"
FT                   /translation="MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRA
FT                   RFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPF
FT                   RGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQ"
FT   assembly_gap    6151285..6151767
FT                   /estimated_length=483
FT                   /gap_type="unknown"
FT   assembly_gap    6160080..6160099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6166938..6173256
FT                   /gene="Mllt7"
FT                   /locus_tag="mCG_2196"
FT                   /note="gene_id=mCG2196.2"
FT   mRNA            join(6166938..6166983,6167008..6167556,6170460..6171516,
FT                   6171798..6173256)
FT                   /gene="Mllt7"
FT                   /locus_tag="mCG_2196"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 7 homolog (Drosophila)"
FT                   /note="gene_id=mCG2196.2 transcript_id=mCT1523.2 created on
FT                   08-AUG-2002"
FT   assembly_gap    6166986..6167005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(6167104..6167556,6170460..6171516,6171798..6171805)
FT                   /codon_start=1
FT                   /gene="Mllt7"
FT                   /locus_tag="mCG_2196"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 7 homolog (Drosophila)"
FT                   /note="gene_id=mCG2196.2 transcript_id=mCT1523.2
FT                   protein_id=mCP9944.2"
FT                   /db_xref="GOA:B1AUT3"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR030456"
FT                   /db_xref="InterPro:IPR032067"
FT                   /db_xref="MGI:MGI:1891915"
FT                   /db_xref="UniProtKB/TrEMBL:B1AUT3"
FT                   /protein_id="EDL14154.1"
FT                   /translation="MDPENKKSATGAAAILDLDPDFEPQSRPRSCTWPLPRPDLATEPH
FT                   EPSEVEPSLGQKVPTEGHSEPILLPSRLPEPAGGPQPGILGAVTGPRKGGSRRNAWGNQ
FT                   SYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSK
FT                   FIKVHNEATGKSSWWMLNPDGGKGGKAPRRRAASMDSSSKLLRGRSKGPKKKPSVLPAP
FT                   PEGATPRSPLGHFAKWSSSPCPRNREEADVWTTFRPRSSSNASTVSTRLSPMRPESEVL
FT                   AEEEMPASASSYAGGVPPTLSEDLELLDGLNLASPHSLLSRSGLSGFSLQHPGLAGPLH
FT                   SYGASLFGPIDGSLSAGEGCFSSSQSLEALLTSDTPPPPADVLMTQVDPILSQAPTLLL
FT                   LGGMPSSSKLGTGVSLCPTPLEGPGPSNLVPNLSVMAPPPVMAGAPIPKVLGTPVLASP
FT                   TEDSSHDRMPQDLDLDMYMENLECDMDNIISDLMDGEGLDFNFEPDP"
FT   gene            complement(<6173661..>6176302)
FT                   /locus_tag="mCG_145216"
FT                   /note="gene_id=mCG145216.0"
FT   mRNA            complement(join(<6173661..6173718,6173758..6173823,
FT                   6174159..6174325,6174705..6174773,6175627..6175761,
FT                   6175960..6176072,6176151..>6176302))
FT                   /locus_tag="mCG_145216"
FT                   /product="mCG145216"
FT                   /note="gene_id=mCG145216.0 transcript_id=mCT184640.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(<6173661..6173718,6173758..6173823,
FT                   6174159..6174325,6174705..6174773,6175627..6175761,
FT                   6175960..6176072,6176151..>6176176))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145216"
FT                   /product="mCG145216"
FT                   /note="gene_id=mCG145216.0 transcript_id=mCT184640.0
FT                   protein_id=mCP106216.0"
FT                   /protein_id="EDL14153.1"
FT                   /translation="HVYHHQTWRILPSYLFSDNQEFLVNSNCSVLLLLHYIRKKMKLRK
FT                   TDTIDLCDESGTMKLLFLSKTPGDSASKFLTARNTYYVCKVERGAPGTRIENSYKAIVP
FT                   MLKNPEPELVDSLRTQCDFLERSRIKMLRTLEAKRLAAMESSVNLPARSPKGGGAQQTT
FT                   STSSQLKSKGGRSDEDGPPSTRRPFYKTRSRLSQEYIVNSIQRPSESS"
FT   assembly_gap    6173734..6173753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6176718..6180533)
FT                   /gene="Il2rg"
FT                   /locus_tag="mCG_2198"
FT                   /note="gene_id=mCG2198.2"
FT   mRNA            complement(join(6176718..6177363,6177702..6177768,
FT                   6177956..6178052,6178507..6178669,6179304..6179446,
FT                   6179637..6179821,6180037..6180190,6180381..6180532))
FT                   /gene="Il2rg"
FT                   /locus_tag="mCG_2198"
FT                   /product="interleukin 2 receptor, gamma chain, transcript
FT                   variant mCT1526"
FT                   /note="gene_id=mCG2198.2 transcript_id=mCT1526.2 created on
FT                   08-AUG-2002"
FT   mRNA            complement(join(6176744..6177363,6177702..6177768,
FT                   6178507..6178669,6179304..6179446,6179637..6179821,
FT                   6180037..6180190,6180381..6180533))
FT                   /gene="Il2rg"
FT                   /locus_tag="mCG_2198"
FT                   /product="interleukin 2 receptor, gamma chain, transcript
FT                   variant mCT171574"
FT                   /note="gene_id=mCG2198.2 transcript_id=mCT171574.0 created
FT                   on 08-AUG-2002"
FT   CDS             complement(join(6177178..6177363,6177702..6177768,
FT                   6177956..6178052,6178507..6178669,6179304..6179446,
FT                   6179637..6179821,6180037..6180190,6180381..6180495))
FT                   /codon_start=1
FT                   /gene="Il2rg"
FT                   /locus_tag="mCG_2198"
FT                   /product="interleukin 2 receptor, gamma chain, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2198.2 transcript_id=mCT1526.2
FT                   protein_id=mCP9945.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UPA9"
FT                   /db_xref="InterPro:IPR003531"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015321"
FT                   /db_xref="MGI:MGI:96551"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UPA9"
FT                   /protein_id="EDL14152.1"
FT                   /translation="MLKLLLSPRSFLVLQLLLLRAGWSSKVLMSSANEDIKADLILTST
FT                   APEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSH
FT                   YLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLS
FT                   NLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTF
FT                   RVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVY
FT                   CWLERMPPIPPIKNLEDLVTEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGG
FT                   ALGEGPGGSPCSLHSPYWPPPCYSLKPEA"
FT   CDS             complement(join(6177737..6177768,6178507..6178669,
FT                   6179304..6179446,6179637..6179821,6180037..6180190,
FT                   6180381..6180495))
FT                   /codon_start=1
FT                   /gene="Il2rg"
FT                   /locus_tag="mCG_2198"
FT                   /product="interleukin 2 receptor, gamma chain, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2198.2 transcript_id=mCT171574.0
FT                   protein_id=mCP94493.0 isoform=CRA_a"
FT                   /protein_id="EDL14151.1"
FT                   /translation="MLKLLLSPRSFLVLQLLLLRAGWSSKVLMSSANEDIKADLILTST
FT                   APEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSH
FT                   YLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLS
FT                   NLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTF
FT                   RVRSRYNPICGSSQQWSKWSQPVHWGSHTVEECLQFPPSRI"
FT   assembly_gap    6183097..6183220
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   gene            6186557..6209655
FT                   /gene="Med12"
FT                   /locus_tag="mCG_119679"
FT                   /note="gene_id=mCG119679.1"
FT   mRNA            join(6186557..6186688,6187125..6187229,6187401..6187592,
FT                   6187721..6187880,6188329..6188510,6188671..6188781,
FT                   6188894..6189148,6189664..6189810,6190083..6190182,
FT                   6190294..6190430,6190658..6190789,6191575..6191701,
FT                   6192786..6193015,6193398..6193478,6193593..6193763,
FT                   6193968..6194112,6194280..6194330,6194603..6194721,
FT                   6194902..6195045,6195484..6195647,6195870..6196001,
FT                   6196348..6196575,6196746..6196890,6197064..6197184,
FT                   6197663..6197764,6197861..6197974,6198227..6198402,
FT                   6198570..6198749,6199763..6199834,6200251..6200384,
FT                   6200552..6200713,6201333..6201444,6201608..6201697,
FT                   6202220..6202329,6202527..6202662,6203397..6203558,
FT                   6204746..6205164,6205295..6205488,6205627..6205832,
FT                   6205995..6206072,6206160..6206377,6208044..6208290,
FT                   6208795..6208935,6209121..6209202,6209389..6209655)
FT                   /gene="Med12"
FT                   /locus_tag="mCG_119679"
FT                   /product="mediator of RNA polymerase II transcription,
FT                   subunit 12 homolog (yeast)"
FT                   /note="gene_id=mCG119679.1 transcript_id=mCT120854.1
FT                   created on 13-AUG-2002"
FT   CDS             join(6186590..6186688,6187125..6187229,6187401..6187592,
FT                   6187721..6187880,6188329..6188510,6188671..6188781,
FT                   6188894..6189148,6189664..6189810,6190083..6190182,
FT                   6190294..6190430,6190658..6190789,6191575..6191701,
FT                   6192786..6193015,6193398..6193478,6193593..6193763,
FT                   6193968..6194112,6194280..6194330,6194603..6194721,
FT                   6194902..6195045,6195484..6195647,6195870..6196001,
FT                   6196348..6196575,6196746..6196890,6197064..6197184,
FT                   6197663..6197764,6197861..6197974,6198227..6198402,
FT                   6198570..6198749,6199763..6199834,6200251..6200384,
FT                   6200552..6200713,6201333..6201444,6201608..6201697,
FT                   6202220..6202329,6202527..6202662,6203397..6203558,
FT                   6204746..6205164,6205295..6205488,6205627..6205832,
FT                   6205995..6206072,6206160..6206377,6208044..6208290,
FT                   6208795..6208935,6209121..6209202,6209389..6209432)
FT                   /codon_start=1
FT                   /gene="Med12"
FT                   /locus_tag="mCG_119679"
FT                   /product="mediator of RNA polymerase II transcription,
FT                   subunit 12 homolog (yeast)"
FT                   /note="gene_id=mCG119679.1 transcript_id=mCT120854.1
FT                   protein_id=mCP69999.1"
FT                   /protein_id="EDL14150.1"
FT                   /translation="MAAFGILSYEHRPLKRLRLGPPDVYPQDPKQKEDELTALNVKQGF
FT                   NNQPAVSGDEHGSAKNVNFNPAKISSNFSSIIAEKLRCNTLSDTGRRKSLMNQKDNFWL
FT                   VTARSQSAINTWFTDLAGTKPLTHLAKKVPIFSKKEEVFGYLAKYTVPVMRAAWLIKMT
FT                   CAYYAAMSETKVKKKNTADPFTEWTQIITKYLWEQLQKMAEYYRPGPAGSGGCGSTIGP
FT                   LPHDVEMAIRQWDYNEKLALFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLKLLLPLL
FT                   LRYSGEFVQSAYLSRRLAYFCTRRLALQLDGVSSHSSHVIAAQSTSSLPTTPAPQPPTS
FT                   STPSTPFSDLLMCPQHRPLVFGLSCILQTILLCCPSALVWHYSLTDSRIKTGSPLDHLP
FT                   IAPSNLPMPEGNSAFTQQVRAKLREIEQQIKERGQAVEVRWSFDKCQEATAGFTIGRVL
FT                   HTLEVLDSHSFERSDFSNSLDSLCNRIFGLGPSKDGHEISSDDDAVVSLLCEWAVSCKR
FT                   SGRHRAMVVAKLLEKRQAEIEAERCGESEAADEKGSVASGSLSAPSAPIFQDVLLQFLD
FT                   TQAPMLTDPRSESERVEFFNLVLLFCELIRHDVFSHNMYTCTLISRGDLAFGAPGPRPP
FT                   SPFDDPTDDPERKEAEGSSSSKLEDPGLSESMDIDPSSSVLFEDMEKPDFSLFSPTMPC
FT                   EGKGSPSPEKPDVEKEVKPPAKEKIEGTLGILYDQPRHVQYATHFPIPQEESCSHECNQ
FT                   RLVVLFGVGKQRDDARHAIKKITKDILKVLNRKGTAETDQLAPIVPLNPGDLTFLGGED
FT                   GQKRRRNRPEAFPTAEDIFAKFQHLSHYDQHQVTAQVSRNVLEQITSFALGMSYHLPLV
FT                   QHVQFIFDLMEYSLSISGLIDFAIQLLNELSVVEAELLLKSSDLVGSYTTSLCLCIVAV
FT                   LRHYHACLILNQDQMAQVFEGLCGVVKHGMNRSDGSSAERCILAYLYDLYTSCSHLKSK
FT                   FGELFSDFCSKVKNTIYCNVEPSESNMRWAPEFMIDTLENPAAHTFTYTGLGKSLSENP
FT                   ANRYSFVCNALMHVCVGHHDPDRVNDIAILCAELTGYCKSLSAEWLGVLKALCCSSNNG
FT                   TCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDLIRCAAIPSLLNAACSEQDS
FT                   EPGARLTCRILLHLFKTPQLNPCQSDGNKPTVGIRSSCDRHLLAASQNRIVDGAVFAVL
FT                   KAVFVLGDAELKGSGFTVPGGTEELPEEEGGGGSSGRRQGGRNISVETASLDVYAKYVL
FT                   RSICQQEWVGERCLKSLCEDSNDLQDPVLSSAQAQRLMQLICYPHRLLDNEDGENPQRQ
FT                   RIKRILKNLDQWTMRQSSLELQLMIKQTPNTEMNSLLENIAKATIEVFQQSAETGSSSG
FT                   STASNMPSSSKTKPVLSSLERSGVWLVAPLIAKLPTSVQGHVLKAAGEELEKGQHLGSS
FT                   SRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLASLHSQVHQIVINWRENQY
FT                   LDDCKPKQLMHEALKLRLNLVGGMFDTVQRSTQQTTEWAQLLLEIIISGTVDMQSNNEL
FT                   FTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLQKDLGERQSDSLEKVHQ
FT                   LLPLPKQNRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVSTKQKISPWELFEGLKP
FT                   STAPLSWAWFGTVRVDRRVARGEEQQRLLLYHTHLRPRPRAYYLEPLPLPPEDEEPPAP
FT                   ALLEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKKRSQPATKNEASPYPTLQALFLT
FT                   LTAVTHLPLSSAPVQDYGMGPGRSGPYGVTVPPDLLHHANPGSISHLSYRQSSMGLYTQ
FT                   NQPLPAGGPRVDPYRPVRLPMQKLPTRPTYPGVLPTTMSTVMGLEPSSYKTSVYRQQQP
FT                   TVPQGQRLRQQLQAKIQSQGMLGQSSVHQMTPSSSYGLQTSQGYTSYVSHVGLQQHTGP
FT                   AGTMVPPSYSSQPYQSTHPSTNPTLVDPTRHLQQRPSGYVHQQAPTYGHGLTSTQRFSH
FT                   QTLQQTPMMGTMTPLSAQGVQAGVRSTSILPEQQQQQQQQQQQQQQQQQQQQQQQQQQQ
FT                   QQQQQQYHIRQQQQQQQMLRQQQQQQQQQQQQQQQQQQQQQQQQQQQPHQQQQQAAPPQ
FT                   PQPQSQPQFQRQGLQQTQQQQQTAALVRQLQQQLSNTQPQPSTNIFGRY"
FT   assembly_gap    6187103..6187122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6194354..6194411
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   gene            <6211411..6233445
FT                   /gene="Nlgn3"
FT                   /locus_tag="mCG_119686"
FT                   /note="gene_id=mCG119686.2"
FT   mRNA            join(<6211411..6211498,6214285..6214430,6214767..6214910,
FT                   6219555..6219614,6221238..6221387,6227732..6227917,
FT                   6230529..6231318,6232019..6233445)
FT                   /gene="Nlgn3"
FT                   /locus_tag="mCG_119686"
FT                   /product="neuroligin 3"
FT                   /note="gene_id=mCG119686.2 transcript_id=mCT120861.2
FT                   created on 10-FEB-2003"
FT   assembly_gap    6211866..6213040
FT                   /estimated_length=1175
FT                   /gap_type="unknown"
FT   assembly_gap    6214431..6214679
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   CDS             join(<6214769..6214910,6219555..6219614,6221238..6221387,
FT                   6227732..6227917,6230529..6231318,6232019..6232862)
FT                   /codon_start=1
FT                   /gene="Nlgn3"
FT                   /locus_tag="mCG_119686"
FT                   /product="neuroligin 3"
FT                   /note="gene_id=mCG119686.2 transcript_id=mCT120861.2
FT                   protein_id=mCP69867.0"
FT                   /protein_id="EDL14149.1"
FT                   /translation="CPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPT
FT                   EDGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSVLASYGN
FT                   VIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSG
FT                   IGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAVNYQPVKYTSLLADKVGCNVLDTVD
FT                   MVDCLRQKSAKELVEQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVN
FT                   QGEGLKFVEGVVDPEDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRD
FT                   NPETRRKTLVALFTDHQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDAAHG
FT                   DEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTKFIHT
FT                   KANRFEEVAWSKYNPRDQLYLHIGLKPRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTS
FT                   TTTKVPPPDTTHSSHITRRPNGKTWSTKRPAISPAYSNENAPGSWNGDQDAGPLLVENP
FT                   RDYSTELSVTIAVGASLLFLNVLAFAALYYRKDKRRQEPLRQPSPQRGTGAPELGTAPE
FT                   EELAALQLGPTHHECEAGPPHDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLV
FT                   GLQTLHPYNTFAAGFNSTGLPHSHSTTRV"
FT   assembly_gap    6224149..6224565
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   assembly_gap    6227389..6227418
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    6237703..6237722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6241954..6242045
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    6249674..6249806
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    6256105..6257016
FT                   /estimated_length=912
FT                   /gap_type="unknown"
FT   assembly_gap    6258136..6258189
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    6259441..6259486
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    6266717..6266961
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    6268652..6268671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6278383..6278402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6290248..6298565
FT                   /gene="Gjb1"
FT                   /locus_tag="mCG_2200"
FT                   /note="gene_id=mCG2200.2"
FT   mRNA            join(6290248..6290306,6297099..6298555)
FT                   /gene="Gjb1"
FT                   /locus_tag="mCG_2200"
FT                   /product="gap junction membrane channel protein beta 1,
FT                   transcript variant mCT1515"
FT                   /note="gene_id=mCG2200.2 transcript_id=mCT1515.2 created on
FT                   08-AUG-2002"
FT   mRNA            join(6295065..6295122,6297099..6298565)
FT                   /gene="Gjb1"
FT                   /locus_tag="mCG_2200"
FT                   /product="gap junction membrane channel protein beta 1,
FT                   transcript variant mCT171571"
FT                   /note="gene_id=mCG2200.2 transcript_id=mCT171571.0 created
FT                   on 08-AUG-2002"
FT   CDS             6297115..6297966
FT                   /codon_start=1
FT                   /gene="Gjb1"
FT                   /locus_tag="mCG_2200"
FT                   /product="gap junction membrane channel protein beta 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG2200.2 transcript_id=mCT1515.2
FT                   protein_id=mCP9947.1 isoform=CRA_a"
FT                   /protein_id="EDL14147.1"
FT                   /translation="MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWG
FT                   DEKSSFICNTLQPGCNSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKK
FT                   MLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMV
FT                   RLVKCEAFPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQ
FT                   RRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCS
FT                   AC"
FT   CDS             6297115..6297966
FT                   /codon_start=1
FT                   /gene="Gjb1"
FT                   /locus_tag="mCG_2200"
FT                   /product="gap junction membrane channel protein beta 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG2200.2 transcript_id=mCT171571.0
FT                   protein_id=mCP94490.0 isoform=CRA_a"
FT                   /protein_id="EDL14148.1"
FT                   /translation="MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWG
FT                   DEKSSFICNTLQPGCNSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKK
FT                   MLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMV
FT                   RLVKCEAFPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQ
FT                   RRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCS
FT                   AC"
FT   assembly_gap    6298566..6299092
FT                   /estimated_length=527
FT                   /gap_type="unknown"
FT   assembly_gap    6301227..6301310
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    6305145..6305435
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    6308785..6309099
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   gene            complement(6317338..6333706)
FT                   /gene="Zmym3"
FT                   /locus_tag="mCG_119678"
FT                   /note="gene_id=mCG119678.0"
FT   mRNA            complement(join(6317338..6318756,6318857..6318971,
FT                   6320107..6320361,6321379..6321493,6322056..6322207,
FT                   6322514..6322682,6322959..6323062,6324115..6324261,
FT                   6324434..6324608,6324747..6324859,6325040..6325196,
FT                   6325280..6325377,6326014..6326179,6326391..6326563,
FT                   6326806..6326956,6327077..6327163,6327324..6327439,
FT                   6327650..6327800,6328090..6328308,6328663..6328840,
FT                   6329069..6329363,6329811..6329883,6330189..6330232,
FT                   6331175..6331854,6333050..6333706))
FT                   /gene="Zmym3"
FT                   /locus_tag="mCG_119678"
FT                   /product="zinc finger, MYM-type 3, transcript variant
FT                   mCT120853"
FT                   /note="gene_id=mCG119678.0 transcript_id=mCT120853.0
FT                   created on 08-AUG-2002"
FT   mRNA            complement(join(6317338..6318756,6318857..6318971,
FT                   6321379..6321493,6322056..6322207,6322535..6322682,
FT                   6322959..6323062,6324115..6324261,6324434..6324608,
FT                   6324747..6324859,6325040..6325196,6325280..6325377,
FT                   6326014..6326179,6326391..6326563,6326806..6326956,
FT                   6327077..6327163,6327324..6327439,6327650..6327800,
FT                   6328090..6328308,6328663..6328840,6329069..6329363,
FT                   6329811..6329883,6330189..6330232,6331175..6331854,
FT                   6332602..>6332702))
FT                   /gene="Zmym3"
FT                   /locus_tag="mCG_119678"
FT                   /product="zinc finger, MYM-type 3, transcript variant
FT                   mCT190749"
FT                   /note="gene_id=mCG119678.0 transcript_id=mCT190749.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(6318564..6318756,6318857..6318971,
FT                   6321379..6321493,6322056..6322207,6322535..6322682,
FT                   6322959..6323062,6324115..6324261,6324434..6324608,
FT                   6324747..6324859,6325040..6325196,6325280..6325377,
FT                   6326014..6326179,6326391..6326563,6326806..6326956,
FT                   6327077..6327163,6327324..6327439,6327650..6327800,
FT                   6328090..6328308,6328663..6328840,6329069..6329363,
FT                   6329811..6329883,6330189..6330232,6331175..6331854,
FT                   6332602..>6332612))
FT                   /codon_start=1
FT                   /gene="Zmym3"
FT                   /locus_tag="mCG_119678"
FT                   /product="zinc finger, MYM-type 3, isoform CRA_a"
FT                   /note="gene_id=mCG119678.0 transcript_id=mCT190749.0
FT                   protein_id=mCP111708.0 isoform=CRA_a"
FT                   /protein_id="EDL14145.1"
FT                   /translation="PCLSPYPAMDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLES
FT                   QTAPSRGWAPPGPSPSSGALDLLDTPSGLEKDPGGVLDGATELLGLGGLLYKAPSPPEV
FT                   DHGPEGTLAWDSGEQTLEPGPGCQTPEVMPPDPGAGASPPSPEGLLEPLAPDSPIILES
FT                   PHIEEEIPPLATRRRGSPGQEEEHTQGQPQSPNAPPSPSVGETLGDGINSSQSKPGVCT
FT                   PTAHPSLPGDGLTGKEIEKPPERVQKRSERVRRAEPPKPEVVDSTESIPVSDEDSDAMV
FT                   DDPNDEDFVPFRPRRSPRMSLRSSMAQRAGRSSMGTKMSCAHCRTPLQKGQTAYQRKGL
FT                   PQLFCSSSCLTTYSKKPLGRKTCTFCKKEIWNTKDSVVVQTGPGGSFHEFCTSVCLSLY
FT                   EAQQQRPIPQSGDPADATRCSICQKTGEVLHEVSNGSVVHRLCSDSCFSKFRANKGLKT
FT                   NCCDQCGAYIYARPGGLGPELLFHDGQQKRFCNTTCLGAYKKKNTRVYPCVWCKTLCKN
FT                   FEMLSHVDRNGKTSLFCSLCCTTSYKVKQAGLTGPPRPCSFCRRSLSDPCYYNKVDRTV
FT                   YQFCSPSCWTKFQHTSPEGGIHLSCHYCHSLFSGKPEVLEWQDQVFQFCCRDCCEDFKR
FT                   LRGVVSQCEHCRQEKLLHEKLRFSGVEKSFCSEGCVLLYKQDFTKKLGLCCITCTYCSQ
FT                   TCQRGVTEQLDGSTWDFCSEDCKTKYLLWYCKAARCHACKRQGKLLETIHWRGQIRHFC
FT                   NQQCLLRFYSQQNQPNLDTQSGPESLLNSQSSESKPQTPSQTKVENNHTVRTPDENGNL
FT                   GKTPVKRATPSVPTPPPPPPPATPRKNKAAMCKPLMQNRGVSCKAEMKSKGSQTEEWKP
FT                   QVIVLPIPVPIFVPVPMHLYCQKVPVPFSMPIPVPVPMFLPTTLESTEKIVETIEELKV
FT                   KIPSNPLEADILAMAEMIAEAEELDKASSDLCDLVSNQSAEGLLEDCDLFGTARDDVLA
FT                   MAVKMANVLDEPGQDLEADFPKNPLDINPSVDFLFDCGLVGPEDVSTEQDLPRAMRKGQ
FT                   KRLMLSESCSRDSLSSQPSCTGLNYSYGVNAWKCWVQSKYANGETSKAKPMRIKEDILA
FT                   CSAAELNYGLAQFVREITRPNGERYEPDSIYYLCLGIQQYLLENNRMVNIFTDLYYLTF
FT                   VQELNKSLSTWQPTLLPNNTGPGKRKREDETILEQRENRMNPLRCPVKFYEFYLSKCPE
FT                   SLRTRNDVFYLQPERSCIAESPLWYSVIPMDRSMLESMLNRILAVREIYEELGRPGEED
FT                   LD"
FT   CDS             complement(join(6318564..6318756,6318857..6318971,
FT                   6320107..6320361,6321379..6321493,6322056..6322207,
FT                   6322514..6322682,6322959..6323062,6324115..6324261,
FT                   6324434..6324608,6324747..6324859,6325040..6325196,
FT                   6325280..6325377,6326014..6326179,6326391..6326563,
FT                   6326806..6326956,6327077..6327163,6327324..6327439,
FT                   6327650..6327800,6328090..6328308,6328663..6328840,
FT                   6329069..6329363,6329811..6329883,6330189..6330232,
FT                   6331175..6331841))
FT                   /codon_start=1
FT                   /gene="Zmym3"
FT                   /locus_tag="mCG_119678"
FT                   /product="zinc finger, MYM-type 3, isoform CRA_b"
FT                   /note="gene_id=mCG119678.0 transcript_id=mCT120853.0
FT                   protein_id=mCP69987.1 isoform=CRA_b"
FT                   /db_xref="GOA:B1AXS5"
FT                   /db_xref="InterPro:IPR010507"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR021893"
FT                   /db_xref="MGI:MGI:1927231"
FT                   /db_xref="UniProtKB/TrEMBL:B1AXS5"
FT                   /protein_id="EDL14146.1"
FT                   /translation="MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPSRGW
FT                   APPGPSPSSGALDLLDTPSGLEKDPGGVLDGATELLGLGGLLYKAPSPPEVDHGPEGTL
FT                   AWDSGEQTLEPGPGCQTPEVMPPDPGAGASPPSPEGLLEPLAPDSPIILESPHIEEEIP
FT                   PLATRRRGSPGQEEEHTQGQPQSPNAPPSPSVGETLGDGINSSQSKPGVCTPTAHPSLP
FT                   GDGLTGKEIEKPPERVQKRSERVRRAEPPKPEVVDSTESIPVSDEDSDAMVDDPNDEDF
FT                   VPFRPRRSPRMSLRSSMAQRAGRSSMGTKMSCAHCRTPLQKGQTAYQRKGLPQLFCSSS
FT                   CLTTYSKKPLGRKTCTFCKKEIWNTKDSVVVQTGPGGSFHEFCTSVCLSLYEAQQQRPI
FT                   PQSGDPADATRCSICQKTGEVLHEVSNGSVVHRLCSDSCFSKFRANKGLKTNCCDQCGA
FT                   YIYARPGGLGPELLFHDGQQKRFCNTTCLGAYKKKNTRVYPCVWCKTLCKNFEMLSHVD
FT                   RNGKTSLFCSLCCTTSYKVKQAGLTGPPRPCSFCRRSLSDPCYYNKVDRTVYQFCSPSC
FT                   WTKFQHTSPEGGIHLSCHYCHSLFSGKPEVLEWQDQVFQFCCRDCCEDFKRLRGVVSQC
FT                   EHCRQEKLLHEKLRFSGVEKSFCSEGCVLLYKQDFTKKLGLCCITCTYCSQTCQRGVTE
FT                   QLDGSTWDFCSEDCKTKYLLWYCKAARCHACKRQGKLLETIHWRGQIRHFCNQQCLLRF
FT                   YSQQNQPNLDTQSGPESLLNSQSSESKPQTPSQTKVENNHTVRTPDENGNLGKTPVKRA
FT                   TPSVPTPPPPPPPATPRKNKAAMCKPLMQNRGVSCKAEMKSKGSQTEEWKPQVIVLPIP
FT                   VPIFVPVPMHLYCQKVPVPFSMPIPVPVPMFLPTTLESTEKIVETIEELKVKIPSNPLE
FT                   ADILAMAEMIAEAEELDKASSDLCDLVSNQSAEGLLEDCDLFGTARDDVLAMAVKMANV
FT                   LDEPGQDLEADFPKNPLDINPSVDFLFDCGLVGPEDVSTEQDLPRAMRKGQKRLMLSES
FT                   CSRDSLSSQPSCTGLNYSYGVNAWKCWVQSKYANGETSKGDELRFGPKPMRIKEDILAC
FT                   SAAELNYGLAQFVREITRPNGERYEPDSIYYLCLGIQQYLLENNRMVNIFTDLYYLTFV
FT                   QELNKSLSTWQPTLLPNNTVFSRVEEEHLWECKQLGVYSPFVLLNTLMFFNTKFFGLQT
FT                   AEEHMQLSFTNVVRQSRKCTTPRGTTKVVSIRYYAPVRQRKGRDTGPGKRKREDETILE
FT                   QRENRMNPLRCPVKFYEFYLSKCPESLRTRNDVFYLQPERSCIAESPLWYSVIPMDRSM
FT                   LESMLNRILAVREIYEELGRPGEEDLD"
FT   assembly_gap    6319928..6319955
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    6333405..6333427
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    6335296..6336012
FT                   /estimated_length=717
FT                   /gap_type="unknown"
FT   gene            <6343105..6362502
FT                   /locus_tag="mCG_119680"
FT                   /note="gene_id=mCG119680.0"
FT   mRNA            join(<6343105..6343185,6343916..6343975,6351135..6351290,
FT                   6353393..6353586,6355424..6355725,6356838..6356933,
FT                   6357203..6357399,6358185..6358269,6358596..6358725,
FT                   6361502..6362502)
FT                   /locus_tag="mCG_119680"
FT                   /product="mCG119680, transcript variant mCT120855"
FT                   /note="gene_id=mCG119680.0 transcript_id=mCT120855.1
FT                   created on 11-FEB-2003"
FT   CDS             join(<6343107..6343185,6343916..6343975,6351135..6351290,
FT                   6353393..6353586,6355424..6355725,6356838..6356933,
FT                   6357203..6357399,6358185..6358269,6358596..6358725,
FT                   6361502..6361636)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119680"
FT                   /product="mCG119680, isoform CRA_c"
FT                   /note="gene_id=mCG119680.0 transcript_id=mCT120855.1
FT                   protein_id=mCP70017.1 isoform=CRA_c"
FT                   /protein_id="EDL14144.1"
FT                   /translation="RSRALFSGRWRPCSVAHTPSKELWPEAVEVSEDCEADTLLCSNPS
FT                   QAIKPLTWRSRIILQGSIISITTSSTISSNSSSSSNSHPHQYLQMASRPAARVNEGLTI
FT                   DLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRL
FT                   ETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVE
FT                   RAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEE
FT                   GLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAR
FT                   EKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRRE
FT                   EEMRRQQEEMMRRQQEGFKGTFPDAVYLPCAYDVTPPTTERFGQAATMEGIGAIGGTPP
FT                   AFNRPAPGAEFAPNKRRRY"
FT   mRNA            join(<6343138..6343185,6343916..6343975,6351118..6351286,
FT                   6353393..6353586,6355424..6355725,6356838..6356933,
FT                   6357203..6357399,6358185..6358269,6358596..6358698,
FT                   6359203..6359242,6360027..6360136,6361502..6362497)
FT                   /locus_tag="mCG_119680"
FT                   /product="mCG119680, transcript variant mCT180102"
FT                   /note="gene_id=mCG119680.0 transcript_id=mCT180102.0
FT                   created on 11-FEB-2003"
FT   CDS             join(<6343138..6343185,6343916..6343975,6351118..6351286,
FT                   6353393..6353586,6355424..6355725,6356838..6356933,
FT                   6357203..6357399,6358185..6358269,6358596..6358698,
FT                   6359203..6359242,6360027..6360136,6361502..6361636)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119680"
FT                   /product="mCG119680, isoform CRA_a"
FT                   /note="gene_id=mCG119680.0 transcript_id=mCT180102.0
FT                   protein_id=mCP103024.0 isoform=CRA_a"
FT                   /protein_id="EDL14142.1"
FT                   /translation="GRAASPILRAKNCGQRQSRLVRTARQTLCCVQIQVKGTKMQSNKA
FT                   FNLEKQNHTPRKHHQHHHQQHHQQQQQQQQQQPPPPIPANGQQASSQNEGLTIDLKNFR
FT                   KPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLA
FT                   EIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIV
FT                   DDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKL
FT                   VIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEME
FT                   MEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQ
FT                   QEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPPGTPAPPGPA
FT                   TMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRPAPGAEFAPNKRRRY"
FT   mRNA            join(<6343144..6343185,6343919..6343975,6351118..6351286,
FT                   6353393..6353586,6355424..6355725,6356838..6356933,
FT                   6357203..6357399,6358185..6358269,6358596..6358698,
FT                   6359203..6359242,6360027..6360136,6361502..6362498)
FT                   /locus_tag="mCG_119680"
FT                   /product="mCG119680, transcript variant mCT190744"
FT                   /note="gene_id=mCG119680.0 transcript_id=mCT190744.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<6343144..6343185,6343919..6343975,6351118..6351286,
FT                   6353393..6353586,6355424..6355725,6356838..6356933,
FT                   6357203..6357399,6358185..6358269,6358596..6358698,
FT                   6359203..6359242,6360027..6360136,6361502..6361636)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119680"
FT                   /product="mCG119680, isoform CRA_b"
FT                   /note="gene_id=mCG119680.0 transcript_id=mCT190744.0
FT                   protein_id=mCP111711.0 isoform=CRA_b"
FT                   /protein_id="EDL14143.1"
FT                   /translation="AASPILRAKNCGQRSRLVRTARQTLCCVQIQVKGTKMQSNKAFNL
FT                   EKQNHTPRKHHQHHHQQHHQQQQQQQQQQPPPPIPANGQQASSQNEGLTIDLKNFRKPG
FT                   EKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIA
FT                   KVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDR
FT                   GRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIK
FT                   NQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEMEA
FT                   ARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQEE
FT                   MMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPPGTPAPPGPATMM
FT                   PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRPAPGAEFAPNKRRRY"
FT   assembly_gap    6344400..6345430
FT                   /estimated_length=1031
FT                   /gap_type="unknown"
FT   assembly_gap    6348787..6348965
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    6352212..6352331
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    6362590..6362609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6363035..6367744
FT                   /gene="Itgb1bp2"
FT                   /locus_tag="mCG_119672"
FT                   /note="gene_id=mCG119672.1"
FT   mRNA            join(6363035..6363176,6363401..6363450,6363545..6363601,
FT                   6363681..6363826,6365527..6365621,6365726..6365784,
FT                   6365894..6365964,6366055..6366154,6366414..6366527,
FT                   6366768..6366830,6367072..6367597,6367635..6367658,
FT                   6367684..6367744)
FT                   /gene="Itgb1bp2"
FT                   /locus_tag="mCG_119672"
FT                   /product="integrin beta 1 binding protein 2, transcript
FT                   variant mCT171566"
FT                   /note="gene_id=mCG119672.1 transcript_id=mCT171566.0
FT                   created on 08-AUG-2002"
FT   mRNA            join(6363035..6363176,6363401..6363450,6363545..6363601,
FT                   6363681..6363826,6365527..6365621,6365726..6365784,
FT                   6365894..6365964,6366055..6366154,6366414..6366527,
FT                   6366768..6366830,6367072..6367597,6367684..6367744)
FT                   /gene="Itgb1bp2"
FT                   /locus_tag="mCG_119672"
FT                   /product="integrin beta 1 binding protein 2, transcript
FT                   variant mCT120847"
FT                   /note="gene_id=mCG119672.1 transcript_id=mCT120847.1
FT                   created on 08-AUG-2002"
FT   CDS             join(6363113..6363176,6363401..6363450,6363545..6363601,
FT                   6363681..6363826,6365527..6365621,6365726..6365784,
FT                   6365894..6365964,6366055..6366154,6366414..6366527,
FT                   6366768..6366830,6367072..6367305)
FT                   /codon_start=1
FT                   /gene="Itgb1bp2"
FT                   /locus_tag="mCG_119672"
FT                   /product="integrin beta 1 binding protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG119672.1 transcript_id=mCT120847.1
FT                   protein_id=mCP69966.1 isoform=CRA_a"
FT                   /protein_id="EDL14140.1"
FT                   /translation="MSLLCYNKGCGQHFDPNTNLPDSCRYHPGVPIFHDALKGWSCCRK
FT                   RTVDFSEFLNIKGCTVGLHCAEKLPEVPPQPEGPATSSLQEQKPLNTIPKSAETLFRER
FT                   PKSEMPPKLLPLLISQALGVALEQKELDQEPGAGLDNSLIWTGSSCQNPGCDAVYQGPE
FT                   SDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWAKQLPASCRHD
FT                   WHQTDSVVVLTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSS
FT                   VSLMPSRVEISLVKADPGSWAQLEHPDSLAEKARAGVLLEMDEEESEDSDDDLSWTEEE
FT                   DEEEEEAMGE"
FT   CDS             join(6363113..6363176,6363401..6363450,6363545..6363601,
FT                   6363681..6363826,6365527..6365621,6365726..6365784,
FT                   6365894..6365964,6366055..6366154,6366414..6366527,
FT                   6366768..6366830,6367072..6367305)
FT                   /codon_start=1
FT                   /gene="Itgb1bp2"
FT                   /locus_tag="mCG_119672"
FT                   /product="integrin beta 1 binding protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG119672.1 transcript_id=mCT171566.0
FT                   protein_id=mCP94485.0 isoform=CRA_a"
FT                   /protein_id="EDL14141.1"
FT                   /translation="MSLLCYNKGCGQHFDPNTNLPDSCRYHPGVPIFHDALKGWSCCRK
FT                   RTVDFSEFLNIKGCTVGLHCAEKLPEVPPQPEGPATSSLQEQKPLNTIPKSAETLFRER
FT                   PKSEMPPKLLPLLISQALGVALEQKELDQEPGAGLDNSLIWTGSSCQNPGCDAVYQGPE
FT                   SDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWAKQLPASCRHD
FT                   WHQTDSVVVLTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSS
FT                   VSLMPSRVEISLVKADPGSWAQLEHPDSLAEKARAGVLLEMDEEESEDSDDDLSWTEEE
FT                   DEEEEEAMGE"
FT   assembly_gap    6367664..6367683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6370664..6371570
FT                   /estimated_length=907
FT                   /gap_type="unknown"
FT   assembly_gap    6376745..6376897
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   gene            6393137..6393532
FT                   /pseudo
FT                   /locus_tag="mCG_1030990"
FT                   /note="gene_id=mCG1030990.1"
FT   mRNA            6393137..6393532
FT                   /pseudo
FT                   /locus_tag="mCG_1030990"
FT                   /note="gene_id=mCG1030990.1 transcript_id=mCT148694.1
FT                   created on 16-AUG-2002"
FT   assembly_gap    6397397..6397534
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    6400656..6401214
FT                   /estimated_length=559
FT                   /gap_type="unknown"
FT   assembly_gap    6405893..6406067
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    6409350..6411289
FT                   /estimated_length=1940
FT                   /gap_type="unknown"
FT   assembly_gap    6412290..6412542
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    6423914..6424180
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    6426449..6430137
FT                   /estimated_length=3689
FT                   /gap_type="unknown"
FT   gene            6432817..6434223
FT                   /pseudo
FT                   /locus_tag="mCG_49218"
FT                   /note="gene_id=mCG49218.2"
FT   mRNA            join(6432817..6433833,6433860..6434223)
FT                   /pseudo
FT                   /locus_tag="mCG_49218"
FT                   /note="gene_id=mCG49218.2 transcript_id=mCT49401.2 created
FT                   on 13-AUG-2002"
FT   assembly_gap    6433835..6433854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6435746..6435804
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    6437595..6437770
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    6439958..6439977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6445836..6445952
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            6446818..6515818
FT                   /locus_tag="mCG_2203"
FT                   /note="gene_id=mCG2203.2"
FT   mRNA            join(6446818..6447008,6447508..6447619,6447755..6447871,
FT                   6453169..6453288,6454861..6455102,6456565..6456783,
FT                   6457152..6457370,6458049..6458256,6461060..6461236,
FT                   6462034..6462161,6462261..6462368,6462464..6462637,
FT                   6463176..6463349,6463804..6463908,6466450..6466650,
FT                   6466791..6466926,6467267..6467397,6468704..6468784,
FT                   6470623..6470772,6470925..6471044,6471276..6471451,
FT                   6473867..6474045,6476175..6476388,6476915..6477080,
FT                   6477629..6477840,6481112..6481220,6482154..6482252,
FT                   6483492..6483669,6489082..6489149,6490278..6490400,
FT                   6491897..6491989,6492069..6492153,6503604..6503653,
FT                   6504131..6504247,6507598..6507723,6508958..6509114,
FT                   6509746..6509923,6512967..6515818)
FT                   /locus_tag="mCG_2203"
FT                   /product="mCG2203"
FT                   /note="gene_id=mCG2203.2 transcript_id=mCT1514.2 created on
FT                   13-AUG-2002"
FT   CDS             join(6446829..6447008,6447508..6447619,6447755..6447871,
FT                   6453169..6453288,6454861..6455102,6456565..6456783,
FT                   6457152..6457370,6458049..6458256,6461060..6461236,
FT                   6462034..6462161,6462261..6462368,6462464..6462637,
FT                   6463176..6463349,6463804..6463908,6466450..6466650,
FT                   6466791..6466926,6467267..6467397,6468704..6468784,
FT                   6470623..6470772,6470925..6471044,6471276..6471451,
FT                   6473867..6474045,6476175..6476388,6476915..6477080,
FT                   6477629..6477840,6481112..6481220,6482154..6482252,
FT                   6483492..6483669,6489082..6489149,6490278..6490400,
FT                   6491897..6491989,6492069..6492153,6503604..6503653,
FT                   6504131..6504247,6507598..6507723,6508958..6509114,
FT                   6509746..6509923,6512967..6513183)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2203"
FT                   /product="mCG2203"
FT                   /note="gene_id=mCG2203.2 transcript_id=mCT1514.2
FT                   protein_id=mCP9946.2"
FT                   /protein_id="EDL14139.1"
FT                   /translation="MGPGWAGLLQDKGGGSPSVVMSDTDSDEESAGGGPFSLTGFLFGN
FT                   INGAGQLEGESVLDDCKKHLAGLGALGLGSLITELTANEELSGSDGALVNDEGWIRSRE
FT                   DAVDYSDINEVAEDESRRYQQTMGSLQPLCHTDYDEDDYDADCEDIDCKLMPPPPPPPG
FT                   PLKKEKDQDDITGVSEDGEGIILPSIIAPSSLASEKVDFSSSSDSESEMGPQDAAQSES
FT                   KDGQLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLRFLRLFGPGKNVPSVWRSARRK
FT                   RKKKHRELIQEGQVQEEECSVELEVNQKSLWNYDYAPPPLPDQCLSDDEITMMAPVESK
FT                   FSQSTGDTDKVMDTKPRVAEWRYGPARLWYDMLGVPEDGSGFDYGFKMKKTEHESTIKC
FT                   NIMKKLRKLEENSGVDLLADENFLMVTQLHWEDDIIWDGEDVKHKGTKPQRASLAGWLP
FT                   SSMTRNAMAYNVQQGFTATLDDDKPWYSIFPIDNEDLVYGRWEDNIIWDAQNMPRILEP
FT                   PVLTLDPNDENLILEIPDEKEEATSNSPSKENKKESSLKKSRILLGKTGVIKEEPQQNM
FT                   SQPEVKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQF
FT                   HRPPLKKYSFGALSQPGPHSVQPLLKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGK
FT                   DGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGS
FT                   LHPGQLLQAFENNLFRAPIYLHKMPESDFLIIRTRQGYFIRELVDIFVVGQQCPLFEVP
FT                   GPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSESSIRKRLKLCAD
FT                   FKRMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCAYYSMIAAEQRLKDAGYGEKSFFAPE
FT                   EENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCGEGFSYVKIPNK
FT                   PTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVR
FT                   TMSTEQARSGEGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDTDS
FT                   SSAEDSDFEEMGKNIENMLQNKKTSSQLSREREEQERKELQRMLLAAGSAAAGNNHRDD
FT                   DTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKATVIDAYVRIRTTKDEEFIR
FT                   KFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKKPKKMKERPDLKLKCGA
FT                   CGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQEEELEKTVIHNDNEELIKVEGTKIVL
FT                   GKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVGTTVHCDYLNRPHKSIHRRRTDPMVT
FT                   LSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSRE
FT                   EFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDD
FT                   DQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVSPMDLETIRKNISKHK
FT                   YQSRESFLDDVNLILANSVKYNGPESQYTKTAPGDCERLYDEHLTQLEKDICTAKEAAL
FT                   EEAELESLDPMTPGPYTPQPPDLYDNNTSLSVSRDASVYQDESNLSVLDIPSATSEKQL
FT                   TQEGGDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFFAIQLS
FT                   ESGSDSDVESGSLRPKQPRVLQENTRMGMENEESMMSYEGDGGDASRGLEDSNISYGSY
FT                   EEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAG
FT                   DTDLDSDE"
FT   assembly_gap    6450124..6450185
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    6452773..6452792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6478710..6480065
FT                   /estimated_length=1356
FT                   /gap_type="unknown"
FT   assembly_gap    6493870..6493997
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    6499683..6500826
FT                   /estimated_length=1144
FT                   /gap_type="unknown"
FT   assembly_gap    6501245..6501359
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    6525091..6525245
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    6532078..6532195
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    6535878..6536582
FT                   /estimated_length=705
FT                   /gap_type="unknown"
FT   assembly_gap    6537667..6537686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6539550..6539698
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    6545191..6545341
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    6546828..6546847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6547992..6548258
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    6551726..6551745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6553310..6553861
FT                   /estimated_length=552
FT                   /gap_type="unknown"
FT   gene            6553862..6598633
FT                   /gene="Ogt"
FT                   /locus_tag="mCG_119685"
FT                   /note="gene_id=mCG119685.1"
FT   mRNA            join(6553862..6554072,6556680..6556830,6557621..6557864,
FT                   6565814..6565882,6569298..6569414,6574927..6575006,
FT                   6577181..6577376,6577665..6577805,6578458..6578558,
FT                   6581092..6581245,6581330..6581431,6581794..6581973,
FT                   6583560..6583718,6583834..6583923,6586613..6586738,
FT                   6587208..6587378,6587488..6587604,6587707..6587877,
FT                   6589936..6590088,6592496..6592748,6593011..6593134,
FT                   6596437..6598633)
FT                   /gene="Ogt"
FT                   /locus_tag="mCG_119685"
FT                   /product="O-linked N-acetylglucosamine (GlcNAc) transferase
FT                   (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl
FT                   transferase), transcript variant mCT120860"
FT                   /note="gene_id=mCG119685.1 transcript_id=mCT120860.1
FT                   created on 06-FEB-2003"
FT   mRNA            join(6554033..6554072,6556650..6556830,6557621..6557864,
FT                   6565814..6565882,6569298..6569414,6574927..6575006,
FT                   6577181..6577376,6577665..6577805,6578458..6578558,
FT                   6581092..6581245,6581330..6581431,6581794..6581973,
FT                   6583560..6583718,6583834..6583923,6586613..6586738,
FT                   6587208..6587378,6587488..6587604,6587707..6587877,
FT                   6589936..6590088,6592496..6592748,6593011..6593134,
FT                   6596437..6596614)
FT                   /gene="Ogt"
FT                   /locus_tag="mCG_119685"
FT                   /product="O-linked N-acetylglucosamine (GlcNAc) transferase
FT                   (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl
FT                   transferase), transcript variant mCT179680"
FT                   /note="gene_id=mCG119685.1 transcript_id=mCT179680.0
FT                   created on 06-FEB-2003"
FT   CDS             join(6554036..6554072,6556650..6556830,6557621..6557864,
FT                   6565814..6565882,6569298..6569414,6574927..6575006,
FT                   6577181..6577376,6577665..6577805,6578458..6578558,
FT                   6581092..6581245,6581330..6581431,6581794..6581973,
FT                   6583560..6583718,6583834..6583923,6586613..6586738,
FT                   6587208..6587378,6587488..6587604,6587707..6587877,
FT                   6589936..6590088,6592496..6592748,6593011..6593134,
FT                   6596437..6596611)
FT                   /codon_start=1
FT                   /gene="Ogt"
FT                   /locus_tag="mCG_119685"
FT                   /product="O-linked N-acetylglucosamine (GlcNAc) transferase
FT                   (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl
FT                   transferase), isoform CRA_b"
FT                   /note="gene_id=mCG119685.1 transcript_id=mCT179680.0
FT                   protein_id=mCP102602.0 isoform=CRA_b"
FT                   /protein_id="EDL14138.1"
FT                   /translation="MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCM
FT                   QLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQ
FT                   LQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL
FT                   GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDP
FT                   NFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDT
FT                   YRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQ
FT                   GNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYS
FT                   NMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKL
FT                   KPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVAEQLEKNRLPSVHPHHSMLYPLSH
FT                   GFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQS
FT                   IPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHI
FT                   LVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSE
FT                   KLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKI
FT                   VKMKCPDGGDNPDSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQ
FT                   INNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNS
FT                   VLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGH
FT                   TTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKSRQEYEDIAVKLGTDLEY
FT                   LKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA"
FT   CDS             join(6554036..6554072,6556680..6556830,6557621..6557864,
FT                   6565814..6565882,6569298..6569414,6574927..6575006,
FT                   6577181..6577376,6577665..6577805,6578458..6578558,
FT                   6581092..6581245,6581330..6581431,6581794..6581973,
FT                   6583560..6583718,6583834..6583923,6586613..6586738,
FT                   6587208..6587378,6587488..6587604,6587707..6587877,
FT                   6589936..6590088,6592496..6592748,6593011..6593134,
FT                   6596437..6596611)
FT                   /codon_start=1
FT                   /gene="Ogt"
FT                   /locus_tag="mCG_119685"
FT                   /product="O-linked N-acetylglucosamine (GlcNAc) transferase
FT                   (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl
FT                   transferase), isoform CRA_a"
FT                   /note="gene_id=mCG119685.1 transcript_id=mCT120860.1
FT                   protein_id=mCP69849.1 isoform=CRA_a"
FT                   /protein_id="EDL14137.1"
FT                   /translation="MASSVGNVADSTGLAELAHREYQAGDFEAAERHCMQLWRQEPDNT
FT                   GVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRH
FT                   ALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRL
FT                   EEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLG
FT                   NVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPH
FT                   FPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLY
FT                   RKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQ
FT                   DVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCN
FT                   LAHCLQIVCDWTDYDERMKKLVSIVAEQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERH
FT                   GNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKF
FT                   EVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKG
FT                   ARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFF
FT                   IGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGD
FT                   NPDSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEE
FT                   VPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAV
FT                   GEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAG
FT                   TPMVTMPGETLASRVAASQLTCLGCLELIAKSRQEYEDIAVKLGTDLEYLKKIRGKVWK
FT                   QRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA"
FT   assembly_gap    6555998..6556017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6571146..6571165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6575737..6575909
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    6578333..6578352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6582618..6582637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6584449..6584836
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   assembly_gap    6588208..6588445
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    6589726..6589916
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    6594085..6594825
FT                   /estimated_length=741
FT                   /gap_type="unknown"
FT   gene            complement(6604351..6606207)
FT                   /locus_tag="mCG_48794"
FT                   /note="gene_id=mCG48794.1"
FT   mRNA            complement(6604351..6606207)
FT                   /locus_tag="mCG_48794"
FT                   /product="mCG48794"
FT                   /note="gene_id=mCG48794.1 transcript_id=mCT48977.1 created
FT                   on 19-AUG-2002"
FT   CDS             complement(6605826..6606131)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48794"
FT                   /product="mCG48794"
FT                   /note="gene_id=mCG48794.1 transcript_id=mCT48977.1
FT                   protein_id=mCP32035.0"
FT                   /protein_id="EDL14136.1"
FT                   /translation="MERLDKAALNALQPPEFRNENSLAATLKTLLFFTALMITVPIGLY
FT                   FTTKAYIFGGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD"
FT   assembly_gap    6610872..6612448
FT                   /estimated_length=1577
FT                   /gap_type="unknown"
FT   assembly_gap    6614530..6614549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6622365..6623865)
FT                   /pseudo
FT                   /locus_tag="mCG_64576"
FT                   /note="gene_id=mCG64576.2"
FT   mRNA            complement(join(6622365..6622576,6622761..6623865))
FT                   /pseudo
FT                   /locus_tag="mCG_64576"
FT                   /note="gene_id=mCG64576.2 transcript_id=mCT64759.2 created
FT                   on 20-AUG-2002"
FT   assembly_gap    6623873..6624368
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   assembly_gap    6625150..6629353
FT                   /estimated_length=4204
FT                   /gap_type="unknown"
FT   gene            complement(6645463..6648074)
FT                   /gene="Cxcr3"
FT                   /locus_tag="mCG_2202"
FT                   /note="gene_id=mCG2202.1"
FT   mRNA            complement(join(6645463..6646969,6647974..6648074))
FT                   /gene="Cxcr3"
FT                   /locus_tag="mCG_2202"
FT                   /product="chemokine (C-X-C motif) receptor 3"
FT                   /note="gene_id=mCG2202.1 transcript_id=mCT1517.0 created on
FT                   08-AUG-2002"
FT   CDS             complement(join(6645878..6646969,6647974..6647985))
FT                   /codon_start=1
FT                   /gene="Cxcr3"
FT                   /locus_tag="mCG_2202"
FT                   /product="chemokine (C-X-C motif) receptor 3"
FT                   /note="gene_id=mCG2202.1 transcript_id=mCT1517.0
FT                   protein_id=mCP9948.1"
FT                   /protein_id="EDL14135.1"
FT                   /translation="MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQD
FT                   FSLNFDRTFLPALYSLLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLT
FT                   LPLWAVDAAVQWVFGPGLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDP
FT                   RVRVALTCIVVWGLCLLFALPDFIYLSANYDQRLNATHCQYNFPQVGRTALRVLQLVAG
FT                   FLLPLLVMAYCYAHILAVLLVSRGQRRFRAMRLVVVVVAAFAVCWTPYHLVVLVDILMD
FT                   VGVLARNCGRESHVDVAKSVTSGMGYMHCCLNPLLYAFVGVKFREQMWMLFTRLGRSDQ
FT                   RGPQRQPSSSRRESSWSETTEASYLGL"
FT   assembly_gap    6666377..6666879
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    6668443..6668515
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    6672566..6672960
FT                   /estimated_length=395
FT                   /gap_type="unknown"
FT   gene            6682251..6683021
FT                   /pseudo
FT                   /locus_tag="mCG_2204"
FT                   /note="gene_id=mCG2204.1"
FT   mRNA            6682251..6683021
FT                   /pseudo
FT                   /locus_tag="mCG_2204"
FT                   /note="gene_id=mCG2204.1 transcript_id=mCT1510.1 created on
FT                   13-AUG-2002"
FT   assembly_gap    6696801..6696820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6698063..6698082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6701453..6707765
FT                   /estimated_length=6313
FT                   /gap_type="unknown"
FT   gene            complement(6724523..>6728154)
FT                   /locus_tag="mCG_1030989"
FT                   /note="gene_id=mCG1030989.1"
FT   mRNA            complement(join(6724523..6724789,6725221..6725266,
FT                   6725530..6725612,6726883..>6728154))
FT                   /locus_tag="mCG_1030989"
FT                   /product="mCG1030989"
FT                   /note="gene_id=mCG1030989.1 transcript_id=mCT148693.1
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(6725233..6725266,6725530..6725612,
FT                   6726883..6728154))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030989"
FT                   /product="mCG1030989"
FT                   /note="gene_id=mCG1030989.1 transcript_id=mCT148693.1
FT                   protein_id=mCP69831.1"
FT                   /protein_id="EDL14134.1"
FT                   /translation="MSCNKEGAVEEVSLDPEDGEATNTCLDGPCSLQDLNLDPDMGSHI
FT                   SENEVKTEDNSEFDSGSKLQALESGMVDLQDHGEQPVSSARDEGDLMDCLPPDSNKVED
FT                   KVQQPTDQMSQDVRSHSSPKSCATQQSTTWADTVADCSRRNRLGKRLGDVKQASMAPVQ
FT                   HCGPKGGRACRTKKKKKVIKSKKTIPEDIQDPASDPDSSSDEYNEMHVMRVTICFKNGG
FT                   HIITGNAMAPEDKTRKRNVQLRGNFHHMTGSLRMSAPKGHMLGIGKLGASCSNRKASVF
FT                   RGKEQSRPPYPGAAVGVLRKASPKKKSAQEKKPLQDIPRATGRRPVPLWGQRPKAAPVE
FT                   VPTFPPINSVPTLESSKKHDTTPLEATEFTHGTSRKRAVAKNTRETLPVAREDRGLECK
FT                   DTMKNSTVMTQTSESSKVKEIDHAQVTKIDLWFPHSLLGRSSIKHQGYWDVSSVLCLRK
FT                   KHAG"
FT   assembly_gap    6745376..6745457
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    6747890..6748046
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    6756615..6756717
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    6759202..6759249
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    6780296..6780385
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    6782769..6782788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6794244..6794681
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    6796815..6797711
FT                   /estimated_length=897
FT                   /gap_type="unknown"
FT   assembly_gap    6811535..6811554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6819460..6820324
FT                   /estimated_length=865
FT                   /gap_type="unknown"
FT   assembly_gap    6822739..6824151
FT                   /estimated_length=1413
FT                   /gap_type="unknown"
FT   assembly_gap    6826163..6826450
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    6832228..6832327
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    6869822..6869868
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    6872114..6872182
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    6883435..6883454
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6883871..6884713
FT                   /estimated_length=843
FT                   /gap_type="unknown"
FT   assembly_gap    6885915..6887776
FT                   /estimated_length=1862
FT                   /gap_type="unknown"
FT   assembly_gap    6897083..6897425
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    6898852..6900608
FT                   /estimated_length=1757
FT                   /gap_type="unknown"
FT   assembly_gap    6902382..6902831
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    6905109..6905128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6911521..6911831
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    6912802..6912886
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   gene            <6918697..>6919802
FT                   /locus_tag="mCG_1031084"
FT                   /note="gene_id=mCG1031084.0"
FT   mRNA            join(<6918697..6918747,6919293..>6919802)
FT                   /locus_tag="mCG_1031084"
FT                   /product="mCG1031084"
FT                   /note="gene_id=mCG1031084.0 transcript_id=mCT148788.0
FT                   created on 15-AUG-2002"
FT   assembly_gap    6918976..6918995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <6919591..>6919802
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031084"
FT                   /product="mCG1031084"
FT                   /note="gene_id=mCG1031084.0 transcript_id=mCT148788.0
FT                   protein_id=mCP69792.0"
FT                   /protein_id="EDL14133.1"
FT                   /translation="YSLTMYVCDIYIYIYIYTYILFYIYIEREKKKEREEGRKEGRKEG
FT                   RKEGRKKERKKERKKERKKERKKEN"
FT   assembly_gap    6934600..6935640
FT                   /estimated_length=1041
FT                   /gap_type="unknown"
FT   assembly_gap    6940124..6940143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6941132..6941750
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   assembly_gap    6950965..6951015
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    6960044..6960258
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   gene            complement(6976765..6978945)
FT                   /pseudo
FT                   /gene="Rgag4"
FT                   /locus_tag="mCG_50018"
FT                   /note="gene_id=mCG50018.2"
FT   mRNA            complement(6976765..6978945)
FT                   /pseudo
FT                   /gene="Rgag4"
FT                   /locus_tag="mCG_50018"
FT                   /note="gene_id=mCG50018.2 transcript_id=mCT50201.2 created
FT                   on 13-AUG-2002"
FT   assembly_gap    6983132..6983251
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   gene            6986409..6991515
FT                   /locus_tag="mCG_56028"
FT                   /note="gene_id=mCG56028.2"
FT   mRNA            join(6986409..6987930,6989822..6989954,6990739..6990842,
FT                   6990864..6991515)
FT                   /locus_tag="mCG_56028"
FT                   /product="mCG56028"
FT                   /note="gene_id=mCG56028.2 transcript_id=mCT56211.2 created
FT                   on 13-AUG-2002"
FT   CDS             join(6986436..6987930,6989822..6989954,6990739..6990842,
FT                   6990864..6991060)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56028"
FT                   /product="mCG56028"
FT                   /note="gene_id=mCG56028.2 transcript_id=mCT56211.2
FT                   protein_id=mCP35578.1"
FT                   /protein_id="EDL14132.1"
FT                   /translation="MRSVSLVKDEPALPPEGELVLPKDQRPRSLCLSLEHQGHHPPHPD
FT                   AQGHPAVPMLKDPGSTQFSHHWYLTDWKSGDTYQSLSSSSTATGTTVIECTQVQGSSES
FT                   LASPSTSRATTPSQLSIEVEAREVASPGRPTGLMSPSSGYSSQSETPTPTVSMSLTLGH
FT                   LPPPSASVRVRPVVPERKSSLPPTSPMEKICKSRLSFDLPLTSSTTLDLSGMSISIRSK
FT                   TKVSRHHSDTNFGVKLAQKTSPNQPIMPMVTQSDLRSVRLRSVSKSEPEDDIESPDYIE
FT                   EPGAEEVFTMPERKVKPPIAEKPPLARRPPSLVHRPPSLPGEYPLTSPTMAMASRSSIP
FT                   HMKQLPQDSYTVLRKPKSPSFPGESTASSSLVLSPLASSSGAFFSGTQQPPQASVEDGG
FT                   PKVRALPERIGLQSQEEAEKKMTKIPPPVPKKPSVLYLPLTSPVAQMDACMAEPRLPFS
FT                   PIITLEEDGKCPSTGDDQKSPGKGVTSPLHTDTEKEAISPGRSVEPSAEEKSLISDKTA
FT                   EWIAEEEDDVFVASRTTEDLFTVIHRSKRKLLGWKETGEGFTGSKPSSHSPVKNTADSP
FT                   TGPSSSACLDAGRNDDFKALLQKKGSKATPRTRPSAAELLKTTNPLARRIIAQFSKDYE
FT                   PTDNPST"
FT   gene            complement(6991553..>6992772)
FT                   /locus_tag="mCG_1031082"
FT                   /note="gene_id=mCG1031082.1"
FT   mRNA            complement(6991553..>6992772)
FT                   /locus_tag="mCG_1031082"
FT                   /product="mCG1031082"
FT                   /note="gene_id=mCG1031082.1 transcript_id=mCT148786.1
FT                   created on 15-AUG-2002"
FT   CDS             complement(6992294..>6992719)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031082"
FT                   /product="mCG1031082"
FT                   /note="gene_id=mCG1031082.1 transcript_id=mCT148786.1
FT                   protein_id=mCP69786.1"
FT                   /protein_id="EDL14131.1"
FT                   /translation="NSELDQPNQGFQPKASMPGARVFSALSGVLFQFQPCCLAGVWAVE
FT                   LRACFSLIRIVKMEICLFLASCCILQESEQGIWKGRSAVGRGTGGRVQGTVFCCLFAFA
FT                   KHDTSSFPFGPLGTRRPRAFQHRQARFLCSVFCPSYP"
FT   gene            complement(6993842..>7000005)
FT                   /locus_tag="mCG_1031080"
FT                   /note="gene_id=mCG1031080.1"
FT   mRNA            complement(join(6993842..6994688,6997540..6997645,
FT                   6999145..>7000005))
FT                   /locus_tag="mCG_1031080"
FT                   /product="mCG1031080"
FT                   /note="gene_id=mCG1031080.1 transcript_id=mCT148784.1
FT                   created on 15-AUG-2002"
FT   CDS             complement(6994003..>6994377)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031080"
FT                   /product="mCG1031080"
FT                   /note="gene_id=mCG1031080.1 transcript_id=mCT148784.1
FT                   protein_id=mCP69997.1"
FT                   /protein_id="EDL14130.1"
FT                   /translation="SFFFFFLTGSKVRRRGVDRCMGRSAQSDKVRRQLDLGCLDKVDVR
FT                   QNACWQNLNLGVMKLTGMDWLPMALTPLWLSCWYQCSSRVLGLEDKLEAHAGQEYRQRG
FT                   GATSKVSLCTKTSLLSTTHI"
FT   assembly_gap    6997835..6998384
FT                   /estimated_length=550
FT                   /gap_type="unknown"
FT   assembly_gap    7006654..7007285
FT                   /estimated_length=632
FT                   /gap_type="unknown"
FT   assembly_gap    7009892..7009933
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    7014037..7014056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7023403..7023422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7027506..7035711
FT                   /locus_tag="mCG_116634"
FT                   /note="gene_id=mCG116634.0"
FT   mRNA            join(7027506..7027637,7029824..7029897,7035054..7035173,
FT                   7035530..7035711)
FT                   /locus_tag="mCG_116634"
FT                   /product="mCG116634"
FT                   /note="gene_id=mCG116634.0 transcript_id=mCT117758.1
FT                   created on 12-AUG-2002"
FT   CDS             join(7027595..7027637,7029824..7029897,7035054..7035173,
FT                   7035530..7035688)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116634"
FT                   /product="mCG116634"
FT                   /note="gene_id=mCG116634.0 transcript_id=mCT117758.1
FT                   protein_id=mCP69994.1"
FT                   /db_xref="GOA:Q9CWW6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="MGI:MGI:1916963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CWW6"
FT                   /protein_id="EDL14129.1"
FT                   /translation="MPPKGKSGSGKGGKGGAASGSDSADKKSQGPKGGGNAVKVRHILC
FT                   EKHGKIMEAMEKLKSGMRFSEVATQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVS
FT                   GMDKPVFTDPPVKTKFGYHIIMVEGRK"
FT   assembly_gap    7027863..7028151
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    7031812..7031905
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   gene            7046519..7047761
FT                   /pseudo
FT                   /locus_tag="mCG_2898"
FT                   /note="gene_id=mCG2898.2"
FT   mRNA            7046519..7047761
FT                   /pseudo
FT                   /locus_tag="mCG_2898"
FT                   /note="gene_id=mCG2898.2 transcript_id=mCT2464.2 created on
FT                   12-AUG-2002"
FT   assembly_gap    7050370..7050571
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   gene            complement(7051128..>7055002)
FT                   /locus_tag="mCG_2900"
FT                   /note="gene_id=mCG2900.2"
FT   mRNA            complement(7051128..>7055002)
FT                   /locus_tag="mCG_2900"
FT                   /product="mCG2900"
FT                   /note="gene_id=mCG2900.2 transcript_id=mCT2466.2 created on
FT                   12-AUG-2002"
FT   CDS             complement(7051348..>7055001)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2900"
FT                   /product="mCG2900"
FT                   /note="gene_id=mCG2900.2 transcript_id=mCT2466.2
FT                   protein_id=mCP14494.2"
FT                   /protein_id="EDL14128.1"
FT                   /translation="YVQEAKEAAKNGDLEESLKLFNLAKDIFPTKKVMSRIQKLQEALE
FT                   QLAEEEDDDEFIDVCSSGLLLYRELYEKLFEHQKEGIAFLYSLYKDGRKGGILADDMGL
FT                   GKTVQIIAFLSGMFDASLVNHVLLIMPTNLINTWVNEFAKWTPGMRVKTFHGSSKSERT
FT                   RSLTRIQQRNGVVITTYQMLLNNWQQLASFNGQAFVWDYVILDEAHKIKSASTKSAVCA
FT                   RAIPASNRLLLTGTPVQNNLQELWSLFDFACQGSLLGTLKTFKMEYEHPIIRAREKDAT
FT                   PGEKALGLKISENLMEIIKPYFLRRTKEEVQTKKADNPEARLGEKNPAGEAICDMFSLA
FT                   RKNDLIVWIRLLPLQEEIYRKFVSLDHIKELLMETRSPLAELGVLKKLCDHPRLLSARA
FT                   CRLLNLGTATFSAQDENEQEDVSNMNSIDHLPDKTLIQESGKMIFLMSLLERLQDEGHQ
FT                   TLVFSQSIKILNIIERLLKNKHFKTLRIDGTVTHLWEREKRIQLFQQNKEYSVFLLTTQ
FT                   VGGVGLTLTAATRVVIFDPSWNPATDAQAVDRVYRIGQKENVVVYRLITCGTVEEKIYR
FT                   RQVFKDSLIRQTTGEKKNPFRYFTKQELKELFTVGDLQKSATQMQLQCLHAAQRRSDEK
FT                   LDEHIAYLHLLGIAGISDHDLMFTRDLSVKEELDMLEDSQYIHQRVQKAQFLVESESQN
FT                   TVQRQTTGIEETWLKAQEFPSQQKKKGTEFNKPQPQPSRLLTKPTQVEAISSQMASITI
FT                   CDQSAESEPQEHSEVHDVTSLQGSHHFNSTSDAGTIASLPQGAESIGEVSTDSLLSPAK
FT                   GFAAENDAMQKKGLQASPGQEAPSENLGSFHYLPRESSKASLGPNLDLQDSVVLYHRSP
FT                   TANENQNLESDVPMIEISDDLSEPPSALQGAQAIEAQLELKEDDPLKSPPQYACDFNLF
FT                   LEDSADTRQNLSSKFLEHVEKEKSLQSPAANSRAKSALTLSLDSSPKSDEESEVISVKT
FT                   KSKTRRILSDDEDEDEEDAFKGSHTNSINISPFPFSSVKQFDASTPQSGSNPSRRFFSP
FT                   KTPGEVNTSLHSRRSLASRRSLINVVLDDVEDMEERLDNSSEEESEPGLSEENNEEEAL
FT                   ACTEEQPSGATLASGNKSSNLTMSEPTSPAPQSSPCAPEPSSSDPMPDPPQDLAVEAGN
FT                   DYESLVARGKELKECGKIQEALNCLVKALDIKSADPEVMLMTLSLYKQLNI"
FT   assembly_gap    7060231..7060250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7062667..7062686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7067927..7068924
FT                   /estimated_length=998
FT                   /gap_type="unknown"
FT   assembly_gap    7070753..7070772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7084871..7084890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7085829..7086253
FT                   /estimated_length=425
FT                   /gap_type="unknown"
FT   gene            complement(7093180..7097536)
FT                   /locus_tag="mCG_116623"
FT                   /note="gene_id=mCG116623.1"
FT   mRNA            complement(join(7093180..7093368,7093740..7093897,
FT                   7094634..7094805,7095593..7095690,7096060..7096240,
FT                   7096465..7096542,7097469..7097536))
FT                   /locus_tag="mCG_116623"
FT                   /product="mCG116623"
FT                   /note="gene_id=mCG116623.1 transcript_id=mCT117747.1
FT                   created on 12-AUG-2002"
FT   CDS             complement(join(7093267..7093368,7093740..7093897,
FT                   7094634..7094805,7095593..7095690,7096060..7096240,
FT                   7096465..7096542,7097469..7097471))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116623"
FT                   /product="mCG116623"
FT                   /note="gene_id=mCG116623.1 transcript_id=mCT117747.1
FT                   protein_id=mCP70006.1"
FT                   /db_xref="GOA:Q545X8"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="InterPro:IPR032277"
FT                   /db_xref="MGI:MGI:98158"
FT                   /db_xref="UniProtKB/TrEMBL:Q545X8"
FT                   /protein_id="EDL14127.1"
FT                   /translation="MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLI
FT                   IFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENFRLIYD
FT                   TKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQID
FT                   LETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVKDANGNSFATRL
FT                   SNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG"
FT   assembly_gap    7096298..7096317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7098864..7100951
FT                   /estimated_length=2088
FT                   /gap_type="unknown"
FT   assembly_gap    7102940..7103266
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    7106159..7106208
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    7109434..7109453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7112040..7112059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7116021..7116447
FT                   /pseudo
FT                   /locus_tag="mCG_1030934"
FT                   /note="gene_id=mCG1030934.1"
FT   mRNA            7116021..7116447
FT                   /pseudo
FT                   /locus_tag="mCG_1030934"
FT                   /note="gene_id=mCG1030934.1 transcript_id=mCT148638.1
FT                   created on 20-AUG-2002"
FT   assembly_gap    7117413..7117528
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    7118287..7119209
FT                   /estimated_length=923
FT                   /gap_type="unknown"
FT   assembly_gap    7122292..7122386
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    7125494..7125513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7133301..7133320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7134613..7134632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7136118..7136137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7143766..7143785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7154621..7159405)
FT                   /gene="Cited1"
FT                   /locus_tag="mCG_21574"
FT                   /note="gene_id=mCG21574.2"
FT   mRNA            complement(join(7154621..7155250,7155805..7155929,
FT                   7159276..7159405))
FT                   /gene="Cited1"
FT                   /locus_tag="mCG_21574"
FT                   /product="Cbp/p300-interacting transactivator with
FT                   Glu/Asp-rich carboxy-terminal domain 1, transcript variant
FT                   mCT19451"
FT                   /note="gene_id=mCG21574.2 transcript_id=mCT19451.2 created
FT                   on 07-AUG-2002"
FT   mRNA            complement(join(7154685..7155250,7155805..7155929,
FT                   7158735..>7159011))
FT                   /gene="Cited1"
FT                   /locus_tag="mCG_21574"
FT                   /product="Cbp/p300-interacting transactivator with
FT                   Glu/Asp-rich carboxy-terminal domain 1, transcript variant
FT                   mCT190748"
FT                   /note="gene_id=mCG21574.2 transcript_id=mCT190748.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(7154699..7155250,7155805..7155929,
FT                   7158735..>7158840))
FT                   /codon_start=1
FT                   /gene="Cited1"
FT                   /locus_tag="mCG_21574"
FT                   /product="Cbp/p300-interacting transactivator with
FT                   Glu/Asp-rich carboxy-terminal domain 1, isoform CRA_a"
FT                   /note="gene_id=mCG21574.2 transcript_id=mCT190748.0
FT                   protein_id=mCP111718.0 isoform=CRA_a"
FT                   /protein_id="EDL14125.1"
FT                   /translation="RRRRQCACQGGSGLGRFVRTSAPVSFPLPGKQLRGDQQAQLAAST
FT                   ATDLSDFCPGSEMPTMSRPALDVKGGTTSGKEDANQEMNSLAYSNLGVKDRKAVTVLHY
FT                   PGVTANGAKANGVPTSSSGSTSPIGSPTATPSSKPPSFNLHPTPHLMASMQLQKLNSQY
FT                   QGAAATAAAALTGAGLPGEEEPMQNWVTAPLVVGGSPGSVSPPAGAQSPALIDSDPVDE
FT                   EVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSGC"
FT   CDS             complement(join(7154699..7155250,7155805..7155864))
FT                   /codon_start=1
FT                   /gene="Cited1"
FT                   /locus_tag="mCG_21574"
FT                   /product="Cbp/p300-interacting transactivator with
FT                   Glu/Asp-rich carboxy-terminal domain 1, isoform CRA_b"
FT                   /note="gene_id=mCG21574.2 transcript_id=mCT19451.2
FT                   protein_id=mCP20824.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UGA1"
FT                   /db_xref="InterPro:IPR007576"
FT                   /db_xref="MGI:MGI:108023"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UGA1"
FT                   /protein_id="EDL14126.1"
FT                   /translation="MPTMSRPALDVKGGTTSGKEDANQEMNSLAYSNLGVKDRKAVTVL
FT                   HYPGVTANGAKANGVPTSSSGSTSPIGSPTATPSSKPPSFNLHPTPHLMASMQLQKLNS
FT                   QYQGAAATAAAALTGAGLPGEEEPMQNWVTAPLVVGGSPGSVSPPAGAQSPALIDSDPV
FT                   DEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSGC"
FT   gene            <7159892..7164928
FT                   /locus_tag="mCG_144647"
FT                   /note="gene_id=mCG144647.0"
FT   mRNA            join(<7159892..7160266,7160722..7160855,7163679..7164928)
FT                   /locus_tag="mCG_144647"
FT                   /product="mCG144647"
FT                   /note="gene_id=mCG144647.0 transcript_id=mCT184071.0
FT                   created on 05-JUN-2003"
FT   CDS             <7159893..7160234
FT                   /codon_start=1
FT                   /locus_tag="mCG_144647"
FT                   /product="mCG144647"
FT                   /note="gene_id=mCG144647.0 transcript_id=mCT184071.0
FT                   protein_id=mCP106213.0"
FT                   /protein_id="EDL14124.1"
FT                   /translation="SFLQGFLRAGLLFLSYVFSSWNGRGWRVPYPLNSLHFVQGHLERS
FT                   YGSGGFPQGPRLVSRLSVLWSSRAEGGWQDATTLGNAVLPDRGARCMHATHMAHGKAKN
FT                   RQRVRKDCH"
FT   assembly_gap    7172142..7172277
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    7175783..7175802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7177414..7177433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7178989..7179151
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    7184958..7185309
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    7187018..7189660
FT                   /estimated_length=2643
FT                   /gap_type="unknown"
FT   assembly_gap    7190317..7190350
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   gene            complement(7192011..7412454)
FT                   /gene="Hdac8"
FT                   /locus_tag="mCG_116632"
FT                   /note="gene_id=mCG116632.0"
FT   mRNA            complement(join(7192011..7192539,7215131..7215236,
FT                   7310235..7310329,7313075..7313247,7335802..7335909,
FT                   7336447..7336528,7340172..7340284,7405201..7405342,
FT                   7406892..7407022,7411469..7411521,7412024..7412372,
FT                   7412395..7412454))
FT                   /gene="Hdac8"
FT                   /locus_tag="mCG_116632"
FT                   /product="histone deacetylase 8, transcript variant
FT                   mCT117756"
FT                   /note="gene_id=mCG116632.0 transcript_id=mCT117756.1
FT                   created on 23-AUG-2002"
FT   mRNA            complement(join(7192011..7192539,7215131..7215236,
FT                   7310235..7310329,7313075..7313247,7335802..7335910,
FT                   7336451..7336528,7340172..7340284,7405201..7405342,
FT                   7406892..7407022,7411469..7411521,7412024..>7412220))
FT                   /gene="Hdac8"
FT                   /locus_tag="mCG_116632"
FT                   /product="histone deacetylase 8, transcript variant
FT                   mCT190760"
FT                   /note="gene_id=mCG116632.0 transcript_id=mCT190760.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(7192517..7192539,7215131..7215236,
FT                   7310235..7310329,7313075..7313247,7335802..7335910,
FT                   7336451..7336528,7340172..7340284,7405201..7405342,
FT                   7406892..7407022,7411469..7411521,7412024..>7412218))
FT                   /codon_start=1
FT                   /gene="Hdac8"
FT                   /locus_tag="mCG_116632"
FT                   /product="histone deacetylase 8, isoform CRA_b"
FT                   /note="gene_id=mCG116632.0 transcript_id=mCT190760.0
FT                   protein_id=mCP111704.0 isoform=CRA_b"
FT                   /protein_id="EDL14121.1"
FT                   /translation="TEEQELELRLSLKTVGSRLWLADGWKWEMEMPEEPANSGHSLPPV
FT                   YIYSPEYVSICDSLVKVPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYL
FT                   QHLQKVSQEGDEDHPDSIEYGLGYDCPATEGIFDYAAAIGGGTITAAQCLIDGKCKVAI
FT                   NWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFDRILYVDLDLHHGDGVEDAFSFTSK
FT                   VMTVSLHKFSPGFFPGTGDMSDVGLGKGRYYSVNVPIQDGIQDEKYYHICESVLKEVYQ
FT                   AFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYVLQWQLATLILGGGGYNLANTA
FT                   RCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKG
FT                   NLKHVV"
FT   CDS             complement(join(7192517..7192539,7215131..7215236,
FT                   7310235..7310329,7313075..7313247,7335802..7335909,
FT                   7336447..7336528,7340172..7340284,7405201..7405342,
FT                   7406892..7407022,7411469..7411521,7412024..7412134))
FT                   /codon_start=1
FT                   /gene="Hdac8"
FT                   /locus_tag="mCG_116632"
FT                   /product="histone deacetylase 8, isoform CRA_a"
FT                   /note="gene_id=mCG116632.0 transcript_id=mCT117756.1
FT                   protein_id=mCP69833.1 isoform=CRA_a"
FT                   /protein_id="EDL14120.1"
FT                   /translation="MEMPEEPANSGHSLPPVYIYSPEYVSICDSLVKVPKRASMVHSLI
FT                   EAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDEDHPDSIEYGLGYDCPA
FT                   TEGIFDYAAAIGGGTITAAQCLIDGKCKVAINWSGGWHHAKKDEASGFCYLNDAVLGIL
FT                   RLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGKTGDMSDVGLGK
FT                   GRYYSVNVPIQDGIQDEKYYHICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMT
FT                   PVGIGKCLKYVLQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTA
FT                   YGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV"
FT   assembly_gap    7199677..7199700
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    7200874..7201451
FT                   /estimated_length=578
FT                   /gap_type="unknown"
FT   assembly_gap    7203946..7204093
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    7205752..7205943
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    7216608..7216692
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    7233673..7233840
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    7243872..7243891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7274918..7275327
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    7276550..7276569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7282891..7282910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7286092..7286111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7287601..7288252
FT                   /estimated_length=652
FT                   /gap_type="unknown"
FT   assembly_gap    7289831..7289850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7296884..7297116
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    7308140..7308159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7311590..7311609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7315618..7315648
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    7322183..7322423
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    7330169..7330213
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    7345487..7345506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7348942..7348961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7355123..7355400
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    7361685..7361704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7364169..7364188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7369404..7369423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7372200..7373027
FT                   /estimated_length=828
FT                   /gap_type="unknown"
FT   assembly_gap    7382064..7382177
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    7385909..7385928
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <7392593..>7409212
FT                   /locus_tag="mCG_1241"
FT                   /note="gene_id=mCG1241.1"
FT   mRNA            join(<7392593..7392672,7407956..7408042,7409120..>7409212)
FT                   /locus_tag="mCG_1241"
FT                   /product="mCG1241"
FT                   /note="gene_id=mCG1241.1 transcript_id=mCT8452.1 created on
FT                   12-AUG-2002"
FT   CDS             join(<7392621..7392672,7407956..7408042,7409120..>7409212)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1241"
FT                   /product="mCG1241"
FT                   /note="gene_id=mCG1241.1 transcript_id=mCT8452.1
FT                   protein_id=mCP14715.1"
FT                   /protein_id="EDL14122.1"
FT                   /translation="CGWLGIQISFSCSYLHVGSVAIKQSEFGARELDSFSNSRLPTSIT
FT                   SVISQRKERRRKSLDPLNQLLTIKDKRNKNKG"
FT   gene            complement(7400542..7402810)
FT                   /locus_tag="mCG_147483"
FT                   /note="gene_id=mCG147483.0"
FT   mRNA            complement(join(7400542..7401551,7401582..7402810))
FT                   /locus_tag="mCG_147483"
FT                   /product="mCG147483"
FT                   /note="gene_id=mCG147483.0 transcript_id=mCT187746.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7400859..7401113)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147483"
FT                   /product="mCG147483"
FT                   /note="gene_id=mCG147483.0 transcript_id=mCT187746.0
FT                   protein_id=mCP108723.0"
FT                   /protein_id="EDL14123.1"
FT                   /translation="MQCRGSTPGLPTYCVSSPPPEPSPKVLVLEIEHRASCMLGKCSIT
FT                   ELHSQLGISSLYALKSICTYKVISLDWVHCSILSMHLVI"
FT   assembly_gap    7401557..7401577
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    7402811..7402830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7412375..7412394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7419827..7420669
FT                   /estimated_length=843
FT                   /gap_type="unknown"
FT   gene            complement(7423267..>7551201)
FT                   /gene="Phka1"
FT                   /locus_tag="mCG_116624"
FT                   /note="gene_id=mCG116624.0"
FT   mRNA            complement(join(7423267..7423627,7424189..7424389,
FT                   7428137..7428307,7435505..7435555,7439516..7439554,
FT                   7439842..7439957,7444664..7444765,7448596..7448725,
FT                   7448856..7448934,7452158..7452237,7452792..7452948,
FT                   7462369..7462510,7464231..7464407,7466701..7466870,
FT                   7476573..7476651,7480751..7480895,7482248..7482357,
FT                   7492972..7493106,7499626..7499704,7504427..7504534,
FT                   7505211..7505306,7516287..7516409,7517397..7517450,
FT                   7523156..7523302,7524562..7524660,7528587..7528667,
FT                   7532842..7532924,7543681..7543849,7546219..7546266,
FT                   7549280..7549438,7550906..>7551201))
FT                   /gene="Phka1"
FT                   /locus_tag="mCG_116624"
FT                   /product="phosphorylase kinase alpha 1"
FT                   /note="gene_id=mCG116624.0 transcript_id=mCT117748.0
FT                   created on 07-AUG-2002"
FT   CDS             complement(join(7423454..7423627,7424189..7424389,
FT                   7428137..7428307,7435505..7435555,7439516..7439554,
FT                   7439842..7439957,7444664..7444765,7448596..7448725,
FT                   7448856..7448934,7452158..7452237,7452792..7452948,
FT                   7462369..7462510,7464231..7464407,7466701..7466870,
FT                   7476573..7476651,7480751..7480895,7482248..7482357,
FT                   7492972..7493106,7499626..7499704,7504427..7504534,
FT                   7505211..7505306,7516287..7516409,7517397..7517450,
FT                   7523156..7523302,7524562..7524660,7528587..7528667,
FT                   7532842..7532924,7543681..7543849,7546219..7546266,
FT                   7549280..7549438,7550906..>7550995))
FT                   /codon_start=1
FT                   /gene="Phka1"
FT                   /locus_tag="mCG_116624"
FT                   /product="phosphorylase kinase alpha 1"
FT                   /note="gene_id=mCG116624.0 transcript_id=mCT117748.0
FT                   protein_id=mCP70009.0"
FT                   /protein_id="EDL14119.1"
FT                   /translation="GRGTMRSRSNSGVRLDGYARLVHQTILCHQNPVTGLLPASYDQKD
FT                   AWVRDNVYSILAVWGLGLAYRKNADRDEDKAKAYELEQSVVKLMRGLLHCMIRQVDKVE
FT                   SFKYSQSTKDSLHAKYNTKTCATVVGDDQWGHLQLDATSVYLLFLAQMTASGLHIIHSL
FT                   DEVNFIQNLVFYIEAAYKTADFGIWERGDKTNQGISELNASSVGMAKAALEALDELDLF
FT                   GVKGGPQSVIHVLADEVQHCQSILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSHLVE
FT                   LTKQEIITKLQGRYGCCRFLRDGYKTPKEDPNRLYYEPAELKLFENIECEWPLFWTYFI
FT                   LDGIFSGNVEQVQEYREALDAVLIKGKNGVPLLPELYSVPPDRVDEEYQNPHTVDRVPM
FT                   GKLPHMWGQSLYILGSLMAEGFLAPGEIDPLNRRFSTVPKPDVVVQVSILAETEEIKAI
FT                   LKDKGIDVETIAEVYPIRVQPARILSHIYSSLGCNSRMKLSGRPYRLMGVLGTSKLYDI
FT                   RKTIFTFTPQFIDQQQFYLALDNQMIVEMLRTDLSYLCSRWRMTGQPTITFPISHTMLD
FT                   EDGTSLNSSILAALRKMQDGYFGGARIQTGKLSEFLTTSCCTHLSFMDPGPEGKLYSED
FT                   YDEDYEDDLDSGNWMDSYDSTSNARCGDEVARYLDRLLAHTVPHPKLAPTSRKGGLDRF
FT                   RAAVQTTCDLMSLVAKAKELHIQKVPSVHVEVHLPRDQSGEVDFQSLVSQLKETSSLQE
FT                   QADILYMLYSMKGPDWNTELYEEGGATVRELLSELYVKVGEIRHWGLIRYISGILRKKV
FT                   EALDEACTDLLSYQKHLTVGLPPEPREKTISAPLPYEALTKLIDEASEGDMSISTLTQE
FT                   IMVYLAMYMRTQPGLFAEMFRLRIGLIIQVMATELAHSLRCSAEEATEGLMNLSPSAMK
FT                   NLLHHILSGKEFGVERSVRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQVEF
FT                   RRLSVSMESQTSGGHPSGVDLMSPSFLSPAACIAASSGSFPTVCDHQTSKDSRQGQWQR
FT                   RRRLDGALNRVPIGFYQKVWKILQKMTPGEIKFSVHVESVLNRVPQPEYRQLLVEAILV
FT                   LTMLADIEIHSIGSIIAVEKIVHIANDLFLQEQKTLGADDTMLAKDPASGICTLLYDSA
FT                   PSGRFGTMTYLSKAAATYVQEFLPHSLCAMQ"
FT   assembly_gap    7424872..7424891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7434064..7434095
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    7443706..7443747
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    7462909..7463048
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    7467144..7467652
FT                   /estimated_length=509
FT                   /gap_type="unknown"
FT   assembly_gap    7468691..7470702
FT                   /estimated_length=2012
FT                   /gap_type="unknown"
FT   assembly_gap    7490379..7491096
FT                   /estimated_length=718
FT                   /gap_type="unknown"
FT   assembly_gap    7492290..7492315
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    7494904..7495005
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    7502966..7503149
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    7514221..7514568
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    7530507..7530593
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    7536356..7536375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7542600..7542619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7548622..7548917
FT                   /estimated_length=296
FT                   /gap_type="unknown"
FT   assembly_gap    7555553..7555572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7562699..7564390
FT                   /pseudo
FT                   /locus_tag="mCG_49312"
FT                   /note="gene_id=mCG49312.2"
FT   mRNA            7562699..7564390
FT                   /pseudo
FT                   /locus_tag="mCG_49312"
FT                   /note="gene_id=mCG49312.2 transcript_id=mCT49495.2 created
FT                   on 12-AUG-2002"
FT   gene            complement(7564816..7565408)
FT                   /pseudo
FT                   /locus_tag="mCG_1030987"
FT                   /note="gene_id=mCG1030987.1"
FT   mRNA            complement(7564816..7565408)
FT                   /pseudo
FT                   /locus_tag="mCG_1030987"
FT                   /note="gene_id=mCG1030987.1 transcript_id=mCT148691.1
FT                   created on 16-AUG-2002"
FT   assembly_gap    7568328..7568782
FT                   /estimated_length=455
FT                   /gap_type="unknown"
FT   assembly_gap    7596505..7598708
FT                   /estimated_length=2204
FT                   /gap_type="unknown"
FT   assembly_gap    7599747..7599766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7603641..7603681
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    7605435..7605498
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    7607668..7607838
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    7612601..7615024
FT                   /estimated_length=2424
FT                   /gap_type="unknown"
FT   assembly_gap    7616635..7616654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7625059..7625086
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    7627491..7627824
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    7629479..7629830
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   gene            complement(7630255..7632669)
FT                   /pseudo
FT                   /locus_tag="mCG_116625"
FT                   /note="gene_id=mCG116625.1"
FT   mRNA            complement(join(7630255..7631895,7632001..7632669))
FT                   /pseudo
FT                   /locus_tag="mCG_116625"
FT                   /note="gene_id=mCG116625.1 transcript_id=mCT117749.1
FT                   created on 12-AUG-2002"
FT   assembly_gap    7631896..7632000
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    7634767..7634786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7636042..7637990
FT                   /estimated_length=1949
FT                   /gap_type="unknown"
FT   gene            7640987..7705165
FT                   /locus_tag="mCG_1031076"
FT                   /note="gene_id=mCG1031076.1"
FT   mRNA            join(7640987..7641124,7642195..7642348,7642651..7642709,
FT                   7643077..7643222,7644453..7644519,7644705..7644915,
FT                   7676738..7676796,7677097..7677233,7678060..7678195,
FT                   7678304..7678481,7693554..7693612,7693979..7694115,
FT                   7702318..7702384,7705020..7705165)
FT                   /locus_tag="mCG_1031076"
FT                   /product="mCG1031076"
FT                   /note="gene_id=mCG1031076.1 transcript_id=mCT148780.1
FT                   created on 15-AUG-2002"
FT   CDS             join(7642285..7642348,7642651..7642709,7643077..7643222,
FT                   7644453..7644519,7644705..7644915,7676738..7676796,
FT                   7677097..7677233,7678060..7678195,7678304..7678481,
FT                   7693554..7693612,7693979..7694115,7702318..7702384,
FT                   7705020..7705157)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031076"
FT                   /product="mCG1031076"
FT                   /note="gene_id=mCG1031076.1 transcript_id=mCT148780.1
FT                   protein_id=mCP69975.0"
FT                   /protein_id="EDL14118.1"
FT                   /translation="MADASSTPMSAQQCPPSSAVMDQHLYPLDQPEVLLHTDPQQGIFQ
FT                   VPQVPLMLSLPTTVINMSCIPVILNFQMIPSFPWSPSQPMAIPCLFPNVIMHPSTNTAT
FT                   PVMLAQVLHPATANQVPVIWAQSNTFNQVPEVYTQGPVTSTQGSSSAEEHRQKVMDAAE
FT                   ALLILHNSQEALQETSTTPDWKESTVHKHETRPPKTPREGSSQDTLMRSKPQEPSVLPY
FT                   APVTQQQQSVISYSAKNLGPIARPKRYSSVIVQNCAVPEPLLLQPQVLTKWWDPGPLEG
FT                   MSLVDGTNRKLGVPDATKQDSVFAAIEWKRKLEFAEALMALRNSPLPPPVSASPKRRGK
FT                   MTNTYLPGHGTQDQHLYPLDQPEVLLHTGPQQGIFQGPLMLSLPTPVINISCIPVTLNL
FT                   QMTHSFSWNPRQPMTIPCLFPNVIMQPSTSTAAPVVLAQVLKRESQATRVESENIKGKT
FT                   AGMTGTQTWKTFTTENRDVRCSSLSRA"
FT   assembly_gap    7647348..7652933
FT                   /estimated_length=5586
FT                   /gap_type="unknown"
FT   assembly_gap    7655661..7663439
FT                   /estimated_length=7779
FT                   /gap_type="unknown"
FT   assembly_gap    7668255..7669790
FT                   /estimated_length=1536
FT                   /gap_type="unknown"
FT   assembly_gap    7675051..7675140
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    7682163..7682182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7683606..7688039
FT                   /estimated_length=4434
FT                   /gap_type="unknown"
FT   assembly_gap    7694366..7694385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7695164..7695630
FT                   /estimated_length=467
FT                   /gap_type="unknown"
FT   assembly_gap    7696983..7697002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7698282..7698673
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    7700510..7701398
FT                   /estimated_length=889
FT                   /gap_type="unknown"
FT   assembly_gap    7702603..7702622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7704582..7704601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7705793..7705812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7706831..7755276
FT                   /estimated_length=48446
FT                   /gap_type="unknown"
FT   gene            complement(7755759..7762165)
FT                   /locus_tag="mCG_116637"
FT                   /note="gene_id=mCG116637.0"
FT   mRNA            complement(join(7755759..7756328,7757317..7757548,
FT                   7757713..7757779,7759952..7760088,7760463..7760521,
FT                   7760824..7760977,7762023..7762165))
FT                   /locus_tag="mCG_116637"
FT                   /product="mCG116637"
FT                   /note="gene_id=mCG116637.0 transcript_id=mCT117761.1
FT                   created on 12-AUG-2002"
FT   CDS             complement(join(7756312..7756328,7757317..7757548,
FT                   7757713..7757779,7759952..7760088,7760463..7760521,
FT                   7760824..7760887))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116637"
FT                   /product="mCG116637"
FT                   /note="gene_id=mCG116637.0 transcript_id=mCT117761.1
FT                   protein_id=mCP70004.1"
FT                   /db_xref="GOA:B1AX30"
FT                   /db_xref="MGI:MGI:1920550"
FT                   /db_xref="UniProtKB/TrEMBL:B1AX30"
FT                   /protein_id="EDL14117.1"
FT                   /translation="MADAFSTPMSALQCPPSSAVMDQHLYPLDQPEDLLHTGPQQGILQ
FT                   VPLMLSLPTPVINMSCIPVTLNLQMTPSFSWNPSQPMTIPCLFPNMIMQPSTSTAAPVK
FT                   LAQVLDSNISSQHPTTANQVPVIWAQNNTFNQVPEVYTQGPVVSTQGSSSAEEHRQKVM
FT                   DAAEALLILHNSREALQETSTTPGPDGE"
FT   assembly_gap    7758580..7759676
FT                   /estimated_length=1097
FT                   /gap_type="unknown"
FT   assembly_gap    7767673..7768949
FT                   /estimated_length=1277
FT                   /gap_type="unknown"
FT   assembly_gap    7771703..7771722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7774080..7775247
FT                   /estimated_length=1168
FT                   /gap_type="unknown"
FT   assembly_gap    7776283..7776492
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    7777217..7777400
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    7791635..7791654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7798648..7804115)
FT                   /gene="4921520P21Rik"
FT                   /locus_tag="mCG_4998"
FT                   /note="gene_id=mCG4998.1"
FT   mRNA            complement(join(7798648..7799193,7800176..7800305,
FT                   7800409..7800547,7801350..7801486,7801794..7801849,
FT                   7802138..7802295,7804040..7804115))
FT                   /gene="4921520P21Rik"
FT                   /locus_tag="mCG_4998"
FT                   /product="RIKEN cDNA 4921520P21, transcript variant
FT                   mCT4533"
FT                   /note="gene_id=mCG4998.1 transcript_id=mCT4533.1 created on
FT                   12-AUG-2002"
FT   mRNA            complement(join(7798652..7799276,7800176..7800305,
FT                   7800481..7800547,7801350..7801486,7801794..7801849,
FT                   7802138..7802295,7804040..7804114))
FT                   /gene="4921520P21Rik"
FT                   /locus_tag="mCG_4998"
FT                   /product="RIKEN cDNA 4921520P21, transcript variant
FT                   mCT171941"
FT                   /note="gene_id=mCG4998.1 transcript_id=mCT171941.0 created
FT                   on 12-AUG-2002"
FT   CDS             complement(join(7799081..7799193,7800176..7800305,
FT                   7800409..7800547,7801350..7801486,7801794..7801849,
FT                   7802138..7802295,7804040..7804062))
FT                   /codon_start=1
FT                   /gene="4921520P21Rik"
FT                   /locus_tag="mCG_4998"
FT                   /product="RIKEN cDNA 4921520P21, isoform CRA_b"
FT                   /note="gene_id=mCG4998.1 transcript_id=mCT4533.1
FT                   protein_id=mCP9450.2 isoform=CRA_b"
FT                   /protein_id="EDL14116.1"
FT                   /translation="MQRSSGSREPRKDFSPVTTSKKEEATPLKRRLVERHKRTMAAAHP
FT                   SHMHVKKLAVEEGVRTGKNTVQQIQAQVDTATQEESSQGPVLLNQHPETTSVPYTPETV
FT                   GQQLMVSLPGEPHGTSAMPSMCPSLILQPCATTDPMLLQPQVMVKTGIQNKGKQQALWI
FT                   GTLVDQVEGPSASNQASVSATLEWQEMLEAAEALLALKNSSQTRHQPCGMPGTAGERGL
FT                   QLANPSMPPRPTSSGSLPSGHLDCMSLLT"
FT   CDS             complement(join(7799242..7799276,7800176..7800305,
FT                   7800481..7800547,7801350..7801486,7801794..7801849,
FT                   7802138..7802295,7804040..7804062))
FT                   /codon_start=1
FT                   /gene="4921520P21Rik"
FT                   /locus_tag="mCG_4998"
FT                   /product="RIKEN cDNA 4921520P21, isoform CRA_a"
FT                   /note="gene_id=mCG4998.1 transcript_id=mCT171941.0
FT                   protein_id=mCP94860.0 isoform=CRA_a"
FT                   /db_xref="GOA:B1AX34"
FT                   /db_xref="InterPro:IPR026607"
FT                   /db_xref="InterPro:IPR031577"
FT                   /db_xref="MGI:MGI:1918137"
FT                   /db_xref="UniProtKB/TrEMBL:B1AX34"
FT                   /protein_id="EDL14115.1"
FT                   /translation="MQRSSGSREPRKDFSPVTTSKKEEATPLKRRLVERHKRTMAAAHP
FT                   SHMHVKKLAVEEGVRTGKNTVQQIQAQVDTATQEESSQGPVLLNQHPETTSVPYTPETV
FT                   GQQLMVSLPGEPHGTSAMPSMCPSLILQPCATTDPMLLQPQVMGPSASNQASVSATLEW
FT                   QEMLEAAEALLALKNSSQTRHQPCGMPVKRELSGASRM"
FT   gene            <7804329..7805159
FT                   /locus_tag="mCG_61812"
FT                   /note="gene_id=mCG61812.1"
FT   mRNA            join(<7804329..7804398,7804695..7804859,7805008..7805159)
FT                   /locus_tag="mCG_61812"
FT                   /product="mCG61812"
FT                   /note="gene_id=mCG61812.1 transcript_id=mCT61995.1 created
FT                   on 15-AUG-2002"
FT   CDS             join(<7804395..7804398,7804695..7804859,7805008..7805126)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61812"
FT                   /product="mCG61812"
FT                   /note="gene_id=mCG61812.1 transcript_id=mCT61995.1
FT                   protein_id=mCP31625.1"
FT                   /protein_id="EDL14114.1"
FT                   /translation="EECEKHNTLHPGQCDLCSHHGELIPAAQERPGNLLLPQGPGGAAS
FT                   RELWHACPSSSGEDANQPEAETTGILDMGAMHSDQDLRLRRPLLSRNLVQ"
FT   assembly_gap    7804536..7804555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7805304..7805405
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    7806931..7807524
FT                   /estimated_length=594
FT                   /gap_type="unknown"
FT   assembly_gap    7822746..7822765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <7824190..7824921
FT                   /locus_tag="mCG_4999"
FT                   /note="gene_id=mCG4999.0"
FT   mRNA            join(<7824190..7824281,7824471..7824613,7824762..7824921)
FT                   /locus_tag="mCG_4999"
FT                   /product="mCG4999"
FT                   /note="gene_id=mCG4999.0 transcript_id=mCT4534.1 created on
FT                   12-AUG-2002"
FT   CDS             join(<7824192..7824281,7824471..7824613,7824762..7824783)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4999"
FT                   /product="mCG4999"
FT                   /note="gene_id=mCG4999.0 transcript_id=mCT4534.1
FT                   protein_id=mCP9451.1"
FT                   /protein_id="EDL14113.1"
FT                   /translation="ITARSPRSHSSGRDTPGSMIVMHLVGHPQLTGTEGVATAHTKENS
FT                   SRGPRETREPAPCTRSWRSRFQRAVARVSKFFRRRRRST"
FT   assembly_gap    7826505..7827014
FT                   /estimated_length=510
FT                   /gap_type="unknown"
FT   assembly_gap    7827992..7828537
FT                   /estimated_length=546
FT                   /gap_type="unknown"
FT   assembly_gap    7829998..7830615
FT                   /estimated_length=618
FT                   /gap_type="unknown"
FT   assembly_gap    7844592..7844611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7852224..7852249
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    7863362..7863381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7872764..7872783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7874417..7874436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7875190..7875361
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    7881546..7881565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7883170..7883189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7888155..7888677
FT                   /estimated_length=523
FT                   /gap_type="unknown"
FT   assembly_gap    7889744..7889763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7890895..7896209
FT                   /estimated_length=5315
FT                   /gap_type="unknown"
FT   gene            complement(7896678..7897943)
FT                   /pseudo
FT                   /locus_tag="mCG_56905"
FT                   /note="gene_id=mCG56905.2"
FT   mRNA            complement(7896678..7897943)
FT                   /pseudo
FT                   /locus_tag="mCG_56905"
FT                   /note="gene_id=mCG56905.2 transcript_id=mCT57088.2 created
FT                   on 19-AUG-2002"
FT   assembly_gap    7900928..7900947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7905325..7905734
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    7906981..7908319
FT                   /estimated_length=1339
FT                   /gap_type="unknown"
FT   assembly_gap    7909471..7909490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7914960..7915068
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    7917953..7918078
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   gene            complement(7918079..>7920162)
FT                   /locus_tag="mCG_1031072"
FT                   /note="gene_id=mCG1031072.1"
FT   mRNA            complement(join(7918079..7918558,7919475..7919611,
FT                   7919961..>7920156))
FT                   /locus_tag="mCG_1031072"
FT                   /product="mCG1031072, transcript variant mCT148776"
FT                   /note="gene_id=mCG1031072.1 transcript_id=mCT148776.1
FT                   created on 15-AUG-2002"
FT   mRNA            complement(join(7918082..7918558,7919475..7919567,
FT                   7919961..>7920162))
FT                   /locus_tag="mCG_1031072"
FT                   /product="mCG1031072, transcript variant mCT171934"
FT                   /note="gene_id=mCG1031072.1 transcript_id=mCT171934.0
FT                   created on 15-AUG-2002"
FT   CDS             complement(join(7918532..7918558,7919475..7919567,
FT                   7919961..>7920161))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031072"
FT                   /product="mCG1031072, isoform CRA_b"
FT                   /note="gene_id=mCG1031072.1 transcript_id=mCT171934.0
FT                   protein_id=mCP94853.0 isoform=CRA_b"
FT                   /protein_id="EDL14112.1"
FT                   /translation="FTSHFSHFSLLFPFSLSSSFLSSLPLSLSFSLAFPPLFLPSLSPC
FT                   ISIIKLLNHRESLLHQDPLRTLQNDGYSIHARQNQLKNASHRDLQEISKFPETGTCCHS
FT                   ST"
FT   CDS             complement(join(7919525..7919611,7919961..>7920155))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031072"
FT                   /product="mCG1031072, isoform CRA_a"
FT                   /note="gene_id=mCG1031072.1 transcript_id=mCT148776.1
FT                   protein_id=mCP69963.1 isoform=CRA_a"
FT                   /protein_id="EDL14111.1"
FT                   /translation="SHFSHFSLLFPFSLSSSFLSSLPLSLSFSLAFPPLFLPSLSPCIS
FT                   IIKLLNHRESLLHQDPLRTLGLPRAPLILFPTTSSRTMVTPSTRDRTS"
FT   assembly_gap    7919771..7919884
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    7925563..7926576
FT                   /estimated_length=1014
FT                   /gap_type="unknown"
FT   gene            7930003..7930804
FT                   /pseudo
FT                   /locus_tag="mCG_7840"
FT                   /note="gene_id=mCG7840.1"
FT   mRNA            7930003..7930804
FT                   /pseudo
FT                   /locus_tag="mCG_7840"
FT                   /note="gene_id=mCG7840.1 transcript_id=mCT6877.1 created on
FT                   12-AUG-2002"
FT   assembly_gap    7938815..7938834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7941633..7941652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7943204..7943382
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    7945313..7945415
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    7949818..7949845
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    7957551..7968326
FT                   /estimated_length=10776
FT                   /gap_type="unknown"
FT   assembly_gap    7969870..7969889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7974820..7975358
FT                   /pseudo
FT                   /locus_tag="mCG_1031071"
FT                   /note="gene_id=mCG1031071.0"
FT   mRNA            7974820..7975358
FT                   /pseudo
FT                   /locus_tag="mCG_1031071"
FT                   /note="gene_id=mCG1031071.0 transcript_id=mCT148775.1
FT                   created on 15-AUG-2002"
FT   assembly_gap    7980077..7980096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7981157..7981450
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    7983949..7983968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7990943..7990962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8006199..8006412
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    8009819..8010292
FT                   /estimated_length=474
FT                   /gap_type="unknown"
FT   assembly_gap    8013761..8013780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8014577..8018261
FT                   /estimated_length=3685
FT                   /gap_type="unknown"
FT   assembly_gap    8023574..8029088
FT                   /estimated_length=5515
FT                   /gap_type="unknown"
FT   assembly_gap    8034638..8034670
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    8052981..8053198
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   gene            complement(8056205..8058986)
FT                   /pseudo
FT                   /locus_tag="mCG_119607"
FT                   /note="gene_id=mCG119607.1"
FT   mRNA            complement(join(8056205..8056278,8056305..8058523,
FT                   8058762..8058986))
FT                   /pseudo
FT                   /locus_tag="mCG_119607"
FT                   /note="gene_id=mCG119607.1 transcript_id=mCT120782.1
FT                   created on 12-AUG-2002"
FT   assembly_gap    8056283..8056302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8058524..8058761
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    8061986..8063357
FT                   /estimated_length=1372
FT                   /gap_type="unknown"
FT   assembly_gap    8074335..8074458
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   gene            complement(8075710..8149742)
FT                   /locus_tag="mCG_55901"
FT                   /note="gene_id=mCG55901.1"
FT   mRNA            complement(join(8075710..8076023,8122883..8123029,
FT                   8125657..8125796,8126877..8127124,8148950..8149118,
FT                   8149645..8149742))
FT                   /locus_tag="mCG_55901"
FT                   /product="mCG55901"
FT                   /note="gene_id=mCG55901.1 transcript_id=mCT56084.2 created
FT                   on 12-AUG-2002"
FT   CDS             complement(join(8075913..8076023,8122883..8123029,
FT                   8125657..8125796,8126877..8127124,8148950..8149118,
FT                   8149645..8149702))
FT                   /codon_start=1
FT                   /locus_tag="mCG_55901"
FT                   /product="mCG55901"
FT                   /note="gene_id=mCG55901.1 transcript_id=mCT56084.2
FT                   protein_id=mCP29720.2"
FT                   /db_xref="GOA:Q8K3S0"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="MGI:MGI:1922356"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K3S0"
FT                   /protein_id="EDL14109.1"
FT                   /translation="MKALLWLYCVLLFVCYCWAVPQMSRLSVSSSSVTGNLPPTNSYID
FT                   IPWLASMPDNCQGTILTTRLILSTANCLKKSKPLYLDISGVNYPESTSHGQRICLHPKF
FT                   NLNDENDPMKADIGLVILEKPIDGDEIPLSQSPSTSLKSCSKCQYKSCYVYEYQSSKKL
FT                   GTSRVKKIDVQLLDFSMCYPQHSSLEKAVGLCIQSQPREDCWVQRASPVLCLLMNHWEL
FT                   VGLIHKTSKICQNPAVIIRTAPYFTWIKQFIKAGPLKPRSSPRSSRCSGALLLNCSKWK
FT                   KYIGKQATY"
FT   gene            complement(8076916..8079380)
FT                   /gene="Nap1l2"
FT                   /locus_tag="mCG_119606"
FT                   /note="gene_id=mCG119606.0"
FT   mRNA            complement(8076916..8079380)
FT                   /gene="Nap1l2"
FT                   /locus_tag="mCG_119606"
FT                   /product="nucleosome assembly protein 1-like 2"
FT                   /note="gene_id=mCG119606.0 transcript_id=mCT120781.0
FT                   created on 07-AUG-2002"
FT   CDS             complement(8077668..8079050)
FT                   /codon_start=1
FT                   /gene="Nap1l2"
FT                   /locus_tag="mCG_119606"
FT                   /product="nucleosome assembly protein 1-like 2"
FT                   /note="gene_id=mCG119606.0 transcript_id=mCT120781.0
FT                   protein_id=mCP69881.1"
FT                   /db_xref="GOA:P51860"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="MGI:MGI:106654"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51860"
FT                   /protein_id="EDL14110.1"
FT                   /translation="MAESVDHKELSESNQEELGSQVMAEGPGESQDRSEGVSIEPGDGG
FT                   QHGEETVAAGVGEEGKGEEAAAGSGEDAGKCGGTDEDSDSDRPKGLIGYLLDTDFVESL
FT                   PVKVKCRVLALKKLQTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTE
FT                   EECEYKSDCEDYFEEEMDEEEETNGNEDGMVHEYVDEDDGYEDCYYDYDDEEEEEEEDD
FT                   SAGATGGEEVNEEDPKGIPDFWLTVLKNVEALTPMIKKYDEPILKLLTDIKVKLSDPGE
FT                   PLSFTLEFHFKPNEYFKNELLTKTYVLKSKLACYDPHPYRGTAIEYATGCDIDWNEGKN
FT                   VTLRTIKKKQRHRVWGTVRTVTEDFPKDSFFNFFSPHGISLNGGDENDDFLLGHNLRTY
FT                   IIPRSVLFFSGDALESQQEGVVREVNDEIYDKIIYDDWMAAIEEVKACCKNLEALVEDI
FT                   DR"
FT   assembly_gap    8085385..8085404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8095074..8095093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8097279..8097322
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    8108433..8108674
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    8109745..8110369
FT                   /estimated_length=625
FT                   /gap_type="unknown"
FT   gene            8120544..8121574
FT                   /pseudo
FT                   /locus_tag="mCG_119601"
FT                   /note="gene_id=mCG119601.0"
FT   mRNA            8120544..8121574
FT                   /pseudo
FT                   /locus_tag="mCG_119601"
FT                   /note="gene_id=mCG119601.0 transcript_id=mCT120776.0
FT                   created on 12-AUG-2002"
FT   gene            8128965..8129477
FT                   /pseudo
FT                   /locus_tag="mCG_1030986"
FT                   /note="gene_id=mCG1030986.1"
FT   mRNA            8128965..8129477
FT                   /pseudo
FT                   /locus_tag="mCG_1030986"
FT                   /note="gene_id=mCG1030986.1 transcript_id=mCT148690.1
FT                   created on 20-AUG-2002"
FT   assembly_gap    8132574..8132599
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    8136865..8136902
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    8138663..8138682
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8142261..8142532
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    8157444..8157463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8167634..8168679
FT                   /estimated_length=1046
FT                   /gap_type="unknown"
FT   assembly_gap    8171975..8172228
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    8193583..8193603
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    8197555..8197574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8217907..8219509
FT                   /pseudo
FT                   /locus_tag="mCG_1030954"
FT                   /note="gene_id=mCG1030954.1"
FT   mRNA            join(8217907..8218187,8218689..8219509)
FT                   /pseudo
FT                   /locus_tag="mCG_1030954"
FT                   /note="gene_id=mCG1030954.1 transcript_id=mCT148658.1
FT                   created on 19-AUG-2002"
FT   gene            8220956..8229785
FT                   /gene="Cdx4"
FT                   /locus_tag="mCG_13660"
FT                   /note="gene_id=mCG13660.1"
FT   mRNA            join(8220956..8221616,8227570..8227715,8228995..8229785)
FT                   /gene="Cdx4"
FT                   /locus_tag="mCG_13660"
FT                   /product="caudal type homeobox 4"
FT                   /note="gene_id=mCG13660.1 transcript_id=mCT17141.1 created
FT                   on 07-AUG-2002"
FT   CDS             join(8221121..8221616,8227570..8227715,8228995..8229201)
FT                   /codon_start=1
FT                   /gene="Cdx4"
FT                   /locus_tag="mCG_13660"
FT                   /product="caudal type homeobox 4"
FT                   /note="gene_id=mCG13660.1 transcript_id=mCT17141.1
FT                   protein_id=mCP7166.2"
FT                   /db_xref="GOA:Q78Z64"
FT                   /db_xref="InterPro:IPR000047"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR006820"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:88362"
FT                   /db_xref="UniProtKB/TrEMBL:Q78Z64"
FT                   /protein_id="EDL14108.1"
FT                   /translation="MYGSCLLEKEAGMYPGTLRSPGGSSTAGVGTSGGSGSPLPASNFT
FT                   AAPVYPHYVGYPHMSNMDPHGPSLGAWSSPYSPPREDWSTYPGPPSTMGTVPMNDMTSP
FT                   VFGSPDYSTLGPTSGASNGGSLPDAASESLVSLDSGTSGATSPSRSRHSPYAWMRKTVQ
FT                   VTGKTRTKEKYRVVYTDHQRLELEKEFHCNRYITIRRKSELAVNLGLSERQVKIWFQNR
FT                   RAKERKMIKKKISQFENTGGSVQSDSGSISPGELPNAFFTTPSAVRGFQPIEIQQVIVS
FT                   E"
FT   gene            complement(8236370..8236845)
FT                   /pseudo
FT                   /locus_tag="mCG_1030953"
FT                   /note="gene_id=mCG1030953.1"
FT   mRNA            complement(8236370..8236845)
FT                   /pseudo
FT                   /locus_tag="mCG_1030953"
FT                   /note="gene_id=mCG1030953.1 transcript_id=mCT148657.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    8241758..8242101
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    8243879..8245358
FT                   /estimated_length=1480
FT                   /gap_type="unknown"
FT   assembly_gap    8254520..8254625
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            8255579..8289033
FT                   /gene="Chic1"
FT                   /locus_tag="mCG_13662"
FT                   /note="gene_id=mCG13662.1"
FT   mRNA            join(8255579..8255965,8265213..8265267,8272598..8272753,
FT                   8286246..8286302,8286977..8287036,8288450..8289033)
FT                   /gene="Chic1"
FT                   /locus_tag="mCG_13662"
FT                   /product="cysteine-rich hydrophobic domain 1"
FT                   /note="gene_id=mCG13662.1 transcript_id=mCT17143.1 created
FT                   on 12-AUG-2002"
FT   CDS             join(8255661..8255965,8265213..8265267,8272598..8272753,
FT                   8286246..8286302,8286977..8287036,8288450..8288500)
FT                   /codon_start=1
FT                   /gene="Chic1"
FT                   /locus_tag="mCG_13662"
FT                   /product="cysteine-rich hydrophobic domain 1"
FT                   /note="gene_id=mCG13662.1 transcript_id=mCT17143.1
FT                   protein_id=mCP7165.2"
FT                   /db_xref="GOA:A2RT09"
FT                   /db_xref="InterPro:IPR019383"
FT                   /db_xref="MGI:MGI:1344694"
FT                   /db_xref="UniProtKB/TrEMBL:A2RT09"
FT                   /protein_id="EDL14107.1"
FT                   /translation="MSILLPNMAEFDTISELEEEEEAATSSSSPSSSPSSSSSSSVSGP
FT                   DEDEEDEEEEEEEDEEEEDEEEEEEEVPPPPRVVSEEHLRRYAPDPVLVRGAGHITVFG
FT                   LSNKFDTEFPSVLTGKVAPEEFKTSIGRVNSCLKKALPVNVKWLLCGCLCCCCTLGCSL
FT                   WPVICLNKRTRRSIQKLLEWENNRLYHKLALHWKLTKRKCETSNMMEYVILIEFLPKYP
FT                   IFRPD"
FT   assembly_gap    8264488..8264630
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   gene            8313482..8323577
FT                   /gene="Tsx"
FT                   /locus_tag="mCG_119600"
FT                   /note="gene_id=mCG119600.0"
FT   mRNA            join(8313482..8313646,8315035..8315070,8315751..8315787,
FT                   8317209..8317290,8319498..8319598,8320985..8321043,
FT                   8323261..8323577)
FT                   /gene="Tsx"
FT                   /locus_tag="mCG_119600"
FT                   /product="testis specific X-linked gene"
FT                   /note="gene_id=mCG119600.0 transcript_id=mCT120775.1
FT                   created on 07-AUG-2002"
FT   CDS             join(8313553..8313646,8315035..8315070,8315751..8315787,
FT                   8317209..8317290,8319498..8319598,8320985..8321043,
FT                   8323261..8323286)
FT                   /codon_start=1
FT                   /gene="Tsx"
FT                   /locus_tag="mCG_119600"
FT                   /product="testis specific X-linked gene"
FT                   /note="gene_id=mCG119600.0 transcript_id=mCT120775.1
FT                   protein_id=mCP69852.1"
FT                   /db_xref="GOA:Q78Z65"
FT                   /db_xref="InterPro:IPR035352"
FT                   /db_xref="MGI:MGI:108118"
FT                   /db_xref="UniProtKB/TrEMBL:Q78Z65"
FT                   /protein_id="EDL14106.1"
FT                   /translation="MSEKQSPKTSEAECSAMDLPEFEDEENWLFKVLGFQPGPSSALDD
FT                   DTDDQADEPLSAAEFLHLQDILQEDRVSSTDDEDTCQAGCTEDDETSHSDRDIDNNVKV
FT                   ITGNIKASPSMYMEMFTDQNPQADQDLEETESDGAMNPTD"
FT   gene            complement(8361510..8381195)
FT                   /locus_tag="mCG_140938"
FT                   /note="gene_id=mCG140938.0"
FT   mRNA            complement(join(8361510..8366031,8366813..8366967,
FT                   8367295..8367441,8367586..8367796,8368545..8368676,
FT                   8368826..8368916,8371693..8381195))
FT                   /locus_tag="mCG_140938"
FT                   /product="mCG140938"
FT                   /note="gene_id=mCG140938.0 transcript_id=mCT172357.0
FT                   created on 13-AUG-2002"
FT   CDS             complement(join(8365518..8366031,8366813..8366817))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140938"
FT                   /product="mCG140938"
FT                   /note="gene_id=mCG140938.0 transcript_id=mCT172357.0
FT                   protein_id=mCP95276.0"
FT                   /protein_id="EDL14105.1"
FT                   /translation="MSVYCGCVYFLFYVSIFSLVCVSNSLLHLFLPCFVCLFLPCFVCL
FT                   FLPCIMSNSLLYLFLPCFVSISSLQLCLILCYIYFFLALCVYFFLALCLILCYIYFFLA
FT                   LCVCLPCFVSISSLQLCLILCYIYFFLAFVCLSFLLLCVYFFLAVVSNSLLHLFLPCFC
FT                   VSISSLHCV"
FT   gene            <8378387..8381243
FT                   /locus_tag="mCG_59677"
FT                   /note="gene_id=mCG59677.2"
FT   mRNA            <8378387..8381243
FT                   /locus_tag="mCG_59677"
FT                   /product="mCG59677"
FT                   /note="gene_id=mCG59677.2 transcript_id=mCT59860.2 created
FT                   on 15-AUG-2002"
FT   CDS             <8380459..8380767
FT                   /codon_start=1
FT                   /locus_tag="mCG_59677"
FT                   /product="mCG59677"
FT                   /note="gene_id=mCG59677.2 transcript_id=mCT59860.2
FT                   protein_id=mCP29722.2"
FT                   /protein_id="EDL14104.1"
FT                   /translation="LTKPYFHPPSAPLGREKKNLKQVSTAPMGKRKRKKNNNSRYPRPR
FT                   WAWEKKTKRRYPRSRWTEKGFFVFFFFFTKSRYPWPRWAKEKKKRIKAGIHSPDGQV"
FT   gene            8384876..8385394
FT                   /pseudo
FT                   /locus_tag="mCG_1030952"
FT                   /note="gene_id=mCG1030952.1"
FT   mRNA            8384876..8385394
FT                   /pseudo
FT                   /locus_tag="mCG_1030952"
FT                   /note="gene_id=mCG1030952.1 transcript_id=mCT148656.1
FT                   created on 19-AUG-2002"
FT   gene            8387411..8387920
FT                   /pseudo
FT                   /locus_tag="mCG_13661"
FT                   /note="gene_id=mCG13661.2"
FT   mRNA            8387411..8387920
FT                   /pseudo
FT                   /locus_tag="mCG_13661"
FT                   /note="gene_id=mCG13661.2 transcript_id=mCT17142.2 created
FT                   on 12-AUG-2002"
FT   gene            8391230..8400887
FT                   /locus_tag="mCG_1031067"
FT                   /note="gene_id=mCG1031067.1"
FT   mRNA            join(8391230..8391347,8394085..8394246,8400513..8400886)
FT                   /locus_tag="mCG_1031067"
FT                   /product="mCG1031067, transcript variant mCT171932"
FT                   /note="gene_id=mCG1031067.1 transcript_id=mCT171932.0
FT                   created on 13-FEB-2003"
FT   mRNA            join(8391230..8391347,8394085..8394240,8400507..8400886)
FT                   /locus_tag="mCG_1031067"
FT                   /product="mCG1031067, transcript variant mCT180230"
FT                   /note="gene_id=mCG1031067.1 transcript_id=mCT180230.0
FT                   created on 13-FEB-2003"
FT   mRNA            join(8391230..8391347,8394085..8394177,8400513..8400886)
FT                   /locus_tag="mCG_1031067"
FT                   /product="mCG1031067, transcript variant mCT148771"
FT                   /note="gene_id=mCG1031067.1 transcript_id=mCT148771.1
FT                   created on 13-FEB-2003"
FT   mRNA            join(8391271..8391594,8394085..8394177,8400507..8400887)
FT                   /locus_tag="mCG_1031067"
FT                   /product="mCG1031067, transcript variant mCT171933"
FT                   /note="gene_id=mCG1031067.1 transcript_id=mCT171933.0
FT                   created on 13-FEB-2003"
FT   mRNA            join(8391279..8391347,8394085..8394177,8400507..8400603)
FT                   /locus_tag="mCG_1031067"
FT                   /product="mCG1031067, transcript variant mCT180232"
FT                   /note="gene_id=mCG1031067.1 transcript_id=mCT180232.0
FT                   created on 13-FEB-2003"
FT   mRNA            join(8391415..8391594,8394085..8394240,8400507..8400884)
FT                   /locus_tag="mCG_1031067"
FT                   /product="mCG1031067, transcript variant mCT180231"
FT                   /note="gene_id=mCG1031067.1 transcript_id=mCT180231.0
FT                   created on 13-FEB-2003"
FT   CDS             join(8394149..8394246,8400513..8400591)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031067"
FT                   /product="mCG1031067, isoform CRA_a"
FT                   /note="gene_id=mCG1031067.1 transcript_id=mCT171932.0
FT                   protein_id=mCP94852.0 isoform=CRA_a"
FT                   /protein_id="EDL14098.1"
FT                   /translation="MEEYGLLAHLCVLACLYIPEPLTQGMMAPIRPVCSTWLLQLPCLL
FT                   PATSTLSWNCKPK"
FT   CDS             join(8394149..8394240,8400507..8400591)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031067"
FT                   /product="mCG1031067, isoform CRA_b"
FT                   /note="gene_id=mCG1031067.1 transcript_id=mCT180230.0
FT                   protein_id=mCP103152.0 isoform=CRA_b"
FT                   /protein_id="EDL14099.1"
FT                   /translation="MEEYGLLAHLCVLACLYIPEPLTQGMMAPISSRCSTWLLQLPCLL
FT                   PATSTLSWNCKPK"
FT   CDS             join(8394149..8394240,8400507..8400591)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031067"
FT                   /product="mCG1031067, isoform CRA_b"
FT                   /note="gene_id=mCG1031067.1 transcript_id=mCT180231.0
FT                   protein_id=mCP103154.0 isoform=CRA_b"
FT                   /protein_id="EDL14100.1"
FT                   /translation="MEEYGLLAHLCVLACLYIPEPLTQGMMAPISSRCSTWLLQLPCLL
FT                   PATSTLSWNCKPK"
FT   CDS             join(8394149..8394177,8400507..8400591)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031067"
FT                   /product="mCG1031067, isoform CRA_d"
FT                   /note="gene_id=mCG1031067.1 transcript_id=mCT171933.0
FT                   protein_id=mCP94851.0 isoform=CRA_d"
FT                   /protein_id="EDL14102.1"
FT                   /translation="MEEYGLLAHLSRCSTWLLQLPCLLPATSTLSWNCKPK"
FT   CDS             join(8394149..8394177,8400507..8400591)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031067"
FT                   /product="mCG1031067, isoform CRA_d"
FT                   /note="gene_id=mCG1031067.1 transcript_id=mCT180232.0
FT                   protein_id=mCP103153.0 isoform=CRA_d"
FT                   /protein_id="EDL14103.1"
FT                   /translation="MEEYGLLAHLSRCSTWLLQLPCLLPATSTLSWNCKPK"
FT   CDS             join(8394149..8394177,8400513..8400591)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031067"
FT                   /product="mCG1031067, isoform CRA_c"
FT                   /note="gene_id=mCG1031067.1 transcript_id=mCT148771.1
FT                   protein_id=mCP69805.1 isoform=CRA_c"
FT                   /protein_id="EDL14101.1"
FT                   /translation="MEEYGLLAHLCSTWLLQLPCLLPATSTLSWNCKPK"
FT   gene            8404438..8405278
FT                   /pseudo
FT                   /locus_tag="mCG_15772"
FT                   /note="gene_id=mCG15772.1"
FT   mRNA            join(8404438..8404668,8404844..8405278)
FT                   /pseudo
FT                   /locus_tag="mCG_15772"
FT                   /note="gene_id=mCG15772.1 transcript_id=mCT19955.1 created
FT                   on 12-AUG-2002"
FT   gene            8412550..8412940
FT                   /pseudo
FT                   /locus_tag="mCG_1031066"
FT                   /note="gene_id=mCG1031066.1"
FT   mRNA            8412550..8412940
FT                   /pseudo
FT                   /locus_tag="mCG_1031066"
FT                   /note="gene_id=mCG1031066.1 transcript_id=mCT148770.1
FT                   created on 15-AUG-2002"
FT   assembly_gap    8413728..8414069
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   gene            complement(8422851..8423525)
FT                   /pseudo
FT                   /locus_tag="mCG_1030951"
FT                   /note="gene_id=mCG1030951.1"
FT   mRNA            complement(8422851..8423525)
FT                   /pseudo
FT                   /locus_tag="mCG_1030951"
FT                   /note="gene_id=mCG1030951.1 transcript_id=mCT148655.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    8424757..8424923
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    8426010..8426126
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            complement(8427134..>8428378)
FT                   /locus_tag="mCG_1030985"
FT                   /note="gene_id=mCG1030985.1"
FT   mRNA            complement(8427134..>8428378)
FT                   /locus_tag="mCG_1030985"
FT                   /product="mCG1030985"
FT                   /note="gene_id=mCG1030985.1 transcript_id=mCT148689.1
FT                   created on 16-AUG-2002"
FT   CDS             complement(8427277..>8427561)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030985"
FT                   /product="mCG1030985"
FT                   /note="gene_id=mCG1030985.1 transcript_id=mCT148689.1
FT                   protein_id=mCP70039.1"
FT                   /protein_id="EDL14097.1"
FT                   /translation="RLMNKRPILCSCQSTGKTCATIWDTKIQWFSLLNDNFLSFLYSWS
FT                   YGLEVVRFQLLQRVLLCCHNPIPSFDALVGSSSSQEVHSSRSVCLGTDE"
FT   assembly_gap    8429628..8430378
FT                   /estimated_length=751
FT                   /gap_type="unknown"
FT   assembly_gap    8436447..8436748
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    8437608..8437643
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    8441169..8441188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8442220..8443431
FT                   /estimated_length=1212
FT                   /gap_type="unknown"
FT   assembly_gap    8447470..8447741
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    8463867..8464093
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    8473145..8473309
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    8487926..8488138
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   gene            8495453..8496161
FT                   /pseudo
FT                   /locus_tag="mCG_49841"
FT                   /note="gene_id=mCG49841.2"
FT   mRNA            8495453..8496161
FT                   /pseudo
FT                   /locus_tag="mCG_49841"
FT                   /note="gene_id=mCG49841.2 transcript_id=mCT50024.2 created
FT                   on 20-AUG-2002"
FT   assembly_gap    8498325..8498451
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    8501411..8501430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<8505282..>8521408)
FT                   /locus_tag="mCG_15773"
FT                   /note="gene_id=mCG15773.2"
FT   mRNA            complement(join(<8505282..8505533,8506988..8507100,
FT                   8512707..8512834,8521200..>8521408))
FT                   /locus_tag="mCG_15773"
FT                   /product="mCG15773, transcript variant mCT171940"
FT                   /note="gene_id=mCG15773.2 transcript_id=mCT171940.0 created
FT                   on 12-AUG-2002"
FT   mRNA            complement(join(<8505282..8505533,8506988..8507104,
FT                   8512707..8512847,8520095..>8520158))
FT                   /locus_tag="mCG_15773"
FT                   /product="mCG15773, transcript variant mCT19956"
FT                   /note="gene_id=mCG15773.2 transcript_id=mCT19956.2 created
FT                   on 12-AUG-2002"
FT   CDS             complement(join(<8505282..8505533,8506988..>8507009))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15773"
FT                   /product="mCG15773, isoform CRA_a"
FT                   /note="gene_id=mCG15773.2 transcript_id=mCT171940.0
FT                   protein_id=mCP94859.0 isoform=CRA_a"
FT                   /protein_id="EDL14095.1"
FT                   /translation="QKNSMERVLGAQLKTDVCLAGSLPPISVLQPFGLFSFLETELHHM
FT                   ASYTVLPQSLQCWDCRPMPPSLSTIQTNMKRRGTSLERSTGTMEEM"
FT   CDS             complement(join(<8505282..8505533,8506988..>8507009))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15773"
FT                   /product="mCG15773, isoform CRA_a"
FT                   /note="gene_id=mCG15773.2 transcript_id=mCT19956.2
FT                   protein_id=mCP22789.2 isoform=CRA_a"
FT                   /protein_id="EDL14096.1"
FT                   /translation="QKNSMERVLGAQLKTDVCLAGSLPPISVLQPFGLFSFLETELHHM
FT                   ASYTVLPQSLQCWDCRPMPPSLSTIQTNMKRRGTSLERSTGTMEEM"
FT   assembly_gap    8506217..8506481
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    8508048..8508067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8510080..8511165
FT                   /estimated_length=1086
FT                   /gap_type="unknown"
FT   assembly_gap    8514609..8515322
FT                   /estimated_length=714
FT                   /gap_type="unknown"
FT   assembly_gap    8517961..8518579
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   assembly_gap    8524188..8524399
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   gene            8528229..8529308
FT                   /gene="Cnbp2"
FT                   /locus_tag="mCG_60180"
FT                   /note="gene_id=mCG60180.2"
FT   mRNA            8528229..8529308
FT                   /gene="Cnbp2"
FT                   /locus_tag="mCG_60180"
FT                   /product="cellular nucleic acid binding protein 2"
FT                   /note="gene_id=mCG60180.2 transcript_id=mCT60363.2 created
FT                   on 20-AUG-2002"
FT   CDS             8528317..8528829
FT                   /codon_start=1
FT                   /gene="Cnbp2"
FT                   /locus_tag="mCG_60180"
FT                   /product="cellular nucleic acid binding protein 2"
FT                   /note="gene_id=mCG60180.2 transcript_id=mCT60363.2
FT                   protein_id=mCP42615.2"
FT                   /db_xref="GOA:Q9D548"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="MGI:MGI:1922314"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D548"
FT                   /protein_id="EDL14094.1"
FT                   /translation="MSSKSCFKCGHSGHWARECPKGGTRGRTARGRTRGPQCSTANQSD
FT                   VCYRCGETGHYAKDCDLLQDTCYNCGRRGHIAKDCTQAKREREQCCYICSQPGHLARDC
FT                   NRQEEQKCYTCGEFGHIQKDCTQIKCYRCGENGHMAVNCSKTSEVSCYRCGESGHLARE
FT                   CPIEATA"
FT   assembly_gap    8529506..8529525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8531148..8531167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8533590..8533609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8535911..8535930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8537532..8537595
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    8539430..8539449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8545935..8546021
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    8547118..8547137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8548497..8549389
FT                   /estimated_length=893
FT                   /gap_type="unknown"
FT   assembly_gap    8551513..8551532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8561576..8561595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8562670..8563284
FT                   /estimated_length=615
FT                   /gap_type="unknown"
FT   assembly_gap    8573252..8573389
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    8582164..8582461
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   gene            8582477..8582968
FT                   /pseudo
FT                   /locus_tag="mCG_49243"
FT                   /note="gene_id=mCG49243.2"
FT   mRNA            8582477..8582968
FT                   /pseudo
FT                   /locus_tag="mCG_49243"
FT                   /note="gene_id=mCG49243.2 transcript_id=mCT49426.2 created
FT                   on 19-AUG-2002"
FT   gene            complement(8583816..8585200)
FT                   /locus_tag="mCG_50717"
FT                   /note="gene_id=mCG50717.1"
FT   mRNA            complement(8583816..8585200)
FT                   /locus_tag="mCG_50717"
FT                   /product="mCG50717"
FT                   /note="gene_id=mCG50717.1 transcript_id=mCT50900.1 created
FT                   on 20-AUG-2002"
FT   CDS             complement(8583894..8584301)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50717"
FT                   /product="mCG50717"
FT                   /note="gene_id=mCG50717.1 transcript_id=mCT50900.1
FT                   protein_id=mCP31071.0"
FT                   /protein_id="EDL14093.1"
FT                   /translation="MAALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRV
FT                   RRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVS
FT                   SKNRKAIVERAAQLAIRVTNPNARLRSEENE"
FT   assembly_gap    8585614..8585850
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    8587930..8588833
FT                   /estimated_length=904
FT                   /gap_type="unknown"
FT   assembly_gap    8592101..8592440
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    8594246..8594431
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   gene            complement(8595849..>8717140)
FT                   /gene="Slc16a2"
FT                   /locus_tag="mCG_140877"
FT                   /note="gene_id=mCG140877.0"
FT   mRNA            complement(join(8595849..8598406,8599931..8600159,
FT                   8604390..8604503,8605893..8606343,8610297..8610441,
FT                   8717044..>8717140))
FT                   /gene="Slc16a2"
FT                   /locus_tag="mCG_140877"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 2, transcript variant mCT171937"
FT                   /note="gene_id=mCG140877.0 transcript_id=mCT171937.0
FT                   created on 15-AUG-2002"
FT   mRNA            complement(join(8595855..8598406,8599931..8600159,
FT                   8604390..8604533,8605893..8606343,8610297..8610441,
FT                   8716765..>8717137))
FT                   /gene="Slc16a2"
FT                   /locus_tag="mCG_140877"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 2, transcript variant mCT171938"
FT                   /note="gene_id=mCG140877.0 transcript_id=mCT171938.0
FT                   created on 15-AUG-2002"
FT   CDS             complement(join(8598186..8598406,8599931..8600159,
FT                   8604390..8604503,8605893..8606343,8610297..8610441,
FT                   8717044..>8717140))
FT                   /codon_start=1
FT                   /gene="Slc16a2"
FT                   /locus_tag="mCG_140877"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 2, isoform CRA_a"
FT                   /note="gene_id=mCG140877.0 transcript_id=mCT171937.0
FT                   protein_id=mCP94856.0 isoform=CRA_a"
FT                   /protein_id="EDL14091.1"
FT                   /translation="PVCSPVPEPEPEPEPEPEPDPEPVPVPPPEPQPWVGALAMGMIFF
FT                   CSPIVSIFTDRLGCRITATTGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQP
FT                   SLVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIKMLGDKIKLAQTFQVLSTFMFVLT
FT                   LLSLTYRPLLPSSQDTPSKRGAHTLRQRFLVQFRKYFNMRVFRQRTYRIWAFGIAAAAL
FT                   GYFVPYVHLIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSM
FT                   MIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIA
FT                   GPPIAGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLSH
FT                   DPDPNGELLPGSPTPEEPI"
FT   CDS             complement(join(8598186..8598406,8599931..8600159,
FT                   8604390..8604533,8605893..8606343,8610297..8610441,
FT                   8716765..>8717137))
FT                   /codon_start=1
FT                   /gene="Slc16a2"
FT                   /locus_tag="mCG_140877"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 2, isoform CRA_b"
FT                   /note="gene_id=mCG140877.0 transcript_id=mCT171938.0
FT                   protein_id=mCP94857.0 isoform=CRA_b"
FT                   /protein_id="EDL14092.1"
FT                   /translation="VCSPVPEPEPEPEPEPEPDPEPVPVPPPEPQPEPEPQPLPDPAPL
FT                   PELGFEAEPVQEPEPTPTVETRGTARGFQPPEGGFGWIVVFAATWCNGSIFGIHNSVGI
FT                   LYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATTGAAVAF
FT                   IGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSSI
FT                   FSMSFPFLIKMLGDKIKLAQTFQVLSTFMFVLTLLSLTYRPLLPSSQDTPSKRGAHTLR
FT                   QRFLVQFRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEDKFKEIKETWVL
FT                   LVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCL
FT                   FLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYH
FT                   VAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLSHDPDPNGELLPGSPTPE
FT                   EPI"
FT   assembly_gap    8601755..8602187
FT                   /estimated_length=433
FT                   /gap_type="unknown"
FT   assembly_gap    8639036..8639055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8640462..8642418
FT                   /estimated_length=1957
FT                   /gap_type="unknown"
FT   assembly_gap    8644294..8645246
FT                   /estimated_length=953
FT                   /gap_type="unknown"
FT   assembly_gap    8661154..8661519
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   gene            complement(8661592..8662295)
FT                   /pseudo
FT                   /locus_tag="mCG_119612"
FT                   /note="gene_id=mCG119612.1"
FT   mRNA            complement(8661592..8662295)
FT                   /pseudo
FT                   /locus_tag="mCG_119612"
FT                   /note="gene_id=mCG119612.1 transcript_id=mCT120787.1
FT                   created on 12-AUG-2002"
FT   assembly_gap    8662298..8663307
FT                   /estimated_length=1010
FT                   /gap_type="unknown"
FT   assembly_gap    8669298..8669826
FT                   /estimated_length=529
FT                   /gap_type="unknown"
FT   gene            8676877..8677577
FT                   /pseudo
FT                   /locus_tag="mCG_1030984"
FT                   /note="gene_id=mCG1030984.1"
FT   mRNA            8676877..8677577
FT                   /pseudo
FT                   /locus_tag="mCG_1030984"
FT                   /note="gene_id=mCG1030984.1 transcript_id=mCT148688.1
FT                   created on 16-AUG-2002"
FT   assembly_gap    8681960..8682378
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    8692137..8693038
FT                   /estimated_length=902
FT                   /gap_type="unknown"
FT   assembly_gap    8697978..8697997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8700458..8700477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8713701..8713720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8717141..8717957
FT                   /estimated_length=817
FT                   /gap_type="unknown"
FT   assembly_gap    8746990..8747009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8751897..8752168
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    8753759..8753778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8760806..8761060
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    8764765..8764819
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    8765722..8766636
FT                   /estimated_length=915
FT                   /gap_type="unknown"
FT   assembly_gap    8771109..8771228
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    8774669..8775000
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   gene            8782691..8783713
FT                   /pseudo
FT                   /locus_tag="mCG_54095"
FT                   /note="gene_id=mCG54095.2"
FT   mRNA            8782691..8783713
FT                   /pseudo
FT                   /locus_tag="mCG_54095"
FT                   /note="gene_id=mCG54095.2 transcript_id=mCT54278.1 created
FT                   on 19-AUG-2002"
FT   assembly_gap    8784739..8785057
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    8807523..8808165
FT                   /estimated_length=643
FT                   /gap_type="unknown"
FT   assembly_gap    8809383..8809513
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    8813810..8813928
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   gene            8814968..8815493
FT                   /pseudo
FT                   /locus_tag="mCG_55962"
FT                   /note="gene_id=mCG55962.2"
FT   mRNA            8814968..8815493
FT                   /pseudo
FT                   /locus_tag="mCG_55962"
FT                   /note="gene_id=mCG55962.2 transcript_id=mCT56145.2 created
FT                   on 16-AUG-2002"
FT   assembly_gap    8820747..8820809
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    8826219..8826238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8828003..8828190
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    8829026..8829163
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    8847218..8847237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8852828..8856390)
FT                   /pseudo
FT                   /locus_tag="mCG_1187"
FT                   /note="gene_id=mCG1187.1"
FT   mRNA            complement(8852828..8856390)
FT                   /pseudo
FT                   /locus_tag="mCG_1187"
FT                   /note="gene_id=mCG1187.1 transcript_id=mCT7980.1 created on
FT                   07-AUG-2002"
FT   gene            complement(8857790..8876883)
FT                   /gene="Rnf12"
FT                   /locus_tag="mCG_1186"
FT                   /note="gene_id=mCG1186.2"
FT   mRNA            complement(join(8857790..8859705,8860913..8860996,
FT                   8862153..8862342,8874877..8874938,8876679..8876854))
FT                   /gene="Rnf12"
FT                   /locus_tag="mCG_1186"
FT                   /product="ring finger protein 12, transcript variant
FT                   mCT7978"
FT                   /note="gene_id=mCG1186.2 transcript_id=mCT7978.1 created on
FT                   15-FEB-2003"
FT   mRNA            complement(join(8858100..8859705,8860913..8860996,
FT                   8862153..8862342,8874877..8874938,8876669..8876883))
FT                   /gene="Rnf12"
FT                   /locus_tag="mCG_1186"
FT                   /product="ring finger protein 12, transcript variant
FT                   mCT180360"
FT                   /note="gene_id=mCG1186.2 transcript_id=mCT180360.0 created
FT                   on 15-FEB-2003"
FT   CDS             complement(join(8858153..8859705,8860913..8860996,
FT                   8862153..8862318))
FT                   /codon_start=1
FT                   /gene="Rnf12"
FT                   /locus_tag="mCG_1186"
FT                   /product="ring finger protein 12, isoform CRA_a"
FT                   /note="gene_id=mCG1186.2 transcript_id=mCT7978.1
FT                   protein_id=mCP6464.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WTV7"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="MGI:MGI:1342291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTV7"
FT                   /protein_id="EDL14089.1"
FT                   /translation="MENSDSNDKGSDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRL
FT                   MRDNNLLGTPGESTEEELLRRLQQIKEGPPPQSPDENRAGESSDDVTNSDSIIDWLNSV
FT                   RQTGNTTRSGQRGNQSWRAVSRTNPNSGDFRFSLEINVNRNNGSQTSENESEPSTRRLS
FT                   VENMESSSQRQMENSASESASARPSRAERNSAEAVTEVPTTRAQRRARSRSPEHRRTRA
FT                   RAERSRSPLQPTSEIPRRAPTLEQSSENEPEGSSRTRHHVTLRQQISGPELLGRGLFAA
FT                   SGSRNPSQGTSSSDTGSNSESSGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRS
FT                   QAPNNTVTYESERGGFRRTFSRSERAGVRTYVSTIRIPIRRILNTGLSETTSVAIQTML
FT                   RQIMTGFGELSYFMYSDSDSEPSASVSSRNVERVESRNGRGSSGGGNSSGSSSSSSPSP
FT                   SSSGESSESSSEMFEGSSEGGSSGPSRRDGRHRAPVTFDESGSLPFLSLAQFFLLNEDD
FT                   EDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRW
FT                   LSENSTCPICRRAVLSSGNRESVV"
FT   CDS             complement(join(8858153..8859705,8860913..8860996,
FT                   8862153..8862318))
FT                   /codon_start=1
FT                   /gene="Rnf12"
FT                   /locus_tag="mCG_1186"
FT                   /product="ring finger protein 12, isoform CRA_a"
FT                   /note="gene_id=mCG1186.2 transcript_id=mCT180360.0
FT                   protein_id=mCP103282.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WTV7"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="MGI:MGI:1342291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTV7"
FT                   /protein_id="EDL14090.1"
FT                   /translation="MENSDSNDKGSDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRL
FT                   MRDNNLLGTPGESTEEELLRRLQQIKEGPPPQSPDENRAGESSDDVTNSDSIIDWLNSV
FT                   RQTGNTTRSGQRGNQSWRAVSRTNPNSGDFRFSLEINVNRNNGSQTSENESEPSTRRLS
FT                   VENMESSSQRQMENSASESASARPSRAERNSAEAVTEVPTTRAQRRARSRSPEHRRTRA
FT                   RAERSRSPLQPTSEIPRRAPTLEQSSENEPEGSSRTRHHVTLRQQISGPELLGRGLFAA
FT                   SGSRNPSQGTSSSDTGSNSESSGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRS
FT                   QAPNNTVTYESERGGFRRTFSRSERAGVRTYVSTIRIPIRRILNTGLSETTSVAIQTML
FT                   RQIMTGFGELSYFMYSDSDSEPSASVSSRNVERVESRNGRGSSGGGNSSGSSSSSSPSP
FT                   SSSGESSESSSEMFEGSSEGGSSGPSRRDGRHRAPVTFDESGSLPFLSLAQFFLLNEDD
FT                   EDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRW
FT                   LSENSTCPICRRAVLSSGNRESVV"
FT   assembly_gap    8867607..8867626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8870681..8870734
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    8880097..8880116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8892364..8892383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8896172..8897808
FT                   /estimated_length=1637
FT                   /gap_type="unknown"
FT   assembly_gap    8903257..8903330
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    8911260..8911279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8917385..8917404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8937269..8937288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8938933..8938952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8940594..8940927
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    8941980..8942074
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   gene            <8945299..8946239
FT                   /locus_tag="mCG_1031057"
FT                   /note="gene_id=mCG1031057.1"
FT   mRNA            <8945299..8946239
FT                   /locus_tag="mCG_1031057"
FT                   /product="mCG1031057"
FT                   /note="gene_id=mCG1031057.1 transcript_id=mCT148761.1
FT                   created on 15-AUG-2002"
FT   CDS             <8945688..8946014
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031057"
FT                   /product="mCG1031057"
FT                   /note="gene_id=mCG1031057.1 transcript_id=mCT148761.1
FT                   protein_id=mCP69762.1"
FT                   /protein_id="EDL14088.1"
FT                   /translation="LVPKPGTLTCPKACFLATLYLPLFYPRSFPNSWVTLCLLPGNFML
FT                   TSTLSEVLPKLLGSQISLTVNLPCRQPLTAESSELGGGVGSPYGPPIVASTLDQQERHD
FT                   HQSF"
FT   assembly_gap    8950858..8950877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8956502..8956521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8972627..>8974740)
FT                   /locus_tag="mCG_1030948"
FT                   /note="gene_id=mCG1030948.1"
FT   mRNA            complement(8972627..>8974740)
FT                   /locus_tag="mCG_1030948"
FT                   /product="mCG1030948"
FT                   /note="gene_id=mCG1030948.1 transcript_id=mCT148652.1
FT                   created on 19-AUG-2002"
FT   CDS             complement(8974345..>8974509)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030948"
FT                   /product="mCG1030948"
FT                   /note="gene_id=mCG1030948.1 transcript_id=mCT148652.1
FT                   protein_id=mCP69962.1"
FT                   /protein_id="EDL14087.1"
FT                   /translation="LLLELEMFVFSCLTERLSNYSFSFRAFNAASHNRNISFCKIKLMQ
FT                   VLFFNHKIL"
FT   gene            complement(<8978425..>8982912)
FT                   /locus_tag="mCG_1188"
FT                   /note="gene_id=mCG1188.2"
FT   mRNA            complement(join(<8978425..8978518,8979091..>8982912))
FT                   /locus_tag="mCG_1188"
FT                   /product="mCG1188"
FT                   /note="gene_id=mCG1188.2 transcript_id=mCT7981.2 created on
FT                   12-AUG-2002"
FT   CDS             complement(join(8978425..8978518,8979091..>8982911))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1188"
FT                   /product="mCG1188"
FT                   /note="gene_id=mCG1188.2 transcript_id=mCT7981.2
FT                   protein_id=mCP6466.1"
FT                   /protein_id="EDL14086.1"
FT                   /translation="SRAGDRRESEKPDIDLEDPTQKSYYEALLLDKCNTEEALLANSNQ
FT                   DWGYFETFISESKIELLDLCSKNELSVNLFSEEDVENYMFDDDESTLGSDVCSLKIRYE
FT                   SFQDNVRDKTTLLMQEDAQFNFFPSVFTTCPKRESKSGILKQSSDLSQFKVPDVSIIWG
FT                   EEDKNLDKKKGKEEVHEDKSIETKDEKDNGEKPALNNKPCGGLEVEQFKNLKADQLTNS
FT                   LETSGNFSDDSSFIEVSYDAMGEIKDCSRYMARDTNSGSSSSQQNYGLRAKRKVRYSED
FT                   YLYDVDSLEGEKVNERKEWPPGGSKEEDDDEWCPKKRRKVTRKEPPVIIKYIIINRFKG
FT                   EKNMLVKLSKVDASETTVNLSENQLSKYAKLSPLKGFWQKKKKQKNSNTDSVKTPLCQK
FT                   QSFEPGSFEVSFLPPARKRKSKLGNRHRIQRIQSVETSASSKQVSFCSDQKQACNRKED
FT                   GVKGTPKSALLTDPSCANGSHLRGLIVSDSVKVKAQDTEFKGPERKVLNKIKFKSEARL
FT                   KSKKIKAGQENKPVVQMSPVSEDTSSKANLKNEVTPGTSNSSHMSEFHETKVKNSTFLP
FT                   TTCSSEMPLSSANVATNIPVIPGGYLQTLLDASDLSNNTSISYFTNHSAEQNEGSLTQT
FT                   EKAFVPLQSAQDCVLSSSSDSQLQQSSQNFKMEASNFGSLWPDKDTSGSQEFMTEVSRE
FT                   IATNQSSEFEASQVVSMENNLTAITYSPVCLNSDASGCNKVLYASLQDSHLPPEDLYQL
FT                   CHFNNGEICFPFQQGPLSTDDDGRLFSFDSMTSLTVSSSNYCSLSLKSCEKDGDDEIND
FT                   DFLAHCSPKLVIQQSIDEIAPLKESTDLLDISNFTPDKFRHSSLLEMSPPDTPSLSPQS
FT                   TRCESIKTLGTMKGFQEGVPGSLSTVEKIKWDCNTLSQQAQADDGFTLNSHQFQFHMFN
FT                   DEDSVGLLQKSPCLSTFDEPAGQINTNSKVSKSRKKTSPGKSGAVSQSSSQKNSRKKSP
FT                   KASNKGVEKPPSKTSRQVPKSTKKGKYVAAVNGEKMQIGIGHSGGQPNSTSSNAKTLTE
FT                   CIQHGGPVASMKIPSQKGLSGDWALGKESRPGWNDMSVVTNTNNLLDDDQREFQEPSYI
FT                   LSNIASGMADVQRFMMASMEPLWEPMEHQGESNTFYSPDSNSLKLKTLKILAGTPQESK
FT                   KKVTNGSSGATKNHRSVKAVSKSNGKAAIGEPGHADMPGSSEDSRSAFFDKKYSNVNTL
FT                   GNNGPTHKKLYRHKSSSKGLRDEKYKGKRVEREQAHKDEAGTTSFEKLRDSNYNLLKAE
FT                   TAFGVLPVFEEETHIFQKDI"
FT   assembly_gap    8992385..8992476
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    8995687..8996065
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    9011367..9012054
FT                   /estimated_length=688
FT                   /gap_type="unknown"
FT   assembly_gap    9022042..9022061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9024587..9024606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9036914..9036933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9050198..9051250
FT                   /estimated_length=1053
FT                   /gap_type="unknown"
FT   assembly_gap    9053384..9053403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9059601..9062467
FT                   /estimated_length=2867
FT                   /gap_type="unknown"
FT   assembly_gap    9081637..9081814
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    9087781..9088186
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   assembly_gap    9088803..9089120
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    9100471..9101970
FT                   /estimated_length=1500
FT                   /gap_type="unknown"
FT   assembly_gap    9109909..9110026
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    9111135..9111240
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    9122770..9122789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9127692..9127711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9131828..9131847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9137253..9137272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9139967..>9140946)
FT                   /locus_tag="mCG_1031053"
FT                   /note="gene_id=mCG1031053.1"
FT   mRNA            complement(9139967..>9140946)
FT                   /locus_tag="mCG_1031053"
FT                   /product="mCG1031053"
FT                   /note="gene_id=mCG1031053.1 transcript_id=mCT148757.1
FT                   created on 15-AUG-2002"
FT   CDS             complement(9140196..>9140750)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031053"
FT                   /product="mCG1031053"
FT                   /note="gene_id=mCG1031053.1 transcript_id=mCT148757.1
FT                   protein_id=mCP69961.1"
FT                   /protein_id="EDL14085.1"
FT                   /translation="ENQQEFFFIIIIIGHLLLGIGPTLFSPIYSPPSTPLYSLTPIPLL
FT                   FSSERRKDPLEYHPTLAYHLCMAGGLPLRALCFLSEIPLKKIKFSLASGYQLEIGMWAC
FT                   DLLSALRPHLDLSSRSSYSRISRGPPPNNQMGGRERRVSCTNKDTGNCSEVVSRPQCIE
FT                   KGPRFKCTSKRGSTDTYQWEG"
FT   assembly_gap    9141029..9141143
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    9144343..9144616
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    9146405..9146424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9148132..9148706
FT                   /estimated_length=575
FT                   /gap_type="unknown"
FT   assembly_gap    9150963..9151832
FT                   /estimated_length=870
FT                   /gap_type="unknown"
FT   assembly_gap    9153134..9159732
FT                   /estimated_length=6599
FT                   /gap_type="unknown"
FT   assembly_gap    9162852..9163337
FT                   /estimated_length=486
FT                   /gap_type="unknown"
FT   gene            complement(9168910..>9170595)
FT                   /locus_tag="mCG_1031052"
FT                   /note="gene_id=mCG1031052.1"
FT   mRNA            complement(9168910..>9170595)
FT                   /locus_tag="mCG_1031052"
FT                   /product="mCG1031052"
FT                   /note="gene_id=mCG1031052.1 transcript_id=mCT148756.1
FT                   created on 15-AUG-2002"
FT   CDS             complement(9169390..>9169560)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031052"
FT                   /product="mCG1031052"
FT                   /note="gene_id=mCG1031052.1 transcript_id=mCT148756.1
FT                   protein_id=mCP69958.0"
FT                   /protein_id="EDL14084.1"
FT                   /translation="TSSRYAFPFPLQGFASFIYLKRNILSFPSMLTDLSLSGWLFFKTC
FT                   FALSARYLKTV"
FT   gene            complement(9172224..>9301928)
FT                   /locus_tag="mCG_146161"
FT                   /note="gene_id=mCG146161.0"
FT   mRNA            complement(join(9172224..9172583,9179448..9179555,
FT                   9182693..9182796,9184056..9184227,9187994..9188123,
FT                   9188275..9188438,9188996..9189153,9190019..9190193,
FT                   9191177..9191264,9191354..9191442,9192357..9192625,
FT                   9193495..9193627,9211366..9211485,9230459..9230545,
FT                   9232890..9232967,9301749..>9301928))
FT                   /locus_tag="mCG_146161"
FT                   /product="mCG146161"
FT                   /note="gene_id=mCG146161.0 transcript_id=mCT186264.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(9172368..9172583,9179448..9179555,
FT                   9182693..9182796,9184056..9184227,9187994..9188123,
FT                   9188275..9188438,9188996..9189153,9190019..9190193,
FT                   9191177..9191264,9191354..9191442,9192357..9192625,
FT                   9193495..9193627,9211366..9211485,9230459..9230545,
FT                   9232890..9232967,9301749..>9301928))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146161"
FT                   /product="mCG146161"
FT                   /note="gene_id=mCG146161.0 transcript_id=mCT186264.0
FT                   protein_id=mCP107737.0"
FT                   /protein_id="EDL14083.1"
FT                   /translation="SSLKMALLAIHSWRWAAAAVAFEKHKHSAVLTRALVSMCGSGPRW
FT                   SSSQRGASGSARLSQTTESLRNTTQQRWGKDNSRQLLDATKALQTWPLIEKRTCWHGHA
FT                   GGGLHTDPKEGLKDVDTRKIIKAMLSYVWPEDRPDLRARVAISLGFLGGAKAMNIVVPF
FT                   MFKYAVDSLNQMSGNMLNLSDAPNTVATMATAVLIGYGVSRAGAAFFNEVRNAVFGKVA
FT                   QNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIVFE
FT                   MMLVSSVLYYKCGAQFALVTLGTLGAYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDS
FT                   LLNYETVKYFNNEKYEAQRYDGFLKTYETASLKSTSTLAMLNFGQNAIFSVGLTAIMVL
FT                   ASQGIVAGALTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLKVDTRI
FT                   KDKVMAPPLQITPQTATVAFDNVHFEYIEGQKVLNGVSFEVPAGKKVAIVGGSGSGKST
FT                   IVRLLFRFYEPQKGSIYLAGQNLQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNIN
FT                   ASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKNPPVIL
FT                   YDEATSSLDSITEETILGAMRDVVKHRTSIFIAHRLSTVVDADEIIVLSQGKVAERGTH
FT                   YGLLANSSSIYSEMWHTQSNRVQNQDSLGWDAKKESLSKEEERKKLQEEIVNSVKGCGN
FT                   CSC"
FT   assembly_gap    9202438..9202457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9204325..9204992
FT                   /estimated_length=668
FT                   /gap_type="unknown"
FT   assembly_gap    9212427..9212446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9217407..9217426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9219818..9220077
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    9222236..9222304
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    9224940..9225205
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   gene            complement(9233245..9236340)
FT                   /pseudo
FT                   /locus_tag="mCG_116727"
FT                   /note="gene_id=mCG116727.1"
FT   mRNA            complement(9233245..9236340)
FT                   /pseudo
FT                   /locus_tag="mCG_116727"
FT                   /note="gene_id=mCG116727.1 transcript_id=mCT117853.1
FT                   created on 12-AUG-2002"
FT   assembly_gap    9236577..9236679
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    9241504..9242086
FT                   /estimated_length=583
FT                   /gap_type="unknown"
FT   assembly_gap    9250519..9250602
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    9258900..9258919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9260265..9260474
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    9262240..9262259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9265353..9266611
FT                   /estimated_length=1259
FT                   /gap_type="unknown"
FT   assembly_gap    9268767..9269153
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   gene            complement(9270361..9271057)
FT                   /pseudo
FT                   /locus_tag="mCG_116729"
FT                   /note="gene_id=mCG116729.1"
FT   mRNA            complement(9270361..9271057)
FT                   /pseudo
FT                   /locus_tag="mCG_116729"
FT                   /note="gene_id=mCG116729.1 transcript_id=mCT117855.1
FT                   created on 12-AUG-2002"
FT   assembly_gap    9271341..9271576
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    9274345..9274464
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    9277079..9277216
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    9288112..9288131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9296955..9297061
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    9305050..9305878
FT                   /estimated_length=829
FT                   /gap_type="unknown"
FT   assembly_gap    9314182..9314302
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    9324901..9325847
FT                   /estimated_length=947
FT                   /gap_type="unknown"
FT   assembly_gap    9351351..9351834
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   assembly_gap    9353311..9353378
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   gene            9372022..9395356
FT                   /locus_tag="mCG_8435"
FT                   /note="gene_id=mCG8435.3"
FT   mRNA            join(9372022..9372553,9384813..9384855,9387352..9387421,
FT                   9388481..9388543,9390822..>9390990)
FT                   /locus_tag="mCG_8435"
FT                   /product="mCG8435, transcript variant mCT180358"
FT                   /note="gene_id=mCG8435.3 transcript_id=mCT180358.0 created
FT                   on 15-FEB-2003"
FT   mRNA            join(9372127..9372553,9387357..9387421,9388481..9388543,
FT                   9390822..9390983,9393407..9393505,9395234..9395356)
FT                   /locus_tag="mCG_8435"
FT                   /product="mCG8435, transcript variant mCT7626"
FT                   /note="gene_id=mCG8435.3 transcript_id=mCT7626.2 created on
FT                   15-FEB-2003"
FT   CDS             join(9372165..9372553,9387357..9387421,9388481..9388543,
FT                   9390822..9390983,9393407..9393505,9395234..9395340)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8435"
FT                   /product="mCG8435, isoform CRA_b"
FT                   /note="gene_id=mCG8435.3 transcript_id=mCT7626.2
FT                   protein_id=mCP1216.2 isoform=CRA_b"
FT                   /protein_id="EDL14082.1"
FT                   /translation="MASELQRPDSMPCHNRQVNSTSSPSPEHLLAEDRVLDHAEENNAA
FT                   MAKLTLLPGHAHSSVLSERDSPACCSTNLHSENHSDSSDSGNYDAPVGGDSLLGDCELS
FT                   RQIGAQLKLLPMNDQIRELQTIIRDKLVVEEGLNQLPYKECMVTTPTGHKYEGVKFEKG
FT                   NCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIHRRKVLLM
FT                   YPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEITILTTEVHPV
FT                   APTHFGQKYFGTD"
FT   CDS             join(9372165..9372553,9384813..9384855,9387352..9387421,
FT                   9388481..9388543,9390822..>9390990)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8435"
FT                   /product="mCG8435, isoform CRA_a"
FT                   /note="gene_id=mCG8435.3 transcript_id=mCT180358.0
FT                   protein_id=mCP103280.0 isoform=CRA_a"
FT                   /protein_id="EDL14081.1"
FT                   /translation="MASELQRPDSMPCHNRQVNSTSSPSPEHLLAEDRVLDHAEENNAA
FT                   MAKLTLLPGHAHSSVLSERDSPACCSTNLHSENHSDSSDSGNYDAPVGGDSLLGDCELS
FT                   RQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSADRLIRLVVEEGLNQLPYKECMV
FT                   TTPTGHKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVY
FT                   YAKFPPDIHRRKVLLMYPILSE"
FT   assembly_gap    9373287..9373393
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    9413599..9414060
FT                   /estimated_length=462
FT                   /gap_type="unknown"
FT   assembly_gap    9415471..9415490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9423647..9423666
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9428986..>9486955)
FT                   /gene="Zdhhc15"
FT                   /locus_tag="mCG_8434"
FT                   /note="gene_id=mCG8434.1"
FT   mRNA            complement(join(9428986..9430037,9433697..9433773,
FT                   9449636..9449739,9452772..9452898,9454653..9454785,
FT                   9460606..9460726,9461457..9461489,9463121..9463190,
FT                   9477160..9477280,9486858..>9486955))
FT                   /gene="Zdhhc15"
FT                   /locus_tag="mCG_8434"
FT                   /product="zinc finger, DHHC domain containing 15"
FT                   /note="gene_id=mCG8434.1 transcript_id=mCT7625.2 created on
FT                   12-AUG-2002"
FT   CDS             complement(join(9433727..9433773,9449636..9449739,
FT                   9452772..9452898,9454653..9454785,9460606..9460726,
FT                   9461457..9461489,9463121..9463190,9477160..9477280,
FT                   9486858..>9486953))
FT                   /codon_start=1
FT                   /gene="Zdhhc15"
FT                   /locus_tag="mCG_8434"
FT                   /product="zinc finger, DHHC domain containing 15"
FT                   /note="gene_id=mCG8434.1 transcript_id=mCT7625.2
FT                   protein_id=mCP1217.2"
FT                   /protein_id="EDL14080.1"
FT                   /translation="VIYLILYHAIFVFFAWTYWKSIFTLPQQPNQKFHLSYTDKERYKN
FT                   EERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHH
FT                   CPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLL
FT                   FVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGD
FT                   NKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEEPWEDNEDDSRDYPEGSSSLAVES
FT                   ET"
FT   assembly_gap    9440901..9440920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9443300..9443379
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    9467373..9467392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9478686..9479093
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    9482715..9482807
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    9491475..9492242
FT                   /estimated_length=768
FT                   /gap_type="unknown"
FT   assembly_gap    9493802..9493865
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    9505992..9506621
FT                   /estimated_length=630
FT                   /gap_type="unknown"
FT   assembly_gap    9512158..9512177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9513373..9530181
FT                   /estimated_length=16809
FT                   /gap_type="unknown"
FT   assembly_gap    9534207..9534250
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    9537479..9537714
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    9541096..9541115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9548660..9548718
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    9551965..9552032
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    9554382..9556478
FT                   /estimated_length=2097
FT                   /gap_type="unknown"
FT   assembly_gap    9567292..9567955
FT                   /estimated_length=664
FT                   /gap_type="unknown"
FT   assembly_gap    9590568..9591023
FT                   /estimated_length=456
FT                   /gap_type="unknown"
FT   assembly_gap    9594756..9594775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9602754..9602773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9606597..9606616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9611539..9611563
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    9621430..9621712
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    9623073..9623380
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    9624390..9624880
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    9657438..9657659
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    9669963..9669982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9675305..9691310
FT                   /estimated_length=16006
FT                   /gap_type="unknown"
FT   assembly_gap    9694039..9694704
FT                   /estimated_length=666
FT                   /gap_type="unknown"
FT   assembly_gap    9698654..9698966
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    9699741..9701751
FT                   /estimated_length=2011
FT                   /gap_type="unknown"
FT   gene            9703132..9712599
FT                   /locus_tag="mCG_147481"
FT                   /note="gene_id=mCG147481.0"
FT   mRNA            join(9703132..9703230,9712202..9712599)
FT                   /locus_tag="mCG_147481"
FT                   /product="mCG147481"
FT                   /note="gene_id=mCG147481.0 transcript_id=mCT187744.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    9705596..9706089
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   CDS             9712325..9712528
FT                   /codon_start=1
FT                   /locus_tag="mCG_147481"
FT                   /product="mCG147481"
FT                   /note="gene_id=mCG147481.0 transcript_id=mCT187744.0
FT                   protein_id=mCP108720.0"
FT                   /protein_id="EDL14079.1"
FT                   /translation="MMEQFVCMLLSAEEVISPSNSHLAMVQKWRILSACEKTPRNQDKS
FT                   LMTCFSKIENWHGFLCLSRCSG"
FT   assembly_gap    9715596..9715615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9718264..9718364
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    9725082..9725101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9725102..9727233)
FT                   /gene="Magee2"
FT                   /locus_tag="mCG_52871"
FT                   /note="gene_id=mCG52871.2"
FT   mRNA            complement(9725102..9727233)
FT                   /gene="Magee2"
FT                   /locus_tag="mCG_52871"
FT                   /product="melanoma antigen, family E, 2"
FT                   /note="gene_id=mCG52871.2 transcript_id=mCT53054.2 created
FT                   on 17-SEP-2002"
FT   CDS             complement(9725438..9727009)
FT                   /codon_start=1
FT                   /gene="Magee2"
FT                   /locus_tag="mCG_52871"
FT                   /product="melanoma antigen, family E, 2"
FT                   /note="gene_id=mCG52871.2 transcript_id=mCT53054.2
FT                   protein_id=mCP37350.1"
FT                   /db_xref="GOA:Q52KG3"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="MGI:MGI:2148316"
FT                   /db_xref="UniProtKB/TrEMBL:Q52KG3"
FT                   /protein_id="EDL14078.1"
FT                   /translation="MSLVSQNARQSSAETTADYSNSQGEMQATNASGPATSMLALEAPQ
FT                   GPEIPNDPQGASASQAVRDPSDIEVLIDEQSRRLGALRVHDPLEERSVALVNFMRMKSQ
FT                   NEGSIRQSEMLEFLKEYSDQFPEILRRASAHLDRVFGLNLRVLDPQMDTYNLISKPGPQ
FT                   TTERLAETLDIPKAGLLALVLGHILLNGNRAREASIWDLLLKVDVIDGSQRINNQFGNT
FT                   RNLLTIDFVHMRFLEYWPVYGTNPLEFEFLWGSRAHSEITKMEALKFVAEAHDEEPWSW
FT                   PEEYNKALEADKAKERSQAAGLEFWSEDTMNDKANELVQLAIGVTEELLPIHQDELFAN
FT                   TGKEFQDVFPNILSRATLILDLFYGFSLIEVDTSEHIYLLVPQPESEEEQVMLESLGRP
FT                   TQEYLMPILGLIFLMGNRVKEAKIWNLLQRFSVDVGRKHAITCKLMRQRYLECRPLSYS
FT                   NPVEYELLWGPRAHHEITKMKALEYMARFYGKQPQDWPEQYREAVEDEEARARSEATAM
FT                   FFFGSI"
FT   assembly_gap    9733981..9738496
FT                   /estimated_length=4516
FT                   /gap_type="unknown"
FT   assembly_gap    9739968..9739987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9742076..9743596
FT                   /estimated_length=1521
FT                   /gap_type="unknown"
FT   assembly_gap    9746032..9746639
FT                   /estimated_length=608
FT                   /gap_type="unknown"
FT   assembly_gap    9748105..9748596
FT                   /estimated_length=492
FT                   /gap_type="unknown"
FT   assembly_gap    9751143..9751312
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    9753742..9753761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9767326..9767345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9780897..9781054
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    9782708..9782727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9785581..9785600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9812324..9812944
FT                   /pseudo
FT                   /locus_tag="mCG_10491"
FT                   /note="gene_id=mCG10491.0"
FT   mRNA            9812324..9812944
FT                   /pseudo
FT                   /locus_tag="mCG_10491"
FT                   /note="gene_id=mCG10491.0 transcript_id=mCT10366.0 created
FT                   on 12-AUG-2002"
FT   assembly_gap    9816829..9817365
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    9818847..9824726
FT                   /estimated_length=5880
FT                   /gap_type="unknown"
FT   assembly_gap    9829228..9830368
FT                   /estimated_length=1141
FT                   /gap_type="unknown"
FT   assembly_gap    9850557..9850722
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    9871739..9872180
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    9874213..9874250
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    9880919..9886380
FT                   /estimated_length=5462
FT                   /gap_type="unknown"
FT   assembly_gap    9889585..9890875
FT                   /estimated_length=1291
FT                   /gap_type="unknown"
FT   gene            9892151..9893128
FT                   /pseudo
FT                   /locus_tag="mCG_2183"
FT                   /note="gene_id=mCG2183.2"
FT   mRNA            9892151..9893128
FT                   /pseudo
FT                   /locus_tag="mCG_2183"
FT                   /note="gene_id=mCG2183.2 transcript_id=mCT1921.2 created on
FT                   12-AUG-2002"
FT   gene            9894782..9895621
FT                   /pseudo
FT                   /locus_tag="mCG_1030982"
FT                   /note="gene_id=mCG1030982.1"
FT   mRNA            9894782..9895621
FT                   /pseudo
FT                   /locus_tag="mCG_1030982"
FT                   /note="gene_id=mCG1030982.1 transcript_id=mCT148686.1
FT                   created on 16-AUG-2002"
FT   gene            complement(9896829..>9930221)
FT                   /locus_tag="mCG_1031049"
FT                   /note="gene_id=mCG1031049.2"
FT   mRNA            complement(join(9896829..9897464,9898187..9899893,
FT                   9903216..9903395,9926866..9926984,9928678..9928737,
FT                   9929735..9929799,9930124..>9930221))
FT                   /locus_tag="mCG_1031049"
FT                   /product="mCG1031049, transcript variant mCT185340"
FT                   /note="gene_id=mCG1031049.2 transcript_id=mCT185340.0
FT                   created on 13-JUN-2003"
FT   mRNA            complement(join(9896829..9897464,9898187..9899893,
FT                   9926866..9926984,9928571..9928737,9929735..9929799,
FT                   9930124..>9930221))
FT                   /locus_tag="mCG_1031049"
FT                   /product="mCG1031049, transcript variant mCT148753"
FT                   /note="gene_id=mCG1031049.2 transcript_id=mCT148753.1
FT                   created on 13-JUN-2003"
FT   mRNA            complement(join(9896829..9897464,9898187..9899893,
FT                   9907911..9908012,9926866..9926984,9928571..9928737,
FT                   9929735..9929799,9930124..>9930221))
FT                   /locus_tag="mCG_1031049"
FT                   /product="mCG1031049, transcript variant mCT180229"
FT                   /note="gene_id=mCG1031049.2 transcript_id=mCT180229.1
FT                   created on 13-JUN-2003"
FT   assembly_gap    9897465..9898186
FT                   /estimated_length=722
FT                   /gap_type="unknown"
FT   CDS             complement(9899583..>9899789)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031049"
FT                   /product="mCG1031049, isoform CRA_b"
FT                   /note="gene_id=mCG1031049.2 transcript_id=mCT185340.0
FT                   protein_id=mCP106598.0 isoform=CRA_b"
FT                   /protein_id="EDL14075.1"
FT                   /translation="SRALTRAFSEEALQTAKKHETAQHPLPSGKHRSSLFSFHLSGVRM
FT                   VIVKNASDMDVEDGFLHCLSLWK"
FT   CDS             complement(join(9899785..9899893,9926866..9926984,
FT                   9928571..>9928621))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031049"
FT                   /product="mCG1031049, isoform CRA_c"
FT                   /note="gene_id=mCG1031049.2 transcript_id=mCT148753.1
FT                   protein_id=mCP69939.1 isoform=CRA_c"
FT                   /protein_id="EDL14076.1"
FT                   /translation="SEKIGFLAKQVYLDSGKGGEQRATRLNGKNAQASHCLPLTFQNFI
FT                   KTVMSYMYTWRRAIWYWTTNWSVVCGGGPPLQVESKHQKINNPVKII"
FT   mRNA            complement(join(9901492..9903468,9907911..9908012,
FT                   9926866..9926984,9928571..9928737,9929735..9929799,
FT                   9930124..9930221))
FT                   /locus_tag="mCG_1031049"
FT                   /product="mCG1031049, transcript variant mCT171931"
FT                   /note="gene_id=mCG1031049.2 transcript_id=mCT171931.1
FT                   created on 13-JUN-2003"
FT   CDS             complement(9902940..9903218)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031049"
FT                   /product="mCG1031049, isoform CRA_d"
FT                   /note="gene_id=mCG1031049.2 transcript_id=mCT171931.1
FT                   protein_id=mCP94850.1 isoform=CRA_d"
FT                   /protein_id="EDL14077.1"
FT                   /translation="MVRNLPIPSPQPLTSGLNPNSVRDLVFTRSRDPLAWVLPPQRSPQ
FT                   ALSPTIQLCILTWWVKNPYQNTADNVNPDAQVTAQKLDKLNQYLIVL"
FT   assembly_gap    9903469..9904178
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   CDS             complement(join(9907976..9908012,9926866..9926984,
FT                   9928571..>9928621))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031049"
FT                   /product="mCG1031049, isoform CRA_a"
FT                   /note="gene_id=mCG1031049.2 transcript_id=mCT180229.1
FT                   protein_id=mCP103151.0 isoform=CRA_a"
FT                   /protein_id="EDL14074.1"
FT                   /translation="SEKIGFLAKQVYLDSGKGGEQRATRLNGKNAQASHCLPLTFQNFI
FT                   KTVMSYMYTWRRTMQNTIQRHEH"
FT   assembly_gap    9910308..9910463
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    9913466..9913521
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    9915039..9915119
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    9928788..9928993
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    9930224..9930243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9933768..9934872
FT                   /estimated_length=1105
FT                   /gap_type="unknown"
FT   gene            9939275..9943712
FT                   /gene="2610029G23Rik"
FT                   /locus_tag="mCG_2182"
FT                   /note="gene_id=mCG2182.2"
FT   mRNA            join(9939275..9939975,9940086..9940151,9941503..9941562,
FT                   9942070..9942210,9942826..9942937,9943148..9943712)
FT                   /gene="2610029G23Rik"
FT                   /locus_tag="mCG_2182"
FT                   /product="RIKEN cDNA 2610029G23"
FT                   /note="gene_id=mCG2182.2 transcript_id=mCT1929.2 created on
FT                   07-AUG-2002"
FT   CDS             join(9939946..9939975,9940086..9940151,9941503..9941562,
FT                   9942070..9942210,9942826..9942937,9943148..9943335)
FT                   /codon_start=1
FT                   /gene="2610029G23Rik"
FT                   /locus_tag="mCG_2182"
FT                   /product="RIKEN cDNA 2610029G23"
FT                   /note="gene_id=mCG2182.2 transcript_id=mCT1929.2
FT                   protein_id=mCP23040.2"
FT                   /protein_id="EDL14073.1"
FT                   /translation="MDAAGESEEPVSGEALSIAHALSHPPESYGNDPDIEMAWAIRAMQ
FT                   HAEVYYKLISSVDPQFLKLTKVDDQIYSEFREIFETLRVDVLDPEELKSESAKEKWRPF
FT                   CLKFEGIVEDYNYGTLLRLDCSQGYTEENTIFAPRIQFFAIEIARNREGYNKAVSVSIQ
FT                   DKEGEEGAGNKEEAAEKGADSGGEKEEGANREGEK"
FT   assembly_gap    9946355..9947195
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   assembly_gap    9955210..9955256
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    9962557..9962839
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    9965123..9965399
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    9968098..9968117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9974544..9974964
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   gene            9980431..9983986
FT                   /gene="Magee1"
FT                   /locus_tag="mCG_58363"
FT                   /note="gene_id=mCG58363.1"
FT   mRNA            9980431..9983986
FT                   /gene="Magee1"
FT                   /locus_tag="mCG_58363"
FT                   /product="melanoma antigen, family E, 1"
FT                   /note="gene_id=mCG58363.1 transcript_id=mCT58546.1 created
FT                   on 07-AUG-2002"
FT   CDS             9981244..9983418
FT                   /codon_start=1
FT                   /gene="Magee1"
FT                   /locus_tag="mCG_58363"
FT                   /product="melanoma antigen, family E, 1"
FT                   /note="gene_id=mCG58363.1 transcript_id=mCT58546.1
FT                   protein_id=mCP42762.1"
FT                   /db_xref="GOA:Q6PCZ4"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="MGI:MGI:2148149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PCZ4"
FT                   /protein_id="EDL14072.1"
FT                   /translation="MSPNISEGPGINEPYSVSEDPSTSVPPTDSNGLGINLPPTFGEGL
FT                   SISMLFSALEEPDIFAPPPSAEGLFASMSPPSGEIQSSWVSPIIMEGCNVNVPPTSKKG
FT                   LRTSVPSAACESPSTSAEGLSSSLSSISAEGFCSSLAPCAAEGSCELLPCGEGRSTSEL
FT                   HCLGEGSSTSQMSLAAEGPSASGMPTEANNPEEALSCCASERRNKSTSRALQKAKDPSV
FT                   RPKREDRFLDFQVLRDSKNSNSITIMGLGTSRVALTLKPQDPMEQNVAELLQFLLLKDQ
FT                   TKYPIKESDMREFIDKDYRHQFPEILRRAAVHLECIFRFELKELDTEEHIYILLNKLGP
FT                   VPFEGLEDVPNGPKMGLLMMILGHILLNGNQAREADIWEMLWRFGVQRERRLSVFGNVK
FT                   RLLSVEFVWQRYLDYRPLTDCVPVEYEFYWGPRSRAETTKMKILKFMAKIYNKDPMDWP
FT                   ALYNEALEEDADRVVVNNFRVARPFRRPLFAEVAPELDASGSKYSPHSWPESRLESKAR
FT                   KLVQLFLLMDSTKLPIPKKGILYYIGRECTKVFPDLLNRAARTLNHVYGTELVVLDPRN
FT                   HSYTLYNRREMEDTEEIMDSPNRPGNNFLMQVLSFIFIMGNHARESAVWAFLRGLGVQN
FT                   GRKHVITCRYLSQRYLDSLRVPDSDPVQYDFVWGPRARLETSKMKALRYVARIHRKEPE
FT                   DWPEQYREAMEDEANRAEAGRRPLIVRNLR"
FT   assembly_gap    9985331..9985731
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   gene            10000621..10002296
FT                   /pseudo
FT                   /locus_tag="mCG_118336"
FT                   /note="gene_id=mCG118336.0"
FT   mRNA            10000621..10002296
FT                   /pseudo
FT                   /locus_tag="mCG_118336"
FT                   /note="gene_id=mCG118336.0 transcript_id=mCT119491.0
FT                   created on 12-AUG-2002"
FT   assembly_gap    10010984..10011132
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    10012228..10012289
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    10037463..10037495
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    10042745..10042913
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    10047589..10047608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10060287..10060306
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10062716..10062935
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    10075448..10075564
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    10106247..10107027
FT                   /estimated_length=781
FT                   /gap_type="unknown"
FT   assembly_gap    10109721..10112431
FT                   /estimated_length=2711
FT                   /gap_type="unknown"
FT   assembly_gap    10113696..10113902
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    10117455..10117704
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    10119316..10119665
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    10121429..10121448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10125642..10126159
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   assembly_gap    10127315..10128994
FT                   /estimated_length=1680
FT                   /gap_type="unknown"
FT   assembly_gap    10130248..10130896
FT                   /estimated_length=649
FT                   /gap_type="unknown"
FT   gene            complement(10136814..10137294)
FT                   /pseudo
FT                   /locus_tag="mCG_2350"
FT                   /note="gene_id=mCG2350.1"
FT   mRNA            complement(10136814..10137294)
FT                   /pseudo
FT                   /locus_tag="mCG_2350"
FT                   /note="gene_id=mCG2350.1 transcript_id=mCT1927.1 created on
FT                   12-AUG-2002"
FT   assembly_gap    10139528..10139609
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    10145415..10145434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10162445..10162464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10171124..10172394
FT                   /estimated_length=1271
FT                   /gap_type="unknown"
FT   assembly_gap    10182730..10182749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10186294..10186313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10215312..10215331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10227324..10227343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10228366..10228385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10229646..>10248424)
FT                   /locus_tag="mCG_145217"
FT                   /note="gene_id=mCG145217.0"
FT   mRNA            complement(join(10229646..10232489,10239421..10239617,
FT                   10244550..10244604,10246538..10246611,10248144..>10248424))
FT                   /locus_tag="mCG_145217"
FT                   /product="mCG145217"
FT                   /note="gene_id=mCG145217.0 transcript_id=mCT184641.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(10231290..>10231514)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145217"
FT                   /product="mCG145217"
FT                   /note="gene_id=mCG145217.0 transcript_id=mCT184641.0
FT                   protein_id=mCP106217.0"
FT                   /protein_id="EDL14071.1"
FT                   /translation="RSSNSHIPQVLPSSCVGLYLKQVLCAGLVRKSHPVVFPTQGTWSA
FT                   KEQSNQQLSFSGLPATCIYTSHKAFFPKS"
FT   assembly_gap    10236528..10236547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10250051..10250463
FT                   /pseudo
FT                   /locus_tag="mCG_62273"
FT                   /note="gene_id=mCG62273.2"
FT   mRNA            10250051..10250463
FT                   /pseudo
FT                   /locus_tag="mCG_62273"
FT                   /note="gene_id=mCG62273.2 transcript_id=mCT62456.2 created
FT                   on 15-AUG-2002"
FT   assembly_gap    10251986..10252047
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    10270044..10270245
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    10277572..10277591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10279918..10280965
FT                   /estimated_length=1048
FT                   /gap_type="unknown"
FT   assembly_gap    10284578..10286863
FT                   /estimated_length=2286
FT                   /gap_type="unknown"
FT   assembly_gap    10291686..10291705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10294499..10294518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10302176..10302195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10304536..10304555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10306727..10307003
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    10322962..10323232
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    10328156..10328388
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    10329034..10330752
FT                   /estimated_length=1719
FT                   /gap_type="unknown"
FT   assembly_gap    10331627..10331967
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   gene            10338887..10340128
FT                   /pseudo
FT                   /locus_tag="mCG_4204"
FT                   /note="gene_id=mCG4204.1"
FT   mRNA            10338887..10340128
FT                   /pseudo
FT                   /locus_tag="mCG_4204"
FT                   /note="gene_id=mCG4204.1 transcript_id=mCT3448.1 created on
FT                   12-AUG-2002"
FT   assembly_gap    10355566..10355585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <10356756..10357623
FT                   /locus_tag="mCG_1030980"
FT                   /note="gene_id=mCG1030980.1"
FT   mRNA            <10356756..10357623
FT                   /locus_tag="mCG_1030980"
FT                   /product="mCG1030980"
FT                   /note="gene_id=mCG1030980.1 transcript_id=mCT148684.1
FT                   created on 16-AUG-2002"
FT   CDS             <10356756..10357136
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030980"
FT                   /product="mCG1030980"
FT                   /note="gene_id=mCG1030980.1 transcript_id=mCT148684.1
FT                   protein_id=mCP70015.1"
FT                   /protein_id="EDL14070.1"
FT                   /translation="GQSLESSAMARVAKKVHWSRAATAVAATAKAKRSKLKKTAAKRSK
FT                   LKKTAAKRFKLNKKRNPRSKLPKRSHHSLIHSFIRSRSCGCCHCCCHCCCLHSRPSYRK
FT                   STFKVRYPKLSSFTPFFGHSFP"
FT   assembly_gap    10369676..10372961
FT                   /estimated_length=3286
FT                   /gap_type="unknown"
FT   assembly_gap    10374334..10374353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10376309..10376372
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    10381391..10381778
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   assembly_gap    10382941..10387219
FT                   /estimated_length=4279
FT                   /gap_type="unknown"
FT   assembly_gap    10393837..10393945
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    10409153..10409172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10410984..10411666
FT                   /estimated_length=683
FT                   /gap_type="unknown"
FT   assembly_gap    10415208..10415227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10421965..10422001
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    10430300..10430319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10441489..10442294
FT                   /estimated_length=806
FT                   /gap_type="unknown"
FT   assembly_gap    10445526..10446308
FT                   /estimated_length=783
FT                   /gap_type="unknown"
FT   assembly_gap    10450061..10450080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10461517..10461818
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    10463867..10463886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10465166..10466115
FT                   /estimated_length=950
FT                   /gap_type="unknown"
FT   assembly_gap    10467459..10467478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10468606..10474534
FT                   /estimated_length=5929
FT                   /gap_type="unknown"
FT   assembly_gap    10475766..10475785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10479477..10486071
FT                   /estimated_length=6595
FT                   /gap_type="unknown"
FT   assembly_gap    10489072..10489765
FT                   /estimated_length=694
FT                   /gap_type="unknown"
FT   assembly_gap    10491425..10491444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10496041..10496060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10512938..10514701
FT                   /estimated_length=1764
FT                   /gap_type="unknown"
FT   assembly_gap    10520502..10520601
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    10521742..10522290
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   assembly_gap    10524095..10524114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10531474..10531493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10537885..10538245
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    10542705..10543065
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   gene            10551242..10552778
FT                   /pseudo
FT                   /locus_tag="mCG_63954"
FT                   /note="gene_id=mCG63954.2"
FT   mRNA            10551242..10552778
FT                   /pseudo
FT                   /locus_tag="mCG_63954"
FT                   /note="gene_id=mCG63954.2 transcript_id=mCT64137.2 created
FT                   on 16-AUG-2002"
FT   assembly_gap    10552782..10553496
FT                   /estimated_length=715
FT                   /gap_type="unknown"
FT   assembly_gap    10557559..10557919
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    10561841..10562043
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    10565907..10566170
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   gene            10570325..10571314
FT                   /pseudo
FT                   /locus_tag="mCG_1030977"
FT                   /note="gene_id=mCG1030977.1"
FT   mRNA            10570325..10571314
FT                   /pseudo
FT                   /locus_tag="mCG_1030977"
FT                   /note="gene_id=mCG1030977.1 transcript_id=mCT148681.1
FT                   created on 16-AUG-2002"
FT   assembly_gap    10574769..10574950
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    10579144..10579304
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    10586703..10587674
FT                   /estimated_length=972
FT                   /gap_type="unknown"
FT   assembly_gap    10588081..10588516
FT                   /estimated_length=436
FT                   /gap_type="unknown"
FT   gene            complement(10588871..10589375)
FT                   /pseudo
FT                   /locus_tag="mCG_118338"
FT                   /note="gene_id=mCG118338.1"
FT   mRNA            complement(10588871..10589375)
FT                   /pseudo
FT                   /locus_tag="mCG_118338"
FT                   /note="gene_id=mCG118338.1 transcript_id=mCT119493.1
FT                   created on 12-AUG-2002"
FT   assembly_gap    10590236..10591760
FT                   /estimated_length=1525
FT                   /gap_type="unknown"
FT   assembly_gap    10594507..10594736
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    10596743..10596840
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    10599004..10599023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10600499..10600518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10601867..10601911
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    10610235..10610318
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   gene            10614799..10624261
FT                   /gene="Fgf16"
FT                   /locus_tag="mCG_13799"
FT                   /note="gene_id=mCG13799.2"
FT   mRNA            join(10614799..10615080,10622583..10622686,
FT                   10624000..10624261)
FT                   /gene="Fgf16"
FT                   /locus_tag="mCG_13799"
FT                   /product="fibroblast growth factor 16"
FT                   /note="gene_id=mCG13799.2 transcript_id=mCT17632.2 created
FT                   on 07-AUG-2002"
FT   CDS             join(10614807..10615080,10622583..10622686,
FT                   10624000..10624245)
FT                   /codon_start=1
FT                   /gene="Fgf16"
FT                   /locus_tag="mCG_13799"
FT                   /product="fibroblast growth factor 16"
FT                   /note="gene_id=mCG13799.2 transcript_id=mCT17632.2
FT                   protein_id=mCP3574.1"
FT                   /db_xref="GOA:Q9ESL8"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028285"
FT                   /db_xref="MGI:MGI:1931627"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ESL8"
FT                   /protein_id="EDL14069.1"
FT                   /translation="MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKL
FT                   QRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLI
FT                   SIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYV
FT                   ALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFRYR"
FT   assembly_gap    10615107..10615197
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    10616058..10616113
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    10619698..10619755
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    10633860..10634271
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    10638336..10638355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10639925..10639971
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   gene            complement(10647872..10779449)
FT                   /gene="Atrx"
FT                   /locus_tag="mCG_118340"
FT                   /note="gene_id=mCG118340.1"
FT   mRNA            complement(join(10647872..10650739,10651631..10651759,
FT                   10652264..10652359,10652973..10653098,10654067..10654216,
FT                   10668297..10668491,10669608..10669785,10671041..10671149,
FT                   10673974..10674080,10676364..10676517,10681111..10681283,
FT                   10681458..10681537,10682710..10682840,10686574..10686691,
FT                   10688600..10688775,10690251..10690388,10695628..10695805,
FT                   10695926..10696016,10696780..10696891,10697678..10697819,
FT                   10701259..10701492,10702187..10702289,10703506..10703599,
FT                   10706086..10706259,10706686..10706846,10718122..10718194,
FT                   10724889..10726318,10726339..10727835,10728629..10728696,
FT                   10730171..10730280,10734569..10734682,10737977..10738101,
FT                   10739255..10739307,10741179..10741234,10750144..10750256,
FT                   10779207..10779449))
FT                   /gene="Atrx"
FT                   /locus_tag="mCG_118340"
FT                   /product="alpha thalassemia/mental retardation syndrome
FT                   X-linked homolog (human)"
FT                   /note="gene_id=mCG118340.1 transcript_id=mCT119495.1
FT                   created on 07-AUG-2002"
FT   CDS             complement(join(10650458..10650739,10651631..10651759,
FT                   10652264..10652359,10652973..10653098,10654067..10654216,
FT                   10668297..10668491,10669608..10669785,10671041..10671149,
FT                   10673974..10674080,10676364..10676517,10681111..10681283,
FT                   10681458..10681537,10682710..10682840,10686574..10686691,
FT                   10688600..10688775,10690251..10690388,10695628..10695805,
FT                   10695926..10696016,10696780..10696891,10697678..10697819,
FT                   10701259..10701492,10702187..10702289,10703506..10703599,
FT                   10706086..10706259,10706686..10706846,10718122..10718194,
FT                   10724889..10726318,10726339..10727835,10728629..10728696,
FT                   10730171..10730280,10734569..10734682,10737977..10738101,
FT                   10739255..10739307,10741179..10741234,10750144..10750256,
FT                   10779207..10779226))
FT                   /codon_start=1
FT                   /gene="Atrx"
FT                   /locus_tag="mCG_118340"
FT                   /product="alpha thalassemia/mental retardation syndrome
FT                   X-linked homolog (human)"
FT                   /note="gene_id=mCG118340.1 transcript_id=mCT119495.1
FT                   protein_id=mCP69747.1"
FT                   /protein_id="EDL14068.1"
FT                   /translation="MTAEPMSGNKLSTLVQKLHDFLAHSSEESEETCSSPRLVMNQSTD
FT                   KICGSGLNSDMMENNKEEGASTSEKSRSSGSSRSKRKPSIVTKYVESDDEKPTDENVNE
FT                   KAATENSENDITMQSLPKGTVIVQPEPVLNEDKDDFKGPEFRSRSKMKADNLKKRGEDG
FT                   LHGIVSCTACGQQVNHFQKDSIYRHPSLKVLICKNCFKYYMSDDISRDSDGMDEQCRWC
FT                   AEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICQPEPLLDLVTACNS
FT                   VFENLEQLLQQNKKKIKVDSEKTSKVCDQTSKFSPKKSSSSCNGEEKKLEESCSGSVSS
FT                   TYSHSALSVPKEMIKKTTKLIETTSNMNSSYIKFLKQAADNSEMTSAMKLCQLKSFKSV
FT                   LDDIKKAHLALEEDLNSEIQALDDVHKEKNTKDLKSTDAKSETKLGKGEKSYSTEKREF
FT                   LKLDARSSVKAIDGEEQRAHKSTSGEHKGSGRKDGSQYEPTNTPEDLDMDIVSVPSSVP
FT                   EDIFDSLESAMEVQSSADYQGDGNSGTEPELESSSVKLNVSSKDSRGNIKSKVTAKVRK
FT                   ELFVKLTPVSLSNSPIKGVDCQEVSQEKNGRKSSGVARSSEKCRPREEISDHENNVTIL
FT                   LEDSDLRRSPRVKTTPLRRQTESNPAMSNSDEESNGTMKEKQKMSGPIRKKDKRNSADC
FT                   ATDNPKPHKVPKAKQPVIGDQNSDSHKGKTGKDDNGKRKRKNSTSGSDFDTKKGKSTET
FT                   SIISKKKRQNYSESSNYDSELEREIKTMSRIGAARKSVPEKKEEDSSEDEKQGKKVVDN
FT                   GGHERAKTTQEGSSADDTGDTEGRQGGSCSIAGGSIEKVRSGVEFREMLCKPGVSSDGA
FT                   EKPSVKEENVNSPEDKRVSKTKEKTKHLRSRQSRKGKGGSSDGTDRFPKKEQSDESSEG
FT                   EKKQSRQRPGTKGKKAPDLKGETLKREQEWDSSSDGTERLPEEEEIGPFSKGIKQSKTD
FT                   TAGGEKKGKKWKDKSCEKKEELSDSVDKLPGKGDSCDSSEDKKTRNRVSLREKKRFSLP
FT                   AKSPGKRPECSSSDTEKSLKGQCCDSTEKRPKRIDLRERRNSSSKRNTKEVKSASSSSD
FT                   AEGSSEDNKKQKKQRTSAKKKTGNTKEKKRNSLRATPKRKQVDITSSSSDIGDDDQNSA
FT                   GEESSDEQKIKPVTENLVLPSHTGFCQSSGDEALSKSVPATVDDDDDDNDPENRIAKKM
FT                   LLEEIKANLSSDEDGSSDDEPDGGGKKRIGKQSEESPADDGELRREQLAVNQVNSESDS
FT                   DSEESKKPRYRHRLLRHKLTLSDGESGEEKPTKPKEHKEAKGRNRRKVSSEDSEDTDFQ
FT                   ESGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQKKKRRRIKVQEDSSSENKSHSEE
FT                   DKKEGDEEDEEDEDEDEEDENDDSKSPGKGRKKIRKILKDDKLRTETQNALKEEEERRK
FT                   RIAEREREREKLREVIEIEDASPTKCPITTKLVLDENEETKEPLVQVHRNMVIKLKPHQ
FT                   VDGVQFMWDCCCESVEKTKKSPGSGCILAHCMGLGKTLQVFSGLSSYTALNWMNEFEKW
FT                   QEGLNDNEKLEVSELATVKRPQERSYMLQRWQEDGGVMIIGYEMYRNLAQGRNVKSRKL
FT                   KDIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIKSRRRIILTGTPLQNNLIEYH
FT                   CMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILYEMLAGCVQRK
FT                   DYTALTKFLPPKHEYVLAVRMTAIQCKLYQYYLDHLTGVGNSTEGGRGKAGAKLFQDFQ
FT                   MLSRIWTHPWCLQLDYISKENKGYFDEDSMDEFIASDSDETSKSLSSDEKKKPKGKKGK
FT                   KDSSSSGSGSDNDVEVIKVWNSRSRGGGDGNMDDTGNNPSVSLKLDESKTTSTSNPSSP
FT                   APDWYKDFVTDTDAEVLEHSGKMVLLFEILRMAEEIGDKVLVFSQSLISLDLIEDFLEL
FT                   ASREKTEDKEKPLIYKGEGKWIRNIDYYRLDGSTNAQSRKKWAEEFNDETNVRGRLFII
FT                   STKAGSLGINLVAANRVIIFDASWNPSYDIQSIFRVYRFGQTKPVYVYRFLAQGTMEDK
FT                   IYDRQVTKQSLSFRVVDQQQVERHFTMNELTELYTFEPDLLDDPNSEKKKKRDTPMLPK
FT                   DTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKAAWAEYEAEKKGLTMRFNIP
FT                   TGTNLPPVTFTSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSMTAVRIQPLE
FT                   DIISTVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLINCVQRILM
FT                   NRRLQQQYTQQQQQQLTYQQATLSHLMMPKPPNLIMTPSNYQQIDMRGMYQSVAGGMQP
FT                   PPLQRAPPPTVRSKNPGPSPGKSM"
FT   assembly_gap    10687027..10687184
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    10690115..10690134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10691403..10691677
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   gene            complement(10694533..10695145)
FT                   /pseudo
FT                   /locus_tag="mCG_13798"
FT                   /note="gene_id=mCG13798.2"
FT   mRNA            complement(10694533..10695145)
FT                   /pseudo
FT                   /locus_tag="mCG_13798"
FT                   /note="gene_id=mCG13798.2 transcript_id=mCT17631.2 created
FT                   on 12-AUG-2002"
FT   assembly_gap    10696024..10696043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10699863..10699998
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    10719169..10719194
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    10721392..10721697
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    10726319..10726338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10754183..10754334
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    10758042..10758066
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    10766744..10766763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10767907..10768012
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    10772035..10772123
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    10774316..10774341
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    10778748..10778767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10783333..10783352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10789346..10789512
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    10807174..10807653
FT                   /estimated_length=480
FT                   /gap_type="unknown"
FT   assembly_gap    10808791..10809929
FT                   /estimated_length=1139
FT                   /gap_type="unknown"
FT   assembly_gap    10811504..10811831
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    10813320..10813545
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    10814854..10815335
FT                   /estimated_length=482
FT                   /gap_type="unknown"
FT   gene            complement(10818042..10819443)
FT                   /locus_tag="mCG_147480"
FT                   /note="gene_id=mCG147480.0"
FT   mRNA            complement(10818042..10819443)
FT                   /locus_tag="mCG_147480"
FT                   /product="mCG147480"
FT                   /note="gene_id=mCG147480.0 transcript_id=mCT187743.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10818709..10818813)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147480"
FT                   /product="mCG147480"
FT                   /note="gene_id=mCG147480.0 transcript_id=mCT187743.0
FT                   protein_id=mCP108719.0"
FT                   /protein_id="EDL14067.1"
FT                   /translation="MGVSTCVLSQCTRETDGNQKFTLILEHSVSIRPT"
FT   gene            complement(10820437..10861768)
FT                   /gene="2610529C04Rik"
FT                   /locus_tag="mCG_13793"
FT                   /note="gene_id=mCG13793.2"
FT   mRNA            complement(join(10820437..10821439,10824177..10824267,
FT                   10829391..10829465,10833690..10833753,10834346..10834435,
FT                   10838916..10839056,10839335..10839475,10842343..10842460,
FT                   10846783..10846952,10861532..10861768))
FT                   /gene="2610529C04Rik"
FT                   /locus_tag="mCG_13793"
FT                   /product="RIKEN cDNA 2610529C04, transcript variant
FT                   mCT17449"
FT                   /note="gene_id=mCG13793.2 transcript_id=mCT17449.2 created
FT                   on 07-AUG-2002"
FT   mRNA            complement(join(10820438..10820986,10821396..10821439,
FT                   10824177..10824267,10829391..10829465,10833690..10833753,
FT                   10834346..10834435,10838916..10839056,10839335..10839475,
FT                   10842343..10842460,10846783..10846952,10861532..>10861656))
FT                   /gene="2610529C04Rik"
FT                   /locus_tag="mCG_13793"
FT                   /product="RIKEN cDNA 2610529C04, transcript variant
FT                   mCT190746"
FT                   /note="gene_id=mCG13793.2 transcript_id=mCT190746.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(10821424..10821439,10824177..10824267,
FT                   10829391..10829465,10833690..10833753,10834346..10834435,
FT                   10838916..10839056,10839335..10839475,10842343..10842460,
FT                   10846783..10846952,10861532..10861732))
FT                   /codon_start=1
FT                   /gene="2610529C04Rik"
FT                   /locus_tag="mCG_13793"
FT                   /product="RIKEN cDNA 2610529C04, isoform CRA_b"
FT                   /note="gene_id=mCG13793.2 transcript_id=mCT17449.2
FT                   protein_id=mCP3579.2 isoform=CRA_b"
FT                   /db_xref="GOA:A2ADH1"
FT                   /db_xref="InterPro:IPR006844"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR021149"
FT                   /db_xref="MGI:MGI:1914325"
FT                   /db_xref="UniProtKB/TrEMBL:A2ADH1"
FT                   /protein_id="EDL14066.1"
FT                   /translation="MGSGKGSVRPFSRPTLGPCWKKVSPRRQERSVNMASPRWFWSVCA
FT                   IAAVALLLVSKVPSASAQRKKEMVLSEKVSQLMEWANKRPVIRMNGDKFRRLVKAPPRN
FT                   YSVVVMFTALQLHRQCVVCKQADEEFQILANSWRYSNAFTNRIFFAMVDFDEGSDVFQM
FT                   LNMNSAPTFINFPPKGKPKRADTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGP
FT                   LMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKN
FT                   PHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRRMMCIAGI
FT                   GLVVLFFSWMLSIFRSKYHGYPYSFLMS"
FT   CDS             complement(join(10821424..10821439,10824177..10824267,
FT                   10829391..10829465,10833690..10833753,10834346..10834435,
FT                   10838916..10839056,10839335..10839475,10842343..10842460,
FT                   10846783..10846952,10861532..>10861654))
FT                   /codon_start=1
FT                   /gene="2610529C04Rik"
FT                   /locus_tag="mCG_13793"
FT                   /product="RIKEN cDNA 2610529C04, isoform CRA_a"
FT                   /note="gene_id=mCG13793.2 transcript_id=mCT190746.0
FT                   protein_id=mCP111715.0 isoform=CRA_a"
FT                   /protein_id="EDL14065.1"
FT                   /translation="RQERSVNMASPRWFWSVCAIAAVALLLVSKVPSASAQRKKEMVLS
FT                   EKVSQLMEWANKRPVIRMNGDKFRRLVKAPPRNYSVVVMFTALQLHRQCVVCKQADEEF
FT                   QILANSWRYSNAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPPKGKPKRADTYEL
FT                   QVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFN
FT                   KTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLL
FT                   FNGGVTLGMVLLCEAATSDMDIGKRRMMCIAGIGLVVLFFSWMLSIFRSKYHGYPYSFL
FT                   MS"
FT   assembly_gap    10823203..10823563
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    10831567..10831728
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    10834676..10834773
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    10848309..10848328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10850093..10850112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10852356..10852375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10865621..10871828
FT                   /locus_tag="mCG_13797"
FT                   /note="gene_id=mCG13797.1"
FT   mRNA            join(10865621..10865742,10869450..10869574,
FT                   10871617..10871828)
FT                   /locus_tag="mCG_13797"
FT                   /product="mCG13797, transcript variant mCT17453"
FT                   /note="gene_id=mCG13797.1 transcript_id=mCT17453.1 created
FT                   on 07-AUG-2002"
FT   mRNA            join(10865629..10865742,10865977..10866094,
FT                   10869450..10869574,10871617..10871821)
FT                   /locus_tag="mCG_13797"
FT                   /product="mCG13797, transcript variant mCT171575"
FT                   /note="gene_id=mCG13797.1 transcript_id=mCT171575.0 created
FT                   on 07-AUG-2002"
FT   CDS             join(10865703..10865742,10869450..10869574,
FT                   10871617..10871694)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13797"
FT                   /product="mCG13797, isoform CRA_b"
FT                   /note="gene_id=mCG13797.1 transcript_id=mCT17453.1
FT                   protein_id=mCP3572.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q5FW98"
FT                   /db_xref="InterPro:IPR008433"
FT                   /db_xref="InterPro:IPR023272"
FT                   /db_xref="MGI:MGI:1913392"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FW98"
FT                   /protein_id="EDL14064.1"
FT                   /translation="MLPLAKNALSRLQVRSIQQVVARQSHQKRAPSFHDKYGNAILAGG
FT                   AIFCVSTWTYTATQIGIEWNMSPVGRVTPKEWRDQ"
FT   CDS             join(10865703..10865742,10865977..10866038)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13797"
FT                   /product="mCG13797, isoform CRA_a"
FT                   /note="gene_id=mCG13797.1 transcript_id=mCT171575.0
FT                   protein_id=mCP94494.0 isoform=CRA_a"
FT                   /protein_id="EDL14063.1"
FT                   /translation="MLPLAKNALSRLQETYDFQEERFGGHLALLAMI"
FT   gene            10877033..10978329
FT                   /gene="Atp7a"
FT                   /locus_tag="mCG_117799"
FT                   /note="gene_id=mCG117799.0"
FT   mRNA            join(10877033..10877318,10919752..10919889,
FT                   10935517..10936006,10936492..10937217,10938738..10938920,
FT                   10942471..10942634,10945239..10945400,10946648..10946724,
FT                   10947724..10947953,10948912..10949168,10950678..10950769,
FT                   10952011..10952138,10952489..10952643,10952854..10952988,
FT                   10955274..10955468,10957310..10957492,10959887..10960103,
FT                   10965238..10965384,10968400..10968542,10970384..10970587,
FT                   10971739..10971860,10973504..10973608,10974500..10974871,
FT                   10974906..10978329)
FT                   /gene="Atp7a"
FT                   /locus_tag="mCG_117799"
FT                   /product="ATPase, Cu++ transporting, alpha polypeptide,
FT                   transcript variant mCT118945"
FT                   /note="gene_id=mCG117799.0 transcript_id=mCT118945.1
FT                   created on 07-AUG-2002"
FT   mRNA            join(<10877185..10877250,10919752..10919889,
FT                   10935517..10936006,10936492..10937217,10938741..10938920,
FT                   10942471..10942634,10945239..10945400,10946648..10946724,
FT                   10947724..10947949,10948935..10949168,10950678..10950769,
FT                   10952011..10952138,10952489..10952643,10952854..10952988,
FT                   10955274..10955468,10957310..10957492,10959887..10960103,
FT                   10965238..10965384,10968400..10968542,10970384..10970587,
FT                   10971739..10971856,10973504..10973606,10974500..10975109)
FT                   /gene="Atp7a"
FT                   /locus_tag="mCG_117799"
FT                   /product="ATPase, Cu++ transporting, alpha polypeptide,
FT                   transcript variant mCT190750"
FT                   /note="gene_id=mCG117799.0 transcript_id=mCT190750.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<10877185..10877250,10919752..10919889,
FT                   10935517..10936006,10936492..10937217,10938741..10938920,
FT                   10942471..10942634,10945239..10945400,10946648..10946724,
FT                   10947724..10947949,10948935..10949168,10950678..10950769,
FT                   10952011..10952138,10952489..10952643,10952854..10952988,
FT                   10955274..10955468,10957310..10957492,10959887..10960103,
FT                   10965238..10965384,10968400..10968542,10970384..10970587,
FT                   10971739..10971856,10973504..10973606,10974500..10974776)
FT                   /codon_start=1
FT                   /gene="Atp7a"
FT                   /locus_tag="mCG_117799"
FT                   /product="ATPase, Cu++ transporting, alpha polypeptide,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG117799.0 transcript_id=mCT190750.0
FT                   protein_id=mCP111707.0 isoform=CRA_b"
FT                   /protein_id="EDL14062.1"
FT                   /translation="GQSLPPCALRSSRARTPALETQECKDIKMEPSVDANSITITVEGM
FT                   TCISCVRTIEQQIGKVNGVHHIKVSLEEKSATIIYDPKLQTPKTLQEAIDDMGFDALLH
FT                   NANPLPVLTNTVFLTVTAPLTLPWDHIQSTLLKTKGVTGVKISPQQRSAVVTIIPSVVS
FT                   ASQIVELVPDLSLDMGTQEKKSGACEEHSTPQAGEVMLKMKVEGMTCHSCTSTIEGKVG
FT                   KLQGVQRIKVSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFIKKQPKYLKLGAIDVE
FT                   RLKNTPVKSSEGSQQKSPSYPSDSTTMFTIEGMHCKSCVSNIESALSTLQYVSSIVVSL
FT                   ENRSAIVKYNASLVTPEMLRKAIEAISPGQYRVSIASEVESTASSPSSSSLQKMPLNIV
FT                   SQPLTQEAVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPET
FT                   LREAIEDMGFDAALPDMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMT
FT                   CASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFGAMVME
FT                   NAGEGNGILELVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPR
FT                   DIIHTIGSLGFEASLVKKDRSANHLDHKREIKQWRGSFLVSLFFCIPVMGLMVYMMVMD
FT                   HHLATLHHNQNMSNEEMINMHSAMFLERQILPGLSIMNLLSLLLCLPVQFCGGWYFYIQ
FT                   AYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMFERAKVNPITFFDTPPMLFVFIAL
FT                   GRWLEHIAKGKTSEALAKLISLQATEATIVTLNSENLLLSEEQVDVELVQRGDIIKVVP
FT                   GGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLIRATHVGADT
FT                   TLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVLVSIVTLLVWIIIGFQNFEIVETY
FT                   FPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGG
FT                   EPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLVESNKISRNKILAIVGTAESNSEHPL
FT                   GAAVTKYCKKELDTETLGTCTDFQVVPGCGISCKVTNIEGLLHKSNLKIEENNIKNASL
FT                   VQIDAINEQSSTSSSMIIDAHLSNAVNTQQYKVLIGNREWMIRNGLVISNDVDESMIEH
FT                   ERRGRTAVLVTIDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIA
FT                   SQVGITKVFAEVLPSHKVAKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIGTGTDV
FT                   AIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFLPIGLV
FT                   LQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYDNYELHPRSHTGQRSPSEISVHVGIDD
FT                   TSRNSPRLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTTL"
FT   assembly_gap    10881270..10881316
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    10897658..10897761
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    10900082..10900101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10905901..10905920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(10919770..10919889,10935517..10936006,
FT                   10936492..10937217,10938738..10938920,10942471..10942634,
FT                   10945239..10945400,10946648..10946724,10947724..10947953,
FT                   10948912..10949168,10950678..10950769,10952011..10952138,
FT                   10952489..10952643,10952854..10952988,10955274..10955468,
FT                   10957310..10957492,10959887..10960103,10965238..10965384,
FT                   10968400..10968542,10970384..10970587,10971739..10971860,
FT                   10973504..10973608,10974500..10974776)
FT                   /codon_start=1
FT                   /gene="Atp7a"
FT                   /locus_tag="mCG_117799"
FT                   /product="ATPase, Cu++ transporting, alpha polypeptide,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG117799.0 transcript_id=mCT118945.1
FT                   protein_id=mCP69896.1 isoform=CRA_a"
FT                   /protein_id="EDL14061.1"
FT                   /translation="MEPSVDANSITITVEGMTCISCVRTIEQQIGKVNGVHHIKVSLEE
FT                   KSATIIYDPKLQTPKTLQEAIDDMGFDALLHNANPLPVLTNTVFLTVTAPLTLPWDHIQ
FT                   STLLKTKGVTGVKISPQQRSAVVTIIPSVVSASQIVELVPDLSLDMGTQEKKSGACEEH
FT                   STPQAGEVMLKMKVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVFQPHLITA
FT                   EEIKKQIEAVGFPAFIKKQPKYLKLGAIDVERLKNTPVKSSEGSQQKSPSYPSDSTTMF
FT                   TIEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIEAISP
FT                   GQYRVSIASEVESTASSPSSSSLQKMPLNIVSQPLTQEAVININGMTCNSCVQSIEGVI
FT                   SKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPADMKEPLVVIAQP
FT                   SLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMA
FT                   GKAEVRYNPAVIQPRVIAEFIRELGFGAMVMENAGEGNGILELVVRGMTCASCVHKIES
FT                   TLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGSLGFEASLVKKDRSANHLDH
FT                   KREIKQWRGSFLVSLFFCIPVMGLMVYMMVMDHHLATLHHNQNMSNEEMINMHSAMFLE
FT                   RQILPGLSIMNLLSLLLCLPVQAIIFTLLLQFCGGWYFYIQAYKALKHKTANMDVLIVL
FT                   ATTIAFAYSLVILLVAMFERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAK
FT                   LISLQATEATIVTLNSENLLLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVD
FT                   ESLITGEAMPVAKKPGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAP
FT                   IQQFADKLSGYFVPFIVLVSIVTLLVWIIIGFQNFEIVETYFPGYNRSISRTETIIRFA
FT                   FQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTG
FT                   TITHGTPVVNQVKVLVESNKISRNKILAIVGTAESNSEHPLGAAVTKYCKKELDTETLG
FT                   TCTDFQVVPGCGISCKVTNIEGLLHKSNLKIEENNIKNASLVQIDAINEQSSTSSSMII
FT                   DAHLSNAVNTQQYKVLIGNREWMIRNGLVISNDVDESMIEHERRGRTAVLVTIDDELCG
FT                   LIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKV
FT                   AKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVV
FT                   ASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGMSFPAHRFGFTTLDGIRSNGRFICLC
FT                   SPFFPFPQAVYRKPTYDNYELHPRSHTGQRSPSEISVHVGIDDTSRNSPRLGLLDRIVN
FT                   YSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTTL"
FT   assembly_gap    10940531..10940550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10945751..10945770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10947056..10947075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10953707..10953726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10960374..10960393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10993446..11010599
FT                   /gene="Tlr13"
FT                   /locus_tag="mCG_13801"
FT                   /note="gene_id=mCG13801.2"
FT   mRNA            join(10993446..10993492,10997494..10997661,
FT                   11006801..11010599)
FT                   /gene="Tlr13"
FT                   /locus_tag="mCG_13801"
FT                   /product="toll-like receptor 13"
FT                   /note="gene_id=mCG13801.2 transcript_id=mCT17634.2 created
FT                   on 12-AUG-2002"
FT   assembly_gap    10994188..10994345
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   CDS             join(10997626..10997661,11006801..11009740)
FT                   /codon_start=1
FT                   /gene="Tlr13"
FT                   /locus_tag="mCG_13801"
FT                   /product="toll-like receptor 13"
FT                   /note="gene_id=mCG13801.2 transcript_id=mCT17634.2
FT                   protein_id=mCP3576.1"
FT                   /db_xref="GOA:Q6R5N8"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:3045213"
FT                   /db_xref="PDB:4Z0C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6R5N8"
FT                   /protein_id="EDL14060.1"
FT                   /translation="MSGLYRILVQLEQSPYVKTVPLNMRRDFFFLVVTWMPKTVKMNGS
FT                   SFVPSLQLLLMLVGFSLPPVAETYGFNKCTQYEFDIHHVLCIRKKITNLTEAISDIPRY
FT                   TTHLNLTHNEIQVLPPWSFTNLSALVDLRLEWNSIWKIDEGAFRGLENLTLLNLVENKI
FT                   QSVNNSFEGLSSLKTLLLSHNQITHIHKDAFTPLIKLKYLSLSRNNISDFSGILEAVQH
FT                   LPCLERLDLTNNSIMYLDHSPRSLVSLTHLSFEGNKLRELNFSALSLPNLTNLSASRNG
FT                   NKVIQNVYLKTLPQLKSLNLSGTVIKLENLSAKHLQNLRAMDLSNWELRHGHLDMKTVC
FT                   HLLGNLPKLETLVFQKNVTNAEGIKQLAKCTRLLFLDLGQNSDLIYLNDSEFNALPSLQ
FT                   KLNLNKCQLSFINNRTWSSLQNLTSLDLSHNKFKSFPDFAFSPLKHLEFLSLSRNPITE
FT                   LNNLAFSGLFALKELNLAACWIVTIDRYSFTQFPNLEVLDLGDNNIRTLNHGTFRPLKK
FT                   LQSLILSHNCLKILEPNSFSGLTNLRSLDLMYNSLSYFHEHLFSGLEKLLILKLGFNKI
FT                   TYETTRTLQYPPFIKLKSLKQLNLEGQRHGIQVVPSNFFQGLGSLQELLLGKNPSVFLD
FT                   HHQFDPLINLTKLDISGTKDGDRSLYLNASLFQNLKRLKILRLENNNLESLVPDMFSSL
FT                   QSLQVFSLRFNNLKVINQSHLKNLKSLMFFDVYGNKLQCTCDNLWFKNWSMNTEEVHIP
FT                   FLRSYPCQQPGSQSLLIDFDDAMCNFDLGKVYFLCSFSMVLSTMVFSWFSTKMIASLWY
FT                   GLYICRAWYLTKWHKTEKKFLYDAFVSFSATDEAWVYKELVPALEQGSQTTFKLCLHQR
FT                   DFEPGIDIFENIQNAINTSRKTLCVVSNHYLHSEWCRLEVQLASMKMFYEHKDVIILIF
FT                   LEEIPNYKLSSYHRLRKLINKQTFITWPDSVHQQPLFWARIRNALGKETVEKENTHLIV
FT                   VE"
FT   assembly_gap    11003714..11004083
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    11011020..11012391
FT                   /estimated_length=1372
FT                   /gap_type="unknown"
FT   assembly_gap    11022146..11022165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11023979..11024032
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    11028850..11028869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11032586..11032605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11033795..11033814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11036487..11036687
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   gene            11036704..11053145
FT                   /locus_tag="mCG_117788"
FT                   /note="gene_id=mCG117788.1"
FT   mRNA            join(11036704..11036863,11041555..11041605,
FT                   11043840..11043995,11044116..11044260,11046327..11046430,
FT                   11047326..11047445,11049131..11049245,11049641..11049820,
FT                   11051923..11052100,11052321..11052419,11052723..11053145)
FT                   /locus_tag="mCG_117788"
FT                   /product="mCG117788"
FT                   /note="gene_id=mCG117788.1 transcript_id=mCT118934.1
FT                   created on 07-AUG-2002"
FT   CDS             join(11036799..11036863,11041555..11041605,
FT                   11043840..11043995,11044116..11044260,11046327..11046430,
FT                   11047326..11047445,11049131..11049245,11049641..11049820,
FT                   11051923..11052100,11052321..11052419,11052723..11052763)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117788"
FT                   /product="mCG117788"
FT                   /note="gene_id=mCG117788.1 transcript_id=mCT118934.1
FT                   protein_id=mCP69840.1"
FT                   /protein_id="EDL14059.1"
FT                   /translation="MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVP
FT                   SIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAAELKSLLGKDVLFLKDCVGPEV
FT                   ENACANPAAGTVILLENLRFHVEEEGKGKDASGNKVKAEPAKIDAFRASLSKLGDVYVN
FT                   DAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQ
FT                   LINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLYDEEGAKIVKDLMSKAEKNGVKIT
FT                   LPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGTESSKKYAEAVGRAKQIVWNGPV
FT                   GVFEWEAFARGTKSLMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGAS
FT                   LELLEGKVLPGVDALSNV"
FT   assembly_gap    11042843..11042862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11053861..11053880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11057850..11069452)
FT                   /gene="Taf9b"
FT                   /locus_tag="mCG_68099"
FT                   /note="gene_id=mCG68099.2"
FT   mRNA            complement(join(11057850..11057921,11065967..11066012,
FT                   11067778..11067912,11067991..11068127,11068577..11068658,
FT                   11069256..11069452))
FT                   /gene="Taf9b"
FT                   /locus_tag="mCG_68099"
FT                   /product="TAF9B RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor, transcript variant mCT171942"
FT                   /note="gene_id=mCG68099.2 transcript_id=mCT171942.1 created
FT                   on 13-FEB-2003"
FT   mRNA            complement(join(11057850..11057921,11065967..11066012,
FT                   11067778..11067912,11067991..11068127,11068577..11068658,
FT                   11069264..11069418))
FT                   /gene="Taf9b"
FT                   /locus_tag="mCG_68099"
FT                   /product="TAF9B RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor, transcript variant mCT180233"
FT                   /note="gene_id=mCG68099.2 transcript_id=mCT180233.0 created
FT                   on 13-FEB-2003"
FT   mRNA            complement(join(11057851..11058187,11059237..11059347,
FT                   11065943..11066012,11067778..11067912,11067991..11068127,
FT                   11068577..11068658,11069256..11069452))
FT                   /gene="Taf9b"
FT                   /locus_tag="mCG_68099"
FT                   /product="TAF9B RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor, transcript variant mCT68284"
FT                   /note="gene_id=mCG68099.2 transcript_id=mCT68284.3 created
FT                   on 13-FEB-2003"
FT   CDS             complement(join(11057857..11057921,11065967..11066012,
FT                   11067778..11067912,11067991..11068127,11068577..11068658,
FT                   11069256..11069315))
FT                   /codon_start=1
FT                   /gene="Taf9b"
FT                   /locus_tag="mCG_68099"
FT                   /product="TAF9B RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor, isoform CRA_c"
FT                   /note="gene_id=mCG68099.2 transcript_id=mCT171942.1
FT                   protein_id=mCP94861.1 isoform=CRA_c"
FT                   /protein_id="EDL14058.1"
FT                   /translation="MEPAKMAPIKNAPERCLGKRVMAQILKDMGITEYEPRVINQMLEF
FT                   AFRYVTTILDDAKIYSSHAKKPTVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQ
FT                   TPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLVKKGPNQGRLVPRLSAVSIVIFFTLVTS
FT                   GRFCYSTSTCF"
FT   CDS             complement(join(11058024..11058187,11059237..11059347,
FT                   11065943..11066012,11067778..11067912,11067991..11068127,
FT                   11068577..11068658,11069256..11069315))
FT                   /codon_start=1
FT                   /gene="Taf9b"
FT                   /locus_tag="mCG_68099"
FT                   /product="TAF9B RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor, isoform CRA_b"
FT                   /note="gene_id=mCG68099.2 transcript_id=mCT68284.3
FT                   protein_id=mCP43406.3 isoform=CRA_b"
FT                   /protein_id="EDL14057.1"
FT                   /translation="MEPAKMAPIKNAPERCLGKRVMAQILKDMGITEYEPRVINQMLEF
FT                   AFRYVTTILDDAKIYSSHAKKPTVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQ
FT                   TPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLVKKGPNQGRLVPRLSAVSSRPTTPPVAP
FT                   PQAVSGPNKAATPVSVTSQRFAVQIPPSQSTPAKPAPAATAVQNVLINPSMIGPKNILI
FT                   TTSMVSSQNTATDSNPLKRKHDDDDDNDTM"
FT   mRNA            complement(join(11058113..11058187,11059237..11059347,
FT                   11065943..11066012,11067778..11067912,11067991..11068127,
FT                   11068577..11068658,11069264..11069406))
FT                   /gene="Taf9b"
FT                   /locus_tag="mCG_68099"
FT                   /product="TAF9B RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor, transcript variant mCT180234"
FT                   /note="gene_id=mCG68099.2 transcript_id=mCT180234.0 created
FT                   on 13-FEB-2003"
FT   assembly_gap    11062886..11063889
FT                   /estimated_length=1004
FT                   /gap_type="unknown"
FT   assembly_gap    11065114..11065300
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    11066509..11067271
FT                   /estimated_length=763
FT                   /gap_type="unknown"
FT   CDS             complement(join(11068615..11068658,11069264..11069315))
FT                   /codon_start=1
FT                   /gene="Taf9b"
FT                   /locus_tag="mCG_68099"
FT                   /product="TAF9B RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor, isoform CRA_a"
FT                   /note="gene_id=mCG68099.2 transcript_id=mCT180233.0
FT                   protein_id=mCP103156.0 isoform=CRA_a"
FT                   /protein_id="EDL14055.1"
FT                   /translation="MEPAKMAPIKNAPERCLGDGTDPEGYGNHRV"
FT   CDS             complement(join(11068615..11068658,11069264..11069315))
FT                   /codon_start=1
FT                   /gene="Taf9b"
FT                   /locus_tag="mCG_68099"
FT                   /product="TAF9B RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor, isoform CRA_a"
FT                   /note="gene_id=mCG68099.2 transcript_id=mCT180234.0
FT                   protein_id=mCP103155.0 isoform=CRA_a"
FT                   /protein_id="EDL14056.1"
FT                   /translation="MEPAKMAPIKNAPERCLGDGTDPEGYGNHRV"
FT   assembly_gap    11081488..11082170
FT                   /estimated_length=683
FT                   /gap_type="unknown"
FT   gene            complement(<11085392..>11102042)
FT                   /locus_tag="mCG_140872"
FT                   /note="gene_id=mCG140872.0"
FT   mRNA            complement(join(<11085392..11085678,11086520..11086641,
FT                   11087374..11087540,11088122..11088334,11088623..11088897,
FT                   11092848..11092954,11093373..11093475,11093599..11093717,
FT                   11094387..11094458,11095083..11095221,11095378..11095464,
FT                   11096471..11096645,11096731..11096852,11098169..11098307,
FT                   11100305..11100441,11100737..11100792,11101648..>11102042))
FT                   /locus_tag="mCG_140872"
FT                   /product="mCG140872"
FT                   /note="gene_id=mCG140872.0 transcript_id=mCT171925.0
FT                   created on 15-AUG-2002"
FT   CDS             complement(join(<11085392..11085678,11086520..11086641,
FT                   11087374..11087540,11088122..11088334,11088623..11088897,
FT                   11092848..11092954,11093373..11093475,11093599..11093717,
FT                   11094387..11094458,11095083..11095221,11095378..11095464,
FT                   11096471..11096645,11096731..11096852,11098169..11098307,
FT                   11100305..11100441,11100737..11100792,11101648..>11102041))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140872"
FT                   /product="mCG140872"
FT                   /note="gene_id=mCG140872.0 transcript_id=mCT171925.0
FT                   protein_id=mCP94844.0"
FT                   /protein_id="EDL14054.1"
FT                   /translation="APRNMADNNADTNPTDRITSSSAHATIISTSNAGFYTDINNSIIG
FT                   PSISTCNQVTSDETQEPPNTKSISSCTSENACNTFISTNDGLRPSDVGSTSENNHGETE
FT                   ANMGAGDNKQILGENQKKSQSSNASLKEHNTENGTQPCCFAIGKPVVSNIQTRSATVSW
FT                   TLKSNEKYDINSMSFELALYTSDENGIYENIYTVTTMRGAEHRSVSEVVSFTTPGCEPD
FT                   PPLAPTLISRTKNSLSLQWKGKGEDFKSCYSGRLKQHTLFKLNPSTKYSFRLAAKNDFG
FT                   CSNFSETAVFYTSGKAPTAPLPPKLKEAGIYSLSLEWCAPTNPNPNDTLTYVLEMEEEN
FT                   FGIGFKPAYDGEDLTCTVRNLQRNTTYKFRIFACNLDGRSKPSGEVKYTTLPARPGCPK
FT                   KPYVVGMIHAHQVTIGWDLPKDNGGMNISSYSLEVCENSDGANLWKIIYNGTQQEFLYN
FT                   DLQAATTYKLRVFCTSPAGQSRPSDVLTIQTPTLPPESCRSQPLRGKTKGKDANLPDNH
FT                   SVNGKPEAHVRGKKAKGPHQDRKVHPSSEKKCAAVDTVGVGMFGGTAKVTSPGTIPGRV
FT                   PVLQEVENRVPAKLSSTCIAIRWEEPDCHGSPITGYNIEYEDKKIVTVKRITEYVLKDL
FT                   QPNTTYRIRIQAINHYGLSPFSPSIRCKTKPLPPEPPQLNCVVYGHQSLRLKWGTVSSK
FT                   KKLDYFINYNLLMEDRSGRFSVIYRGPDVTHKVQKLSEYTEYKFKIQACNEAGEGPESD
FT                   IYTFTTTKSPPTALKAPKVHPLNNNCCEIKWESLEPIEGDPIIYCLQVNTGKKANQIYK
FT                   GPNTSFSFSNYHANSRYRFKVCAGRRYETSNGLQELWGPYSPSALFSTYKHHSGHGKGS
FT                   GGKGKGKHNGKVRKYRIGFALIAILCAVAIQYFL"
FT   assembly_gap    11085952..11085988
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    11087725..11087967
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    11108729..11108748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11116122..11116230
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    11117274..11118706
FT                   /estimated_length=1433
FT                   /gap_type="unknown"
FT   assembly_gap    11122739..11122910
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    11126379..11126398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11128130..11128763
FT                   /estimated_length=634
FT                   /gap_type="unknown"
FT   assembly_gap    11130014..11130344
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   gene            complement(11131321..11134603)
FT                   /pseudo
FT                   /locus_tag="mCG_117796"
FT                   /note="gene_id=mCG117796.1"
FT   mRNA            complement(11131321..11134603)
FT                   /pseudo
FT                   /locus_tag="mCG_117796"
FT                   /note="gene_id=mCG117796.1 transcript_id=mCT118942.1
FT                   created on 12-AUG-2002"
FT   assembly_gap    11146206..11146225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<11155726..>11158950)
FT                   /locus_tag="mCG_68203"
FT                   /note="gene_id=mCG68203.1"
FT   mRNA            complement(join(<11155726..11156022,11156726..11156847,
FT                   11157651..11157817,11158141..11158353,11158625..>11158950))
FT                   /locus_tag="mCG_68203"
FT                   /product="mCG68203"
FT                   /note="gene_id=mCG68203.1 transcript_id=mCT68390.1 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(11155726..11156022,11156726..11156847,
FT                   11157651..11157817,11158141..11158353,11158625..11158950))
FT                   /codon_start=1
FT                   /locus_tag="mCG_68203"
FT                   /product="mCG68203"
FT                   /note="gene_id=mCG68203.1 transcript_id=mCT68390.1
FT                   protein_id=mCP43346.1"
FT                   /protein_id="EDL14053.1"
FT                   /translation="MHGKWLKGIANQACVFQAVDTVGVGMFGRTAKVTTPGTVPAMVPV
FT                   LKEVESKVPAKLSSTCIAIRWEEPDCHGSPIIGYKIEYGHKKIMTVKRITEYVLKGLRP
FT                   NTTYRIRIQAINHYGLSPFSPSIKCKTKPLPPEPPQLNCVAYGHQSLRLKWGTVSSKKE
FT                   LANFINYNLLMEDRSGRFSVIYRGPDVTHKVQKLSEYTEYKFKIQACNEAGEGPESDIY
FT                   TFTTTKSPPTALKAPKVHPLNNNCCEIKWESLEPIEGDPIIYCLQVNTGKKANQIYRGP
FT                   NTSFSFSNYHANSRYRFKVCAGRRYETSNGLQELWGPYSPSALFSTCKHHSEHGKGNGS
FT                   KGKGKHNGKVRKYRIGFALIAILCAVAIQYFLFI"
FT   assembly_gap    11160014..11161056
FT                   /estimated_length=1043
FT                   /gap_type="unknown"
FT   assembly_gap    11168103..11175272
FT                   /estimated_length=7170
FT                   /gap_type="unknown"
FT   assembly_gap    11180001..11180542
FT                   /estimated_length=542
FT                   /gap_type="unknown"
FT   assembly_gap    11188535..11188554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11195959..11196007
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    11211985..11212020
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   gene            complement(<11213481..>11226889)
FT                   /locus_tag="mCG_140795"
FT                   /note="gene_id=mCG140795.0"
FT   mRNA            complement(join(<11213481..11213647,11214585..11214940,
FT                   11218397..11218503,11218910..11219012,11219136..11219254,
FT                   11220913..11220981,11221592..11221730,11224665..11224791,
FT                   11226750..>11226889))
FT                   /locus_tag="mCG_140795"
FT                   /product="mCG140795"
FT                   /note="gene_id=mCG140795.0 transcript_id=mCT171562.0
FT                   created on 09-AUG-2002"
FT   CDS             complement(join(<11213481..11213647,11214585..11214940,
FT                   11218397..11218503,11218910..11219012,11219136..11219254,
FT                   11220913..11220981,11221592..11221730,11224665..11224791,
FT                   11226750..>11226886))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140795"
FT                   /product="mCG140795"
FT                   /note="gene_id=mCG140795.0 transcript_id=mCT171562.0
FT                   protein_id=mCP94481.0"
FT                   /protein_id="EDL14052.1"
FT                   /translation="SNIQTQSATVSWTQKCNKKCDINSSMTYELALSSNGKNGPYKNIY
FT                   IVTIIRGAEHRSVSEVVSFTTPGCEPDPPLASRTKNSLSLQWKIFACNLEGRSNPSGEV
FT                   KYTTRPARPGCPNKPYVVGTIHAHQVTIGWDLPKDNGGMNISSYSLEVYENSDANLWKM
FT                   IYNGTRQEFLYDDLQPATTYKLRVFCTSPSGQSLPSDILTIQTPTLPPESCRSQPLRGK
FT                   TKGKDANLPDNHSVNGKLEAHVCDKKAKGPHQDRKAYPSSEKKCASLFSHARKWSMHGK
FT                   WLKGIVNQACVFQAVDTVGVGMFGGTAKVTTSGTIPARVSVLQKVENRVPAKLSSTCIA
FT                   ILWEEPDCHGSPITGYNIEYEDKKIVTVKRITEYVLKDLQPNTTYRFSVFYRGPDVTYK
FT                   VQMLSEYTEYKFKIQACNEAGEGPESDIYTFTTTKSPPTALK"
FT   assembly_gap    11216562..11216709
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    11230524..11230792
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    11234262..11241538
FT                   /estimated_length=7277
FT                   /gap_type="unknown"
FT   assembly_gap    11246081..11246100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11248970..11249482
FT                   /estimated_length=513
FT                   /gap_type="unknown"
FT   assembly_gap    11250910..11251634
FT                   /estimated_length=725
FT                   /gap_type="unknown"
FT   assembly_gap    11257098..11257126
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   gene            complement(11264968..11292792)
FT                   /locus_tag="mCG_5282"
FT                   /note="gene_id=mCG5282.2"
FT   mRNA            complement(join(11264968..11265696,11266575..11266696,
FT                   11269574..11269740,11270913..11271187,11276500..11276649,
FT                   11277646..11277759,11277971..11278077,11278496..11278598,
FT                   11278721..11278839,11279476..11279547,11280163..11280301,
FT                   11281534..11281620,11284343..11284481,11289309..11289448,
FT                   11292628..11292792))
FT                   /locus_tag="mCG_5282"
FT                   /product="mCG5282"
FT                   /note="gene_id=mCG5282.2 transcript_id=mCT4733.2 created on
FT                   09-AUG-2002"
FT   CDS             complement(join(11265361..11265696,11266575..11266696,
FT                   11269574..11269740,11270913..11271187,11276500..11276649,
FT                   11277646..11277759,11277971..11278077,11278496..11278598,
FT                   11278721..11278839,11279476..11279547,11280163..11280301,
FT                   11281534..11281620,11284343..11284481,11289309..11289448,
FT                   11292628..11292726))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5282"
FT                   /product="mCG5282"
FT                   /note="gene_id=mCG5282.2 transcript_id=mCT4733.2
FT                   protein_id=mCP13324.2"
FT                   /protein_id="EDL14051.1"
FT                   /translation="MTAPVQQPFVAAPLLTYPQAPQLLYSPVQGEIPVSNIQTRSATVS
FT                   WTRKSNEKYDINSSMTHELALSSNGKNGTYKNIYTVTTIRNAEHRSVSEVVSFTTPGCE
FT                   PDPPLAPTLISRTKNSLSLQWKGLGFKPKYNGEDLTCTIRNLQRNTMYKFRIFAYNLEG
FT                   RSNPSGEVKYTTRPARPGCPNKPYVVGTIHAHQVTIGWDLPKDNGGMNISSYSLEVCEN
FT                   SDSANLWKIIYSGTRQEFLYDDLQAATTYKLRVFCTSPAGQSRPSDVLTIQTPTLPPES
FT                   CRSQPLRGKTKSKDANLPDNRSVNGKPEAHVRGKKAKGPHQDRKVHPSSEKKCALGSQS
FT                   MECGSVPARHPPSQCGTPVLTCKGPTCVIVSWEIPKCNGAEIIDYRLQWGQVEDSMHLI
FT                   YTGPCLRYEVKGLVPATTYFCRVQAVNIVGVGMFGGTAKVTTPGTVPAMVPVLKEVESK
FT                   VPAKLSSTCIAIRWEEPDCHGSPITGYNIEYGDKKVVTVKRITEYVLKDLQPNTTYRFS
FT                   VIYRGPDVTHKVQKLSEYTEYKFKIQACNEAGEGPESDIYTFTTTKSPPTALKAPKVHP
FT                   LNNNSCEIKWESLEPIKGDPIVYCLQVTTGKKANQIYKGPNTSFSFSNYHANSRYRFKV
FT                   CAGRRYETSNGLQELWGPYSPSALFSTYKHHSGHGKGSGSKGKGNHNDKGEKCKTEMSD
FT                   DTFVLTLLIGFALIAVLCAVAVQYLLIN"
FT   assembly_gap    11269776..11270296
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    11273798..11273817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11274983..11275077
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    11283040..11283107
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    11285273..11287879
FT                   /estimated_length=2607
FT                   /gap_type="unknown"
FT   assembly_gap    11295014..11295545
FT                   /estimated_length=532
FT                   /gap_type="unknown"
FT   assembly_gap    11298313..11298332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11300847..11300894
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    11303069..11303241
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    11306554..11313933
FT                   /estimated_length=7380
FT                   /gap_type="unknown"
FT   assembly_gap    11317891..11317910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11319321..11319487
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    11321632..11321739
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    11330535..11331039
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    11345408..11345600
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    11352494..11352889
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    11359483..11359502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11368115..11368134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11380605..11380624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11390846..11391189
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    11393868..11393887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11395075..11395427
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    11400254..11406606
FT                   /estimated_length=6353
FT                   /gap_type="unknown"
FT   assembly_gap    11407788..11409292
FT                   /estimated_length=1505
FT                   /gap_type="unknown"
FT   assembly_gap    11416196..11416328
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    11419923..11420396
FT                   /estimated_length=474
FT                   /gap_type="unknown"
FT   gene            complement(11421361..11448135)
FT                   /gene="Cysltr1"
FT                   /locus_tag="mCG_16179"
FT                   /note="gene_id=mCG16179.2"
FT   mRNA            complement(join(11421361..11423599,11425583..11425653,
FT                   11426878..11426964,11447710..11448135))
FT                   /gene="Cysltr1"
FT                   /locus_tag="mCG_16179"
FT                   /product="cysteinyl leukotriene receptor 1, transcript
FT                   variant mCT16224"
FT                   /note="gene_id=mCG16179.2 transcript_id=mCT16224.2 created
FT                   on 15-FEB-2003"
FT   mRNA            complement(join(11422480..11423599,11425583..11425672,
FT                   11426878..11426964,11447710..11447957))
FT                   /gene="Cysltr1"
FT                   /locus_tag="mCG_16179"
FT                   /product="cysteinyl leukotriene receptor 1, transcript
FT                   variant mCT180203"
FT                   /note="gene_id=mCG16179.2 transcript_id=mCT180203.0 created
FT                   on 15-FEB-2003"
FT   CDS             complement(join(11422554..11423599,11425583..11425595))
FT                   /codon_start=1
FT                   /gene="Cysltr1"
FT                   /locus_tag="mCG_16179"
FT                   /product="cysteinyl leukotriene receptor 1, isoform CRA_a"
FT                   /note="gene_id=mCG16179.2 transcript_id=mCT16224.2
FT                   protein_id=mCP6780.2 isoform=CRA_a"
FT                   /protein_id="EDL14049.1"
FT                   /translation="MYLQGTKQTFLENMNGTENLTTSLINNTCHDTIDEFRNQVYSTMY
FT                   SVISVVGFFGNSFVLYVLIKTYHEKSAFQVYMINLAIADLLCVCTLPLRVVYYVHKGKW
FT                   LFGDFLCRLTTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCIGIW
FT                   IFVILTSSPFLMYKSYQDEKNNTKCFEPPQNNQAKKYVLILHYVSLFFGFIIPFVTIIV
FT                   CYTMIILTLLKNTMKKNMPSRRKAIGMIIVVTAAFLVSFMPYHIQRTIHLHLLHSETRP
FT                   CDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYVPKKKA
FT                   SLPEKGEEICNE"
FT   CDS             complement(join(11422554..11423599,11425583..11425595))
FT                   /codon_start=1
FT                   /gene="Cysltr1"
FT                   /locus_tag="mCG_16179"
FT                   /product="cysteinyl leukotriene receptor 1, isoform CRA_a"
FT                   /note="gene_id=mCG16179.2 transcript_id=mCT180203.0
FT                   protein_id=mCP103125.0 isoform=CRA_a"
FT                   /protein_id="EDL14050.1"
FT                   /translation="MYLQGTKQTFLENMNGTENLTTSLINNTCHDTIDEFRNQVYSTMY
FT                   SVISVVGFFGNSFVLYVLIKTYHEKSAFQVYMINLAIADLLCVCTLPLRVVYYVHKGKW
FT                   LFGDFLCRLTTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCIGIW
FT                   IFVILTSSPFLMYKSYQDEKNNTKCFEPPQNNQAKKYVLILHYVSLFFGFIIPFVTIIV
FT                   CYTMIILTLLKNTMKKNMPSRRKAIGMIIVVTAAFLVSFMPYHIQRTIHLHLLHSETRP
FT                   CDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYVPKKKA
FT                   SLPEKGEEICNE"
FT   gene            <11427919..11554198
FT                   /locus_tag="mCG_144646"
FT                   /note="gene_id=mCG144646.0"
FT   mRNA            join(<11427919..11427980,11469961..11470044,
FT                   11516009..11516168,11519070..11519175,11548200..11548357,
FT                   11553071..11553169,11553412..11554198)
FT                   /locus_tag="mCG_144646"
FT                   /product="mCG144646"
FT                   /note="gene_id=mCG144646.0 transcript_id=mCT184070.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    11437172..11438317
FT                   /estimated_length=1146
FT                   /gap_type="unknown"
FT   gene            11456389..11457274
FT                   /pseudo
FT                   /locus_tag="mCG_1030974"
FT                   /note="gene_id=mCG1030974.1"
FT   mRNA            11456389..11457274
FT                   /pseudo
FT                   /locus_tag="mCG_1030974"
FT                   /note="gene_id=mCG1030974.1 transcript_id=mCT148678.1
FT                   created on 16-AUG-2002"
FT   gene            complement(11477277..11477777)
FT                   /pseudo
FT                   /locus_tag="mCG_50809"
FT                   /note="gene_id=mCG50809.1"
FT   mRNA            complement(11477277..11477777)
FT                   /pseudo
FT                   /locus_tag="mCG_50809"
FT                   /note="gene_id=mCG50809.1 transcript_id=mCT50992.1 created
FT                   on 10-APR-2002"
FT   assembly_gap    11479295..11479314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11484589..11485450
FT                   /estimated_length=862
FT                   /gap_type="unknown"
FT   gene            complement(11485833..11487335)
FT                   /pseudo
FT                   /locus_tag="mCG_1030928"
FT                   /note="gene_id=mCG1030928.1"
FT   mRNA            complement(11485833..11487335)
FT                   /pseudo
FT                   /locus_tag="mCG_1030928"
FT                   /note="gene_id=mCG1030928.1 transcript_id=mCT148632.1
FT                   created on 20-AUG-2002"
FT   assembly_gap    11505179..11505221
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    11523136..11523488
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    11536109..11536128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11545706..11546048
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    11547590..11547609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<11553168..11553169,11553412..11554090)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144646"
FT                   /product="mCG144646"
FT                   /note="gene_id=mCG144646.0 transcript_id=mCT184070.0
FT                   protein_id=mCP106212.0"
FT                   /protein_id="EDL14048.1"
FT                   /translation="RNPAQLHILKNRDHMKDLRRYLMFKYIQYLVLPSPNVIIILLGSL
FT                   ASLYVMLLLTFPSVSRKSTAVFIGSIAQADILVVCSLFSAISACVIRSEPSSTSFQLAL
FT                   RQNFQIANIHASSLLLSCVTLEAFLITFLPVETRHIRNVRCARVASKIIWAVVITECFL
FT                   YQLEYVKGLNISYLGIHRQIQLLMNFFYEATVLLKLLIYPIGVLLRIFNVYLFYKMYFR
FT                   DHYS"
FT   assembly_gap    11561104..11561129
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    11569448..11569595
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    11573341..11578112
FT                   /estimated_length=4772
FT                   /gap_type="unknown"
FT   assembly_gap    11589319..11590175
FT                   /estimated_length=857
FT                   /gap_type="unknown"
FT   assembly_gap    11593145..11593300
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   gene            complement(11596630..11597560)
FT                   /pseudo
FT                   /locus_tag="mCG_1031040"
FT                   /note="gene_id=mCG1031040.1"
FT   mRNA            complement(join(11596630..11596725,11597218..11597560))
FT                   /pseudo
FT                   /locus_tag="mCG_1031040"
FT                   /note="gene_id=mCG1031040.1 transcript_id=mCT148744.1
FT                   created on 15-AUG-2002"
FT   gene            11598697..11599564
FT                   /pseudo
FT                   /locus_tag="mCG_146363"
FT                   /note="gene_id=mCG146363.0"
FT   mRNA            11598697..11599564
FT                   /pseudo
FT                   /locus_tag="mCG_146363"
FT                   /note="gene_id=mCG146363.0 transcript_id=mCT186556.0
FT                   created on 07-JUL-2003"
FT   assembly_gap    11600555..11600658
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    11617681..11617895
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    11625264..11625302
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    11627793..11628491
FT                   /estimated_length=699
FT                   /gap_type="unknown"
FT   assembly_gap    11632245..11632401
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    11637757..11637791
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    11639137..11639177
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    11658052..11658071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11664659..11664994
FT                   /pseudo
FT                   /locus_tag="mCG_1031039"
FT                   /note="gene_id=mCG1031039.1"
FT   mRNA            11664659..11664994
FT                   /pseudo
FT                   /locus_tag="mCG_1031039"
FT                   /note="gene_id=mCG1031039.1 transcript_id=mCT148743.1
FT                   created on 15-AUG-2002"
FT   assembly_gap    11677031..11677050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11679825..11683273)
FT                   /gene="Zcchc5"
FT                   /locus_tag="mCG_147484"
FT                   /note="gene_id=mCG147484.0"
FT   mRNA            complement(join(11679825..11682584,11683200..11683273))
FT                   /gene="Zcchc5"
FT                   /locus_tag="mCG_147484"
FT                   /product="zinc finger, CCHC domain containing 5"
FT                   /note="gene_id=mCG147484.0 transcript_id=mCT187747.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(11680715..11682376)
FT                   /codon_start=1
FT                   /gene="Zcchc5"
FT                   /locus_tag="mCG_147484"
FT                   /product="zinc finger, CCHC domain containing 5"
FT                   /note="gene_id=mCG147484.0 transcript_id=mCT187747.0
FT                   protein_id=mCP108724.0"
FT                   /db_xref="GOA:Q6P1Y1"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR005162"
FT                   /db_xref="InterPro:IPR032567"
FT                   /db_xref="MGI:MGI:2685221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6P1Y1"
FT                   /protein_id="EDL14047.1"
FT                   /translation="MVEDLAASYVTLKLENEILQAQVKRLMEENAALQAQIPELQKSGA
FT                   VKEHEPLRKPSEAQEPPESPEFPAARESQNPWEPPATTEPGEPTKIREPREPSAISELR
FT                   EPPEIKEPQEPPETNESGESSAITEFRGSPEIKEPHLPPKSKEYWGPQELPMVKESWEP
FT                   PEALDSTAWKPPAVKESQEIQKALESPATQRPQASPRGYDLPAVCEAEPTDNQGTPALK
FT                   ELQSPQLHNPTNDEESQTVPEYQETSSQLEPLEHPPPQETLEPRVPQEPLDPSDAEEFL
FT                   ELSVPEESLEGLIVARTGTEQAQCELEATTLPLEYPLAFSEDFQKLSEFLVQLTSYLRS
FT                   RGYPTEAALVSFVGSFFSGEAGRMFQPLLDSQPPLVEQFERLLRALQDTFDNPESLEVA
FT                   NQGLPQLRQGEGLAPRYSTRFHLIAQELDLGESTLCIQFQEELASSIQNELSCTSPATN
FT                   LSDVIIECVTLEEKASGGVDSSSSSSEEENGSEGPPTENQPVQATSNRPHLSEAERARR
FT                   REGHLCLYCGHPGHFARDCPVKPHRVQQAGNMEARR"
FT   assembly_gap    11688164..11688372
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    11709041..11709060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11715476..11715496
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    11721273..11721370
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    11726427..11726702
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    11745324..11746065
FT                   /estimated_length=742
FT                   /gap_type="unknown"
FT   assembly_gap    11758501..11758520
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11762802..11776293
FT                   /gene="Gpr23"
FT                   /locus_tag="mCG_1030946"
FT                   /note="gene_id=mCG1030946.2"
FT   mRNA            join(11762802..11763166,11766255..11766356,
FT                   11772521..11776293)
FT                   /gene="Gpr23"
FT                   /locus_tag="mCG_1030946"
FT                   /product="G protein-coupled receptor 23"
FT                   /note="gene_id=mCG1030946.2 transcript_id=mCT148650.2
FT                   created on 17-APR-2003"
FT   assembly_gap    11766510..11766550
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    11768185..11769290
FT                   /estimated_length=1106
FT                   /gap_type="unknown"
FT   CDS             11772603..11773715
FT                   /codon_start=1
FT                   /gene="Gpr23"
FT                   /locus_tag="mCG_1030946"
FT                   /product="G protein-coupled receptor 23"
FT                   /note="gene_id=mCG1030946.2 transcript_id=mCT148650.2
FT                   protein_id=mCP69954.0"
FT                   /db_xref="GOA:Q8BLG2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1925384"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BLG2"
FT                   /protein_id="EDL14046.1"
FT                   /translation="MGDRRFIDFQFQDLNSSLRPRLGNATANNTCIVDDSFKYNLNGAV
FT                   YSVVFILGLITNSASLFVFCFRMKMRSETAIFITNLALSDLLFVCTLPFKIFYNFNRHW
FT                   PFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVW
FT                   ILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVS
FT                   CSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAIT
FT                   NCLLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINTHIRMESLFKTETPL
FT                   TPKPSLPAIQEEVSDQTTNNGGELMLESTF"
FT   assembly_gap    11778434..11778453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11820255..11820557
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    11880197..11880216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11886624..11886643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11889926..11896418
FT                   /estimated_length=6493
FT                   /gap_type="unknown"
FT   assembly_gap    11904487..11904506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11911635..11911654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11916724..11916743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11919416..11919925
FT                   /estimated_length=510
FT                   /gap_type="unknown"
FT   gene            11927647..11945430
FT                   /gene="P2ry10"
FT                   /locus_tag="mCG_1030926"
FT                   /note="gene_id=mCG1030926.1"
FT   mRNA            join(11927647..11927698,11928490..11928584,
FT                   11942848..11943815,11943849..11945429)
FT                   /gene="P2ry10"
FT                   /locus_tag="mCG_1030926"
FT                   /product="purinergic receptor P2Y, G-protein coupled 10,
FT                   transcript variant mCT175230"
FT                   /note="gene_id=mCG1030926.1 transcript_id=mCT175230.0
FT                   created on 29-OCT-2002"
FT   mRNA            join(11928390..11928584,11942848..11943815,
FT                   11943849..11945429)
FT                   /gene="P2ry10"
FT                   /locus_tag="mCG_1030926"
FT                   /product="purinergic receptor P2Y, G-protein coupled 10,
FT                   transcript variant mCT175231"
FT                   /note="gene_id=mCG1030926.1 transcript_id=mCT175231.0
FT                   created on 29-OCT-2002"
FT   mRNA            join(11928476..11928584,11928715..11928889,
FT                   11942848..11943815,11943849..11945430)
FT                   /gene="P2ry10"
FT                   /locus_tag="mCG_1030926"
FT                   /product="purinergic receptor P2Y, G-protein coupled 10,
FT                   transcript variant mCT148630"
FT                   /note="gene_id=mCG1030926.1 transcript_id=mCT148630.1
FT                   created on 29-OCT-2002"
FT   assembly_gap    11932348..11934676
FT                   /estimated_length=2329
FT                   /gap_type="unknown"
FT   assembly_gap    11942450..11942608
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   CDS             join(11942897..11943815,11943849..11943874)
FT                   /codon_start=1
FT                   /gene="P2ry10"
FT                   /locus_tag="mCG_1030926"
FT                   /product="purinergic receptor P2Y, G-protein coupled 10,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1030926.1 transcript_id=mCT175230.0
FT                   protein_id=mCP98150.0 isoform=CRA_a"
FT                   /protein_id="EDL14043.1"
FT                   /translation="MGSNSTSSAESNCNATYLPFQYSLYATTYIFIFIPGLLANSAALW
FT                   VLCRFISKKNKAIIFMINLSVADLAHILSLPLRIYYYINRHWPFQRALCLLCFYLKYLN
FT                   MYASIFFLTCISLQRCLFLLKPFRARNWKRRYDVGISAVIWIVVGTACLPFPILRNAGL
FT                   ANSTDSCFADLGYKQMDAVVLVTMVVIAELAGFVIPVITIACCTWKTTVSLKHPPIAFQ
FT                   GISERKKALRMVFMCAAVFVICFTPYHINFIFYTMVKESIITSCPTVKSTLYFHPFSLC
FT                   LASLCCLLDPILYYFMASEFRDQLSPLLLVLVS"
FT   CDS             join(11942897..11943815,11943849..11943874)
FT                   /codon_start=1
FT                   /gene="P2ry10"
FT                   /locus_tag="mCG_1030926"
FT                   /product="purinergic receptor P2Y, G-protein coupled 10,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1030926.1 transcript_id=mCT175231.0
FT                   protein_id=mCP98149.0 isoform=CRA_a"
FT                   /protein_id="EDL14044.1"
FT                   /translation="MGSNSTSSAESNCNATYLPFQYSLYATTYIFIFIPGLLANSAALW
FT                   VLCRFISKKNKAIIFMINLSVADLAHILSLPLRIYYYINRHWPFQRALCLLCFYLKYLN
FT                   MYASIFFLTCISLQRCLFLLKPFRARNWKRRYDVGISAVIWIVVGTACLPFPILRNAGL
FT                   ANSTDSCFADLGYKQMDAVVLVTMVVIAELAGFVIPVITIACCTWKTTVSLKHPPIAFQ
FT                   GISERKKALRMVFMCAAVFVICFTPYHINFIFYTMVKESIITSCPTVKSTLYFHPFSLC
FT                   LASLCCLLDPILYYFMASEFRDQLSPLLLVLVS"
FT   CDS             join(11942897..11943815,11943849..11943874)
FT                   /codon_start=1
FT                   /gene="P2ry10"
FT                   /locus_tag="mCG_1030926"
FT                   /product="purinergic receptor P2Y, G-protein coupled 10,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1030926.1 transcript_id=mCT148630.1
FT                   protein_id=mCP69902.1 isoform=CRA_a"
FT                   /protein_id="EDL14045.1"
FT                   /translation="MGSNSTSSAESNCNATYLPFQYSLYATTYIFIFIPGLLANSAALW
FT                   VLCRFISKKNKAIIFMINLSVADLAHILSLPLRIYYYINRHWPFQRALCLLCFYLKYLN
FT                   MYASIFFLTCISLQRCLFLLKPFRARNWKRRYDVGISAVIWIVVGTACLPFPILRNAGL
FT                   ANSTDSCFADLGYKQMDAVVLVTMVVIAELAGFVIPVITIACCTWKTTVSLKHPPIAFQ
FT                   GISERKKALRMVFMCAAVFVICFTPYHINFIFYTMVKESIITSCPTVKSTLYFHPFSLC
FT                   LASLCCLLDPILYYFMASEFRDQLSPLLLVLVS"
FT   assembly_gap    11943821..11943840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11951505..11951524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11952134..11952258
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    11960744..11962726
FT                   /estimated_length=1983
FT                   /gap_type="unknown"
FT   assembly_gap    11965029..11965585
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    11966966..11967516
FT                   /estimated_length=551
FT                   /gap_type="unknown"
FT   assembly_gap    11969037..11969060
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    11970345..11971073
FT                   /estimated_length=729
FT                   /gap_type="unknown"
FT   assembly_gap    11978477..11978496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11980713..11980976
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   gene            11989334..12013934
FT                   /gene="A630033H20Rik"
FT                   /locus_tag="mCG_112865"
FT                   /note="gene_id=mCG112865.1"
FT   mRNA            join(11989334..11989444,12011110..12013934)
FT                   /gene="A630033H20Rik"
FT                   /locus_tag="mCG_112865"
FT                   /product="RIKEN cDNA A630033H20, transcript variant
FT                   mCT113937"
FT                   /note="gene_id=mCG112865.1 transcript_id=mCT113937.1
FT                   created on 13-FEB-2003"
FT   mRNA            join(11989878..11989924,12011110..>12011697)
FT                   /gene="A630033H20Rik"
FT                   /locus_tag="mCG_112865"
FT                   /product="RIKEN cDNA A630033H20, transcript variant
FT                   mCT180090"
FT                   /note="gene_id=mCG112865.1 transcript_id=mCT180090.0
FT                   created on 13-FEB-2003"
FT   mRNA            join(11989913..11990096,12011110..>12011511)
FT                   /gene="A630033H20Rik"
FT                   /locus_tag="mCG_112865"
FT                   /product="RIKEN cDNA A630033H20, transcript variant
FT                   mCT180091"
FT                   /note="gene_id=mCG112865.1 transcript_id=mCT180091.0
FT                   created on 13-FEB-2003"
FT   assembly_gap    11995161..11995243
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   CDS             12011307..12012365
FT                   /codon_start=1
FT                   /gene="A630033H20Rik"
FT                   /locus_tag="mCG_112865"
FT                   /product="RIKEN cDNA A630033H20, isoform CRA_a"
FT                   /note="gene_id=mCG112865.1 transcript_id=mCT113937.1
FT                   protein_id=mCP69713.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BY68"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2441814"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BY68"
FT                   /protein_id="EDL14040.1"
FT                   /translation="MGSNSTSSAESNCNGTYLTFQYSLYATTYIFIFIPGLLANSVALW
FT                   VLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYINRHWPFQRALCLLCFYLKYLN
FT                   MYASIFFLTCISLQRCLFLLKPFRARNWKRRYDVAISAAVWIIVGTACLPLPILRSAGL
FT                   ANNSESCFADLGLQDITMASSIGMVTAAELGGFVLPVVIITYCTWKTRKSLQEFQDPPQ
FT                   NIKERKKALRMVLMCAVVFIVCFTPYHLNFPFFMMVKQRVFSNCSFIRNTLCFHIISLC
FT                   LANLNCCLDPVVYYFMTSEFRDQFSEHGNLVIQSCLHCKDSTLEIRQRKENLQTISLEC
FT                   LDVPTQCDEMVI"
FT   CDS             12011307..>12011697
FT                   /codon_start=1
FT                   /gene="A630033H20Rik"
FT                   /locus_tag="mCG_112865"
FT                   /product="RIKEN cDNA A630033H20, isoform CRA_b"
FT                   /note="gene_id=mCG112865.1 transcript_id=mCT180090.0
FT                   protein_id=mCP103012.0 isoform=CRA_b"
FT                   /db_xref="GOA:A2ASC4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2441814"
FT                   /db_xref="UniProtKB/TrEMBL:A2ASC4"
FT                   /protein_id="EDL14041.1"
FT                   /translation="MGSNSTSSAESNCNGTYLTFQYSLYATTYIFIFIPGLLANSVALW
FT                   VLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYINRHWPFQRALCLLCFYLKYLN
FT                   MYASIFFLTCISLQRCLFLLKPFRAR"
FT   CDS             12011307..>12011511
FT                   /codon_start=1
FT                   /gene="A630033H20Rik"
FT                   /locus_tag="mCG_112865"
FT                   /product="RIKEN cDNA A630033H20, isoform CRA_c"
FT                   /note="gene_id=mCG112865.1 transcript_id=mCT180091.0
FT                   protein_id=mCP103013.0 isoform=CRA_c"
FT                   /protein_id="EDL14042.1"
FT                   /translation="MGSNSTSSAESNCNGTYLTFQYSLYATTYIFIFIPGLLANSVALW
FT                   VLCRFISKKNKAIIFMINLSVAD"
FT   gene            complement(12014886..12016168)
FT                   /pseudo
FT                   /locus_tag="mCG_49036"
FT                   /note="gene_id=mCG49036.2"
FT   mRNA            complement(12014886..12016168)
FT                   /pseudo
FT                   /locus_tag="mCG_49036"
FT                   /note="gene_id=mCG49036.2 transcript_id=mCT49219.2 created
FT                   on 15-AUG-2002"
FT   assembly_gap    12029833..12030421
FT                   /estimated_length=589
FT                   /gap_type="unknown"
FT   assembly_gap    12032012..12032391
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    12041895..12041990
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    12058607..12058626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12069320..12069670
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   gene            12073558..12074180
FT                   /pseudo
FT                   /locus_tag="mCG_140875"
FT                   /note="gene_id=mCG140875.0"
FT   mRNA            12073558..12074180
FT                   /pseudo
FT                   /locus_tag="mCG_140875"
FT                   /note="gene_id=mCG140875.0 transcript_id=mCT171930.0
FT                   created on 16-AUG-2002"
FT   assembly_gap    12077448..12078034
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    12081212..12081285
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    12082664..12082683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12084454..12087257
FT                   /locus_tag="mCG_140874"
FT                   /note="gene_id=mCG140874.0"
FT   mRNA            <12084454..12087257
FT                   /locus_tag="mCG_140874"
FT                   /product="mCG140874"
FT                   /note="gene_id=mCG140874.0 transcript_id=mCT171929.0
FT                   created on 16-AUG-2002"
FT   CDS             <12085179..12086054
FT                   /codon_start=1
FT                   /locus_tag="mCG_140874"
FT                   /product="mCG140874"
FT                   /note="gene_id=mCG140874.0 transcript_id=mCT171929.0
FT                   protein_id=mCP94848.0"
FT                   /protein_id="EDL14039.1"
FT                   /translation="SIDPRCVVMLFSPIDPLWVGLIVLVLFVLIYGLCYCLKLCVEAVK
FT                   TGQKILTEQQESMSEEEKGLKRKRKKKGDTVLSGEQKGQNKRVEAEEEGELAFAPPPYA
FT                   SSSAIYGQTFCPEVWKEDRFSLLGCPIFTDQAKFAWDRDMLLDQGRFAQQQTRYPVQVF
FT                   EQVNQIPIRAWKSLPNRGEVSENLTLVLTPQMDTQVIEVMVSSSRGIVSISPGDRQDQV
FT                   LTWARGSVCVFPQDQMEPLWVPERLVRRYKNEAPDPVAPVDVVDDPTSTKDGAEMGDPF
FT                   GIPEADTSST"
FT   assembly_gap    12096392..12096411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12106766..12106785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12108987..12136817
FT                   /locus_tag="mCG_55385"
FT                   /note="gene_id=mCG55385.1"
FT   mRNA            join(12108987..12109070,12128567..12128637,
FT                   12132124..12136817)
FT                   /locus_tag="mCG_55385"
FT                   /product="mCG55385"
FT                   /note="gene_id=mCG55385.1 transcript_id=mCT55568.1 created
FT                   on 16-AUG-2002"
FT   gene            12119290..12120125
FT                   /pseudo
FT                   /locus_tag="mCG_140873"
FT                   /note="gene_id=mCG140873.0"
FT   mRNA            12119290..12120125
FT                   /pseudo
FT                   /locus_tag="mCG_140873"
FT                   /note="gene_id=mCG140873.0 transcript_id=mCT171928.0
FT                   created on 16-AUG-2002"
FT   CDS             12132685..12133692
FT                   /codon_start=1
FT                   /locus_tag="mCG_55385"
FT                   /product="mCG55385"
FT                   /note="gene_id=mCG55385.1 transcript_id=mCT55568.1
FT                   protein_id=mCP31403.0"
FT                   /protein_id="EDL14038.1"
FT                   /translation="MTDNFTCNKTDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFY
FT                   GYMKETKRAVVFMINLAIADLLQILSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYA
FT                   SIYFLVCISVRRFWFLMYPFRFNDCKQKYDLYISIIGWLIICLACLLFPLLRTNDDTPG
FT                   NRTKCFVDLPIRNVNLAQSVAMITIGEVVGFVTPLMIVLYCTWKTALSLQNKYPISQHL
FT                   GEKKKALKMILTCAGVFLVCFVPYHFSFPLDFLVKSNEIKSCFARRVILIFHSVALCLA
FT                   SLNSCLDPVIYYFTTNEFRRRLSRQDLPDNIQLHTKSYKIASNHATSTVAAELC"
FT   assembly_gap    12140195..12140477
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    12144333..12144360
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    12145187..12145293
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    12150173..12150203
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    12159670..12159782
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    12170158..12170177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12181979..12182087
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   gene            complement(12188309..12189063)
FT                   /pseudo
FT                   /locus_tag="mCG_1030925"
FT                   /note="gene_id=mCG1030925.1"
FT   mRNA            complement(12188309..12189063)
FT                   /pseudo
FT                   /locus_tag="mCG_1030925"
FT                   /note="gene_id=mCG1030925.1 transcript_id=mCT148629.1
FT                   created on 20-AUG-2002"
FT   assembly_gap    12191469..12191488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12197253..12197585
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    12207211..12207998
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    12208731..12208834
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    12226038..12226057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12231010..12237505)
FT                   /gene="Itm2a"
FT                   /locus_tag="mCG_18930"
FT                   /note="gene_id=mCG18930.1"
FT   mRNA            complement(join(12231010..12231794,12231911..12232061,
FT                   12232912..12233022,12233237..12233434,12233708..12233839,
FT                   12237247..12237505))
FT                   /gene="Itm2a"
FT                   /locus_tag="mCG_18930"
FT                   /product="integral membrane protein 2A"
FT                   /note="gene_id=mCG18930.1 transcript_id=mCT16796.1 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(12231706..12231794,12231911..12232061,
FT                   12232912..12233022,12233237..12233434,12233708..12233839,
FT                   12237247..12237357))
FT                   /codon_start=1
FT                   /gene="Itm2a"
FT                   /locus_tag="mCG_18930"
FT                   /product="integral membrane protein 2A"
FT                   /note="gene_id=mCG18930.1 transcript_id=mCT16796.1
FT                   protein_id=mCP9213.2"
FT                   /protein_id="EDL14037.1"
FT                   /translation="MVKIAFNTPTAVQKEEARQDVEALVSRTVRAQILTGKELRVVPQE
FT                   KDGSSGRCMLTLLGLSFILAGLIVGGACIYKYFMPKSTIYHGEMCFFDSEDPVNSIPGG
FT                   EPYFLPVTEEADIREDDNIAIIDVPVPSFSDSDPAAIIHDFEKGMTAYLDLLLGNCYLM
FT                   PLNTSIVMTPKNLVELFGKLASGKYLPHTYVVREDLVAVEEIRDVSNLGIFIYQLCNNR
FT                   KSFRLRRRDLLLGFNKRAIDKCWKIRHFPNEFIVETKICQE"
FT   assembly_gap    12248672..12248691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12260173..12260292
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    12270350..12270434
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    12287196..12287215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12289779..12290235
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   assembly_gap    12303888..12304398
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   assembly_gap    12324334..12324752
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    12330368..12330459
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    12333562..12335039
FT                   /estimated_length=1478
FT                   /gap_type="unknown"
FT   assembly_gap    12335927..12337068
FT                   /estimated_length=1142
FT                   /gap_type="unknown"
FT   assembly_gap    12350058..12356167
FT                   /estimated_length=6110
FT                   /gap_type="unknown"
FT   assembly_gap    12366603..12367741
FT                   /estimated_length=1139
FT                   /gap_type="unknown"
FT   assembly_gap    12372389..12372408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12376136..12377406
FT                   /pseudo
FT                   /locus_tag="mCG_49574"
FT                   /note="gene_id=mCG49574.2"
FT   mRNA            12376136..12377406
FT                   /pseudo
FT                   /locus_tag="mCG_49574"
FT                   /note="gene_id=mCG49574.2 transcript_id=mCT49757.2 created
FT                   on 20-AUG-2002"
FT   assembly_gap    12379839..12380756
FT                   /estimated_length=918
FT                   /gap_type="unknown"
FT   assembly_gap    12382998..12390909
FT                   /estimated_length=7912
FT                   /gap_type="unknown"
FT   assembly_gap    12405123..12405142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12420612..12420631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12422539..12422558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12423387..12426641
FT                   /estimated_length=3255
FT                   /gap_type="unknown"
FT   assembly_gap    12434799..12441180
FT                   /estimated_length=6382
FT                   /gap_type="unknown"
FT   assembly_gap    12450720..12451116
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    12452934..12453100
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    12454200..12454279
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    12460142..12460211
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    12462534..12462764
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    12474068..12474208
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    12486486..12486668
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    12503438..12503457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12509038..12518156
FT                   /gene="Tbx22"
FT                   /locus_tag="mCG_51684"
FT                   /note="gene_id=mCG51684.2"
FT   mRNA            join(12509038..12509076,12509385..12509561,
FT                   12510130..12510301,12511076..12511177,12512632..12512806,
FT                   12513665..12513829,12514160..12514224,12514639..12514724,
FT                   12517371..12518156)
FT                   /gene="Tbx22"
FT                   /locus_tag="mCG_51684"
FT                   /product="T-box 22"
FT                   /note="gene_id=mCG51684.2 transcript_id=mCT51867.2 created
FT                   on 09-AUG-2002"
FT   CDS             join(12509387..12509561,12510130..12510301,
FT                   12511076..12511177,12512632..12512806,12513665..12513829,
FT                   12514160..12514224,12514639..12514724,12517371..12517984)
FT                   /codon_start=1
FT                   /gene="Tbx22"
FT                   /locus_tag="mCG_51684"
FT                   /product="T-box 22"
FT                   /note="gene_id=mCG51684.2 transcript_id=mCT51867.2
FT                   protein_id=mCP28890.2"
FT                   /protein_id="EDL14036.1"
FT                   /translation="MALSSRAHAFSVEALMGRPSKRKAQDPREEMQPELQEEQFVEEGE
FT                   EILRSPSRDSQQPEKRLKAESSKTVFSCSDESNSQESLQEESVIQVELQGSDLWKRFHD
FT                   IGTEMIITKAGRRMFPSVRIKVKGMDPVKQYYVILDVVPVDSKRYRYVYHSSQWMVAGN
FT                   TDHSCITPRFYVHPDSPCSGENWMRQIISFDRVKLTNNEMDDKGHIILQSMHKYNPRVH
FT                   VVEQDSRIDLSLIESFPTEGVKTFSFKETEFTTVTAYQNQQITKLKIDRNPFAKGFRDP
FT                   GRNRGVLDGFLETYPWMPSFSMDFKTFVTDTQSGSSGSSPVTSSGGAPSPLNSLLSPSC
FT                   SPPMVYIPPSSFGMTYPDAYLHSVNIPFCYRICPTNNWRSQPFVLPTPERLPSFIIPQT
FT                   LPPLMMEVPVVSSRGIINPNSGLHEDCNGQCLQASHSANQMLYGLQNPGNIFHPNAIAQ
FT                   EAISYPFHPPNGCYRYTISMPPRLENVASHLSENGTSQISFTEGSCDHSHWYPAINHYL
FT                   "
FT   assembly_gap    12524717..12524928
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    12534994..12535036
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    12552941..12552960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12559552..12559630
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    12563471..12569162
FT                   /estimated_length=5692
FT                   /gap_type="unknown"
FT   assembly_gap    12570462..12571610
FT                   /estimated_length=1149
FT                   /gap_type="unknown"
FT   assembly_gap    12580398..12580650
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    12587778..12589005
FT                   /estimated_length=1228
FT                   /gap_type="unknown"
FT   assembly_gap    12598670..12598689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12601448..12601467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12620308..12649239)
FT                   /gene="2610002M06Rik"
FT                   /locus_tag="mCG_8519"
FT                   /note="gene_id=mCG8519.1"
FT   mRNA            complement(join(12620308..12620817,12621230..12621302,
FT                   12623701..12623744,12625864..12625971,12626058..12626126,
FT                   12626473..12626619,12640768..12640865,12649091..12649239))
FT                   /gene="2610002M06Rik"
FT                   /locus_tag="mCG_8519"
FT                   /product="RIKEN cDNA 2610002M06"
FT                   /note="gene_id=mCG8519.1 transcript_id=mCT7505.1 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(12620773..12620817,12621230..12621302,
FT                   12623701..12623744,12625864..12625971,12626058..12626126,
FT                   12626473..12626619,12640768..12640865,12649091..12649106))
FT                   /codon_start=1
FT                   /gene="2610002M06Rik"
FT                   /locus_tag="mCG_8519"
FT                   /product="RIKEN cDNA 2610002M06"
FT                   /note="gene_id=mCG8519.1 transcript_id=mCT7505.1
FT                   protein_id=mCP15012.2"
FT                   /protein_id="EDL14035.1"
FT                   /translation="MSNMEKHLFNLKFAAKELNRNAKKCDKEEKAEKAKIKKAIQKGNT
FT                   EVARIHAENAIRQKNQAINFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLR
FT                   SMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLD
FT                   LNMELPQGQTGSVGASVASTEQDELSQRLARLRDQV"
FT   assembly_gap    12632733..12632752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12637779..12637948
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    12644257..12644276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12647384..12647403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12649024..12649043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12703293..12704798
FT                   /locus_tag="mCG_1030945"
FT                   /note="gene_id=mCG1030945.1"
FT   mRNA            12703293..12704798
FT                   /locus_tag="mCG_1030945"
FT                   /product="mCG1030945"
FT                   /note="gene_id=mCG1030945.1 transcript_id=mCT148649.1
FT                   created on 19-AUG-2002"
FT   CDS             12703299..12704471
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030945"
FT                   /product="mCG1030945"
FT                   /note="gene_id=mCG1030945.1 transcript_id=mCT148649.1
FT                   protein_id=mCP69953.1"
FT                   /db_xref="GOA:B1ATX6"
FT                   /db_xref="InterPro:IPR012937"
FT                   /db_xref="MGI:MGI:2685223"
FT                   /db_xref="UniProtKB/TrEMBL:B1ATX6"
FT                   /protein_id="EDL14034.1"
FT                   /translation="MSEIRFSNLTWDHIVTLDRVLHEVIPIHGRGNFPTLEVKPKDIIH
FT                   IVKDQLIKQGIVVKDTRLNGSTASYILASHNGISYKDLDIIFGVDIPSDEEFHVVKDAV
FT                   LSCLFDFLPKGVKKEKITLKTMKEAYVQKMVKICNNHDRWSLISLSNNNGKNVELKFVN
FT                   SLRRQFEFSVDSFQILLDSMLDFYSVPNAKLTKESCPVVVAESMYGDFQEAMIHLKYKL
FT                   ISTRKPEEIRGGGLLKYSNLLVRDFKPACQTEIKTLERYMCSRFFIDFPDVAEQQKKIE
FT                   SYLHNHFIGEAKNKYDYLMTLHGVVNQSTVCLMGYERRQTLNMITLLALKVLGEQNILP
FT                   STDNVTCFYQPAPYLVLEGGYPSYYVASGLPLVYFQPCHTVQFPVQNGMM"
FT   assembly_gap    12717729..12718602
FT                   /estimated_length=874
FT                   /gap_type="unknown"
FT   assembly_gap    12720878..12720897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12724138..12724157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12734973..12735074
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    12768701..12769117
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   gene            complement(12778542..12781333)
FT                   /locus_tag="mCG_8518"
FT                   /note="gene_id=mCG8518.2"
FT   mRNA            complement(join(12778542..12778884,12779389..12780132,
FT                   12781174..12781333))
FT                   /locus_tag="mCG_8518"
FT                   /product="mCG8518"
FT                   /note="gene_id=mCG8518.2 transcript_id=mCT7514.2 created on
FT                   09-AUG-2002"
FT   CDS             complement(join(12778622..12778884,12779389..12780031))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8518"
FT                   /product="mCG8518"
FT                   /note="gene_id=mCG8518.2 transcript_id=mCT7514.2
FT                   protein_id=mCP15013.2"
FT                   /protein_id="EDL14033.1"
FT                   /translation="MNKGQTSEKKHIQNQNINHAGDFKNVLQCQLLKEHIPVDHIPASG
FT                   NEESHSYLDQYDGGSSSYIFQSNRNKCQGRYAANDLPDVQDHFYHCIGHVSKSQPRVLY
FT                   GIGKGGVVLRQGPTLAHYKSNVFVNPLAPEAPPLPSDWLIQLISSKRPSAHGVVSSRRS
FT                   RGTSSLLVLERTTTLPPASSKSNPNIDLIMLPEVEFTATSESLEYYELQKQGQRALKIR
FT                   QYTIESAYASIMQTPSSLPIMTKPRNELMEEIRKGIKLHKTQPRPENEDLENGAEMIRV
FT                   RRKAMGYHSEKSDSETEWIE"
FT   assembly_gap    12782889..12782908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12787137..12787156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12791861..12791899
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    12800164..12800183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12808445..12808464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12811665..12814682
FT                   /estimated_length=3018
FT                   /gap_type="unknown"
FT   assembly_gap    12816699..12816956
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    12834603..12834622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12837699..12837718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12839806..12839825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12849075..12849094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12849714..12850081
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    12851270..12851403
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    12860827..12860846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12863992..12864273
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    12865219..12865238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12866827..12866846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12876630..12876649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12883265..12883535
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   gene            12889351..12892002
FT                   /pseudo
FT                   /locus_tag="mCG_1030944"
FT                   /note="gene_id=mCG1030944.1"
FT   mRNA            12889351..12892002
FT                   /pseudo
FT                   /locus_tag="mCG_1030944"
FT                   /note="gene_id=mCG1030944.1 transcript_id=mCT148648.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    12899677..12905746
FT                   /estimated_length=6070
FT                   /gap_type="unknown"
FT   assembly_gap    12907615..12907766
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    12911873..12911892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12920236..12920379
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    12930729..12934485
FT                   /estimated_length=3757
FT                   /gap_type="unknown"
FT   assembly_gap    12938371..12940124
FT                   /estimated_length=1754
FT                   /gap_type="unknown"
FT   assembly_gap    12942436..12942670
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    12943842..12949342
FT                   /estimated_length=5501
FT                   /gap_type="unknown"
FT   assembly_gap    12955786..12955830
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    12958755..12958833
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    12963766..12963785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12973999..12974103
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    12979981..12980000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12991630..12991789
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    12993217..12993236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12999964..12999983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13003304..13004577
FT                   /estimated_length=1274
FT                   /gap_type="unknown"
FT   assembly_gap    13006979..13006998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13018377..13018396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13028477..13028496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13030248..13030489
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    13039222..13039925
FT                   /estimated_length=704
FT                   /gap_type="unknown"
FT   assembly_gap    13047371..13048061
FT                   /estimated_length=691
FT                   /gap_type="unknown"
FT   assembly_gap    13055775..13055794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13060659..13061134
FT                   /estimated_length=476
FT                   /gap_type="unknown"
FT   assembly_gap    13067841..13068119
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    13068580..13068697
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    13076640..13076659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13081670..13081689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13096636..13096655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13099997..13100548
FT                   /estimated_length=552
FT                   /gap_type="unknown"
FT   assembly_gap    13103447..13103466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13106400..13106419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13113253..13113272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13117990..13118565
FT                   /estimated_length=576
FT                   /gap_type="unknown"
FT   assembly_gap    13125872..13125891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13127304..13144742
FT                   /estimated_length=17439
FT                   /gap_type="unknown"
FT   assembly_gap    13152065..13152147
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    13182003..13182788
FT                   /estimated_length=786
FT                   /gap_type="unknown"
FT   assembly_gap    13183791..13184546
FT                   /estimated_length=756
FT                   /gap_type="unknown"
FT   assembly_gap    13193831..13193850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13196177..13199451
FT                   /estimated_length=3275
FT                   /gap_type="unknown"
FT   assembly_gap    13207805..13209425
FT                   /estimated_length=1621
FT                   /gap_type="unknown"
FT   assembly_gap    13217749..13218249
FT                   /estimated_length=501
FT                   /gap_type="unknown"
FT   assembly_gap    13223240..13224437
FT                   /estimated_length=1198
FT                   /gap_type="unknown"
FT   assembly_gap    13225105..13226552
FT                   /estimated_length=1448
FT                   /gap_type="unknown"
FT   gene            <13227475..13228646
FT                   /locus_tag="mCG_1030969"
FT                   /note="gene_id=mCG1030969.1"
FT   mRNA            <13227475..13228646
FT                   /locus_tag="mCG_1030969"
FT                   /product="mCG1030969"
FT                   /note="gene_id=mCG1030969.1 transcript_id=mCT148673.1
FT                   created on 16-AUG-2002"
FT   CDS             <13227477..13228250
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030969"
FT                   /product="mCG1030969"
FT                   /note="gene_id=mCG1030969.1 transcript_id=mCT148673.1
FT                   protein_id=mCP69974.1"
FT                   /protein_id="EDL14032.1"
FT                   /translation="LYLFDSTSRLISSLYLTSRLCFTQNLAMSLPSSSLAKPVVESSPE
FT                   AQGGLGADKHERAEGAEEAKKTLWPAHPGLPPAGTTASLSGEEGQSSSGEVGTQECLAS
FT                   EPPQWEEGKAEEKAVVESEEKAAVESDQEERLIPLSQMIPYISCFICKGYLIDAATITE
FT                   CLHTFCKSCIVKHFEHSNRCPKCNIIVHQAKPHKNLRMDPQLQSIVYKLVAGLEENEKK
FT                   QRREFNKEHCLGPPEPAAVPQPGHSSEENTKEVVE"
FT   assembly_gap    13232571..13232590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13238772..13238791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13240187..13240218
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    13249863..13249901
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    13254846..13255561
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   assembly_gap    13259876..13259896
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   gene            13266792..13270077
FT                   /pseudo
FT                   /locus_tag="mCG_117153"
FT                   /note="gene_id=mCG117153.1"
FT   mRNA            13266792..13270077
FT                   /pseudo
FT                   /locus_tag="mCG_117153"
FT                   /note="gene_id=mCG117153.1 transcript_id=mCT118275.1
FT                   created on 09-AUG-2002"
FT   assembly_gap    13276508..13276527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13296410..13296507
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    13300381..13300683
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    13312593..13312929
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    13320029..13322808
FT                   /estimated_length=2780
FT                   /gap_type="unknown"
FT   assembly_gap    13335119..13336061
FT                   /estimated_length=943
FT                   /gap_type="unknown"
FT   assembly_gap    13340606..13340625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13342826..13342885
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    13344409..13344851
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    13359334..13359353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13377717..13377736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13380187..13380475
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    13389631..13390049
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    13391193..13393146
FT                   /estimated_length=1954
FT                   /gap_type="unknown"
FT   assembly_gap    13400986..13401143
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    13403247..13407683
FT                   /estimated_length=4437
FT                   /gap_type="unknown"
FT   assembly_gap    13413267..13413286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13436612..13436631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13454030..13454049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13463909..13463928
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13469144..13470996
FT                   /estimated_length=1853
FT                   /gap_type="unknown"
FT   assembly_gap    13472557..13472576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13481288..13481307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13487742..13488599
FT                   /estimated_length=858
FT                   /gap_type="unknown"
FT   assembly_gap    13510808..13512182
FT                   /estimated_length=1375
FT                   /gap_type="unknown"
FT   assembly_gap    13513720..13513827
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    13532759..13532858
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    13536154..13536719
FT                   /estimated_length=566
FT                   /gap_type="unknown"
FT   assembly_gap    13560281..13560499
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   gene            complement(13560557..13656294)
FT                   /locus_tag="mCG_117148"
FT                   /note="gene_id=mCG117148.2"
FT   mRNA            complement(join(13560557..13564845,13570284..13570437,
FT                   13571233..13571330,13571692..13571773,13572201..13572247,
FT                   13574243..13574395,13576841..13576981,13577771..13577827,
FT                   13578945..13579023,13579109..13579234,13580274..13580394,
FT                   13581031..13581051,13581073..13581204,13581314..13581375,
FT                   13581742..13581916,13582679..13582761,13583516..13583640,
FT                   13586573..13586680,13589277..13589390,13590214..13590304,
FT                   13591074..13591150,13592856..13593005,13594822..13594915,
FT                   13596339..13596522,13599764..13599931,13601413..13601638,
FT                   13605640..13605768,13607175..13607309,13611261..13611414,
FT                   13615800..13615840,13625446..13625667,13626901..13627061,
FT                   13646371..13646469,13646910..13647060,13655166..13655225,
FT                   13655629..13655658,13655860..13655918,13656051..13656294))
FT                   /locus_tag="mCG_117148"
FT                   /product="mCG117148"
FT                   /note="gene_id=mCG117148.2 transcript_id=mCT118278.1
FT                   created on 19-JUN-2003"
FT   assembly_gap    13564947..13564966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13566368..13566387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13568131..13569251
FT                   /estimated_length=1121
FT                   /gap_type="unknown"
FT   assembly_gap    13571787..13572195
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    13581052..13581071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(13581095..13581204,13581314..13581375,
FT                   13581742..13581916,13582679..13582761,13583516..13583640,
FT                   13586573..13586680,13589277..13589390,13590214..13590304,
FT                   13591074..13591150,13592856..13593005,13594822..13594915,
FT                   13596339..13596522,13599764..13599931,13601413..13601638,
FT                   13605640..13605768,13607175..13607309,13611261..13611414,
FT                   13615800..13615840,13625446..13625667,13626901..13627061,
FT                   13646371..13646469,13646910..13647060,13655166..13655225,
FT                   13655629..13655658,13655860..13655918,13656051..13656081))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117148"
FT                   /product="mCG117148"
FT                   /note="gene_id=mCG117148.2 transcript_id=mCT118278.1
FT                   protein_id=mCP69955.1"
FT                   /protein_id="EDL14031.1"
FT                   /translation="MAAAPTQIEAELYYLIARFLQSGPCNKSAQVLVQELEEHQLIPRR
FT                   LDWEGKEHRRSFEDLVAANAHIPPDYLLKICERIGPLLDKEIPQSVPGVQTLLGVGRQS
FT                   LLRDAKDCKSTLWNGSAFAALHRGRPPELPVNYVKPPNVVNITSARQLTGCSRFSHVFP
FT                   SSAYQHIKMHKRILGHLSSVYCVAFDRSGRRIFTGSDDCLVKIWATDDGRLLATLRGHS
FT                   AEISDMAVNYENTLIAAGSCDKVVRVWCLRTCAPVAVLQGHSASITSIQDKVVAVQFCN
FT                   NGDRNNLTSAEDKVTKLKVTMVAWDRYDTTVITAVNNFLLKVWNSVTGQLLHTLSGHDD
FT                   EVFVLEAHPFDQRIILSAGHDGNIFIWDLDRGTKIRNYFNMIEGQGHGAVFDCKFSPDG
FT                   NHFACTDSHGHLLLFGFGCSKYYEKIPDQMFFHTDYRPLIRDANNYVLDEQTQQAPHLM
FT                   PPPFLVDVDGNPHPTKFQRLVPGRENCKDEQLIPQLGYVANGDGEVVEQVIGQQTNDQE
FT                   ESILDGIIRELQREQDLRLINEGDVPHFPINRSYSVNGALSSPNMDIPSSPNIGLRRSG
FT                   QIEGVRQMHNNAPRSQMATERDLMAWSRRVVVNELNSGVSRVQEECRNAKGDLEVSLYT
FT                   VEKKKKPSYPIQRNDYQPSCGRSLRRTQRKRQHTYLTRSNIEHNSQASSQTSGVQEDSD
FT                   SSSEEDETVGTSDASVEDPVVEWQSESSSRQATQKIYSSSEDENLKLEDRQKKPKQTKK
FT                   KKGGLVSMAGEPNEEWLAPQWILDTIPRRSPFVPQMGDELIYFRQGHEAYVRAVRKSKI
FT                   YSVNLQKQPWNKMDLREQEFVKIVGIKYEIGPPTLCCLKLAFLDPISGKMTGESFSIKY
FT                   HDMPDVIDFLVLHQFYNEAKERNWQIEIRHNLNGNRAYSHGLFEFIIGDRFRSIIDDAW
FT                   WFGTVESQQPFQPEYPDSSFQCYSVHWDNNEREKMSPWDMEPIPDGTAFPDEVGAGIPV
FT                   SQEELTALLYKPQEGEWGAHYQR"
FT   assembly_gap    13587622..13587645
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    13590315..13590334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13593022..13593041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13599465..13599484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13613479..13613538
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    13620186..13620205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13627173..13627314
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    13632739..13632783
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    13633647..13633971
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    13635569..13635588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13636724..13636743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13639804..13639823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13650164..13650563
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   gene            <13656429..13708963
FT                   /locus_tag="mCG_145219"
FT                   /note="gene_id=mCG145219.0"
FT   mRNA            join(<13656429..13656637,13658218..13658307,
FT                   13678000..13678049,13680388..13680492,13708412..13708963)
FT                   /locus_tag="mCG_145219"
FT                   /product="mCG145219"
FT                   /note="gene_id=mCG145219.0 transcript_id=mCT184643.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<13656479..13656637,13658218..13658307,
FT                   13678000..13678014)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145219"
FT                   /product="mCG145219"
FT                   /note="gene_id=mCG145219.0 transcript_id=mCT184643.0
FT                   protein_id=mCP106219.0"
FT                   /protein_id="EDL14030.1"
FT                   /translation="AGLGLPSYCPENKEEVLNAGRRSGNLRQTLWWRWRPRAPELLTLP
FT                   VRAIGPFPACDIIIPAITKTVNLDAIKRENSTHLWKFKILNM"
FT   assembly_gap    13662569..13662630
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    13665653..13665900
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    13682672..13682691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13686526..13686719
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    13702230..13702779
FT                   /estimated_length=550
FT                   /gap_type="unknown"
FT   assembly_gap    13709946..13710229
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    13717249..13717268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13719416..13719543
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    13722127..13722490
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    13730301..13730328
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    13737756..13743249
FT                   /estimated_length=5494
FT                   /gap_type="unknown"
FT   assembly_gap    13759555..13759586
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    13776990..13777009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13792543..13792562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13819092..13820165
FT                   /pseudo
FT                   /locus_tag="mCG_1030923"
FT                   /note="gene_id=mCG1030923.1"
FT   mRNA            13819092..13820165
FT                   /pseudo
FT                   /locus_tag="mCG_1030923"
FT                   /note="gene_id=mCG1030923.1 transcript_id=mCT148627.1
FT                   created on 20-AUG-2002"
FT   assembly_gap    13820560..13820579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13822175..>13830643)
FT                   /locus_tag="mCG_4972"
FT                   /note="gene_id=mCG4972.2"
FT   mRNA            complement(join(13822175..13822732,13822762..13823728,
FT                   13825820..13825954,13828210..13828263,13828513..13828542,
FT                   13830532..>13830643))
FT                   /locus_tag="mCG_4972"
FT                   /product="mCG4972"
FT                   /note="gene_id=mCG4972.2 transcript_id=mCT4561.2 created on
FT                   08-NOV-2002"
FT   assembly_gap    13822737..13822756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(13822766..13823728,13825820..13825954,
FT                   13828210..13828263,13828513..>13828542))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4972"
FT                   /product="mCG4972"
FT                   /note="gene_id=mCG4972.2 transcript_id=mCT4561.2
FT                   protein_id=mCP13886.2"
FT                   /protein_id="EDL14029.1"
FT                   /translation="PKRRSARLSAMPVPFTPELKPKRASTSRKTKTTNVVEENKDASTI
FT                   PIPETKPEDVKDECNMENAENGEAKIMEAPIPKMEAEEVKEQINEDTEEDGGEKKEAVA
FT                   AEAKDDELKANIQDVEKDEDGKEHKDTGEEVEDGKIEEEGLNEKPGTAKSEDAEVSKDE
FT                   EEKGDNEKGEDGKEEGDEKEEEKDDKEGDTGTEKEVKEQNKEAEEDDGKCKEEENKEVG
FT                   KEGQPEEDGKEDLHEEVGKEDLHEEDGKEGQPEEDGKEIHHEEDGKEGQPEEDGKEYLH
FT                   EEDGEEGQPKEDQKEGQPEEDGKEDQPEEDGKEGQCKEDGKEGHHEEGGKEDLHEEDGK
FT                   EKDGGKEDRKEEGEQEVAVDEGSDENKVEAEEEGAENKDFKQDGEKEEPLSIV"
FT   assembly_gap    13828850..13829775
FT                   /estimated_length=926
FT                   /gap_type="unknown"
FT   assembly_gap    13832175..13832948
FT                   /estimated_length=774
FT                   /gap_type="unknown"
FT   assembly_gap    13833720..13833764
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    13844473..13844574
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    13849880..13849899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13853275..13853294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13855549..13861165
FT                   /estimated_length=5617
FT                   /gap_type="unknown"
FT   assembly_gap    13865802..13866239
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    13873248..13877562
FT                   /estimated_length=4315
FT                   /gap_type="unknown"
FT   assembly_gap    13884386..13885795
FT                   /estimated_length=1410
FT                   /gap_type="unknown"
FT   assembly_gap    13899370..13899835
FT                   /estimated_length=466
FT                   /gap_type="unknown"
FT   assembly_gap    13900845..13900864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13902372..13902391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13904466..13904605
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            13913905..14021253
FT                   /gene="Sh3bgrl"
FT                   /locus_tag="mCG_117316"
FT                   /note="gene_id=mCG117316.2"
FT   mRNA            join(13913905..13914217,13968280..13968342,
FT                   13968420..13968544,13978562..13980895)
FT                   /gene="Sh3bgrl"
FT                   /locus_tag="mCG_117316"
FT                   /product="SH3-binding domain glutamic acid-rich protein
FT                   like, transcript variant mCT171561"
FT                   /note="gene_id=mCG117316.2 transcript_id=mCT171561.1
FT                   created on 23-JUN-2003"
FT   mRNA            join(13913907..13914217,13968446..13968544,
FT                   13978566..13980895)
FT                   /gene="Sh3bgrl"
FT                   /locus_tag="mCG_117316"
FT                   /product="SH3-binding domain glutamic acid-rich protein
FT                   like, transcript variant mCT118453"
FT                   /note="gene_id=mCG117316.2 transcript_id=mCT118453.2
FT                   created on 23-JUN-2003"
FT   mRNA            join(13914089..13914217,13968280..13968342,
FT                   13968420..13968545,14017526..14017701,14018591..14021253)
FT                   /gene="Sh3bgrl"
FT                   /locus_tag="mCG_117316"
FT                   /product="SH3-binding domain glutamic acid-rich protein
FT                   like, transcript variant mCT58798"
FT                   /note="gene_id=mCG117316.2 transcript_id=mCT58798.2 created
FT                   on 23-JUN-2003"
FT   CDS             join(13914173..13914217,13968446..13968544,
FT                   13978566..13978631)
FT                   /codon_start=1
FT                   /gene="Sh3bgrl"
FT                   /locus_tag="mCG_117316"
FT                   /product="SH3-binding domain glutamic acid-rich protein
FT                   like, isoform CRA_a"
FT                   /note="gene_id=mCG117316.2 transcript_id=mCT118453.2
FT                   protein_id=mCP70019.2 isoform=CRA_a"
FT                   /protein_id="EDL14026.1"
FT                   /translation="MVIRVYIASSSGSTANRKWMRENVPEDSRPSTGYPLPPQIFNECQ
FT                   YRGPKPRQISKHECSEFFLQHLEK"
FT   CDS             join(13914173..13914217,13968280..13968342,
FT                   13968420..13968461)
FT                   /codon_start=1
FT                   /gene="Sh3bgrl"
FT                   /locus_tag="mCG_117316"
FT                   /product="SH3-binding domain glutamic acid-rich protein
FT                   like, isoform CRA_b"
FT                   /note="gene_id=mCG117316.2 transcript_id=mCT171561.1
FT                   protein_id=mCP94480.1 isoform=CRA_b"
FT                   /protein_id="EDL14027.1"
FT                   /translation="MVIRVYIASSSGSTAIKKKQQDVLCFLEANKIGFEEKKILQLMKR
FT                   IGSG"
FT   CDS             join(13914173..13914217,13968280..13968342,
FT                   13968420..13968461)
FT                   /codon_start=1
FT                   /gene="Sh3bgrl"
FT                   /locus_tag="mCG_117316"
FT                   /product="SH3-binding domain glutamic acid-rich protein
FT                   like, isoform CRA_b"
FT                   /note="gene_id=mCG117316.2 transcript_id=mCT58798.2
FT                   protein_id=mCP36775.1 isoform=CRA_b"
FT                   /protein_id="EDL14028.1"
FT                   /translation="MVIRVYIASSSGSTAIKKKQQDVLCFLEANKIGFEEKKILQLMKR
FT                   IGSG"
FT   assembly_gap    13916945..13916964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13937806..13937825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13950234..13950575
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    13960674..13960693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13968343..13968411
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    13972621..13973219
FT                   /estimated_length=599
FT                   /gap_type="unknown"
FT   assembly_gap    13977152..13977249
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    13996117..13996136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13997970..13997989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14001258..14001277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14002550..14002569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14003655..14004736
FT                   /estimated_length=1082
FT                   /gap_type="unknown"
FT   assembly_gap    14010186..14010205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14013148..14013224
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    14024637..14024656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14027169..14027188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14032896..14033757
FT                   /estimated_length=862
FT                   /gap_type="unknown"
FT   assembly_gap    14035502..14035681
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    14043535..14043554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14047090..14047269
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    14048026..14048592
FT                   /estimated_length=567
FT                   /gap_type="unknown"
FT   assembly_gap    14051477..14051609
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    14052790..14052809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14053941..14054389
FT                   /estimated_length=449
FT                   /gap_type="unknown"
FT   assembly_gap    14057421..14057949
FT                   /estimated_length=529
FT                   /gap_type="unknown"
FT   assembly_gap    14060143..14060162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14063022..14063328
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    14071460..14071479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14079412..14079431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14081081..14081121
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    14082316..14083318
FT                   /estimated_length=1003
FT                   /gap_type="unknown"
FT   assembly_gap    14088669..14099696
FT                   /estimated_length=11028
FT                   /gap_type="unknown"
FT   assembly_gap    14121800..14122019
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    14128764..14128875
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    14138427..14138529
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    14140789..14140878
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    14143679..14145067
FT                   /estimated_length=1389
FT                   /gap_type="unknown"
FT   assembly_gap    14146587..14150973
FT                   /estimated_length=4387
FT                   /gap_type="unknown"
FT   assembly_gap    14153173..14153398
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    14156230..14156249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14159420..14159506
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    14177036..14177318
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    14182468..14187484
FT                   /estimated_length=5017
FT                   /gap_type="unknown"
FT   assembly_gap    14194628..14194769
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   gene            <14199824..>14200678
FT                   /locus_tag="mCG_1030968"
FT                   /note="gene_id=mCG1030968.1"
FT   mRNA            <14199824..>14200678
FT                   /locus_tag="mCG_1030968"
FT                   /product="mCG1030968"
FT                   /note="gene_id=mCG1030968.1 transcript_id=mCT148672.1
FT                   created on 16-AUG-2002"
FT   CDS             <14200280..>14200678
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030968"
FT                   /product="mCG1030968"
FT                   /note="gene_id=mCG1030968.1 transcript_id=mCT148672.1
FT                   protein_id=mCP69970.1"
FT                   /protein_id="EDL14025.1"
FT                   /translation="DQGIISLQVPDYPQQGGLPSLELTPTKVHIYRDARETRTLLNCSL
FT                   HYPLFLRGVKKPTLLSRKPVRVTYIINKHQSRASVKEIYRNLKTPHSRLKTSNSPHLHT
FT                   PIHYPSPLVGAESCRSRQKSKTAQRKLTV"
FT   assembly_gap    14202319..14202342
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            complement(<14202563..>14205066)
FT                   /locus_tag="mCG_117317"
FT                   /note="gene_id=mCG117317.1"
FT   mRNA            complement(join(<14202563..14203398,14205000..>14205066))
FT                   /locus_tag="mCG_117317"
FT                   /product="mCG117317"
FT                   /note="gene_id=mCG117317.1 transcript_id=mCT118454.1
FT                   created on 04-SEP-2002"
FT   CDS             complement(<14202563..>14203206)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117317"
FT                   /product="mCG117317"
FT                   /note="gene_id=mCG117317.1 transcript_id=mCT118454.1
FT                   protein_id=mCP70023.1"
FT                   /protein_id="EDL14024.1"
FT                   /translation="PEPSSKSPPYTAFLENLPYNVTEDSIKDFFRGLNISAVSLPREPG
FT                   NPDRLKGFGYAEFEDLDSLLSTLSLNEESLGNRRIRVDVAGQAQDKDRDDRSFGRDRNR
FT                   DSDKTDTDWRACPATDSFDDYTPRRGDDSFGEKYRDHYDSDQYRDGYRDGYRDGPHRDM
FT                   DHYGSWDRYGDQGIRDYDRGYDSRIGSGRRAFGSEYLRDDDYRGHGDHYEDR"
FT   assembly_gap    14227119..14227986
FT                   /estimated_length=868
FT                   /gap_type="unknown"
FT   assembly_gap    14232335..14232354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14248178..14249804
FT                   /estimated_length=1627
FT                   /gap_type="unknown"
FT   assembly_gap    14270388..14270407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14273318..14273337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14287065..14290292
FT                   /estimated_length=3228
FT                   /gap_type="unknown"
FT   assembly_gap    14291415..14291862
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   assembly_gap    14293554..14293592
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    14310289..14310308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14314841..14315198
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    14316559..14316578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14318659..14318678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14325399..14327365
FT                   /estimated_length=1967
FT                   /gap_type="unknown"
FT   assembly_gap    14329041..14329280
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    14332792..14333690
FT                   /estimated_length=899
FT                   /gap_type="unknown"
FT   assembly_gap    14341037..14341696
FT                   /estimated_length=660
FT                   /gap_type="unknown"
FT   assembly_gap    14343883..14343902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14346766..14346807
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    14350548..14353013
FT                   /estimated_length=2466
FT                   /gap_type="unknown"
FT   assembly_gap    14353762..14355433
FT                   /estimated_length=1672
FT                   /gap_type="unknown"
FT   assembly_gap    14397869..14397896
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    14411457..14411626
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    14416942..14420642
FT                   /estimated_length=3701
FT                   /gap_type="unknown"
FT   assembly_gap    14429597..14429616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14440285..14440304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14442228..14442247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14449598..14449722
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    14453218..14453237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14469814..14469833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14475723..14475742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14499015..14499034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14515635..14515654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14517568..14519995
FT                   /estimated_length=2428
FT                   /gap_type="unknown"
FT   assembly_gap    14524915..14525030
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    14553440..14553978
FT                   /estimated_length=539
FT                   /gap_type="unknown"
FT   assembly_gap    14569145..14569248
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    14570791..14570810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14574431..14574910
FT                   /estimated_length=480
FT                   /gap_type="unknown"
FT   assembly_gap    14577532..14578104
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    14631026..14637389
FT                   /estimated_length=6364
FT                   /gap_type="unknown"
FT   assembly_gap    14651619..14651829
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    14659685..14660057
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    14666930..14666994
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    14672428..14684582
FT                   /estimated_length=12155
FT                   /gap_type="unknown"
FT   assembly_gap    14686654..14686678
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    14688230..14688869
FT                   /estimated_length=640
FT                   /gap_type="unknown"
FT   assembly_gap    14693842..14693861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14705903..14705922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14707252..14707918
FT                   /estimated_length=667
FT                   /gap_type="unknown"
FT   assembly_gap    14716967..14717276
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   gene            <14718167..14719756
FT                   /locus_tag="mCG_1030922"
FT                   /note="gene_id=mCG1030922.1"
FT   mRNA            <14718167..14719756
FT                   /locus_tag="mCG_1030922"
FT                   /product="mCG1030922"
FT                   /note="gene_id=mCG1030922.1 transcript_id=mCT148626.1
FT                   created on 20-AUG-2002"
FT   CDS             <14718168..14719298
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030922"
FT                   /product="mCG1030922"
FT                   /note="gene_id=mCG1030922.1 transcript_id=mCT148626.1
FT                   protein_id=mCP69759.1"
FT                   /protein_id="EDL14023.1"
FT                   /translation="FKNKGKDSTEMCRCGIEVNVEPRKAKNDEQMLKRRNFSSFPDDDT
FT                   FLLQENQNNQGTVNWSVEDTVKGINSNNLESQLQTTQAAQKLLSREKQPPIDNIIRAGL
FT                   IPIFMSFLGKTGCSPIKFESAWALTNIASGTSEQTNAVVDGGPMPAFISLLASLHAHIS
FT                   EQAVWALGTIAGNISAFQNLVIKHGAIDPLLTFLAVPDLPSLTCGYLHNLTWTLSNLCQ
FT                   NKNPAFSLEAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNELIEMVVKKGVVPQ
FT                   LVKLLGATELPTVTPTLRRAIGYIVTGTDEQTQKVIDAGALAVPKTNIQKEATWTMSNI
FT                   TAGRQDQIQQVVNHSLVPLLIGVLSKADFKTQKEAA"
FT   assembly_gap    14721085..14721104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14723103..14723122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14740237..14740256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14748461..14748480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14765725..14765744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14778247..14778349
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    14785021..14791188
FT                   /estimated_length=6168
FT                   /gap_type="unknown"
FT   assembly_gap    14796256..14796348
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    14801459..14801781
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    14805585..14805695
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    14808388..14808462
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    14833292..14833311
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14846048..14846134
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    14846767..14847151
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    14850661..14851785
FT                   /estimated_length=1125
FT                   /gap_type="unknown"
FT   assembly_gap    14852529..14854828
FT                   /estimated_length=2300
FT                   /gap_type="unknown"
FT   assembly_gap    14856230..14856385
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    14879095..14879144
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    14891288..14900181
FT                   /estimated_length=8894
FT                   /gap_type="unknown"
FT   assembly_gap    14908632..14908651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14924540..14924559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14935561..14935682
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    14939520..14939539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14945455..14945474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14951763..14951782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14958353..14958372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14962614..14962775
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    14977371..14977390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14988607..14988626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14994146..14994165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15011890..15011991
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    15012700..15012719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15020701..15021674
FT                   /estimated_length=974
FT                   /gap_type="unknown"
FT   assembly_gap    15032331..15032350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15047068..15047087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15053912..15054009
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    15059884..15059903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15061533..15064932
FT                   /estimated_length=3400
FT                   /gap_type="unknown"
FT   assembly_gap    15069803..15069900
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    15072412..15072594
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    15082588..15082607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15089082..15090087
FT                   /estimated_length=1006
FT                   /gap_type="unknown"
FT   assembly_gap    15104751..15104770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15110335..15111217
FT                   /estimated_length=883
FT                   /gap_type="unknown"
FT   assembly_gap    15136950..15136969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15137789..15139254
FT                   /estimated_length=1466
FT                   /gap_type="unknown"
FT   assembly_gap    15145614..15145913
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    15153699..15153718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15169288..15169445
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    15176098..15176491
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    15188589..15188608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15198190..15200010
FT                   /estimated_length=1821
FT                   /gap_type="unknown"
FT   assembly_gap    15201525..15201544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15202898..15202917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15205059..15205078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<15205081..15205417)
FT                   /locus_tag="mCG_147485"
FT                   /note="gene_id=mCG147485.0"
FT   mRNA            complement(<15205081..15205417)
FT                   /locus_tag="mCG_147485"
FT                   /product="mCG147485"
FT                   /note="gene_id=mCG147485.0 transcript_id=mCT187748.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<15205081..15205369)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147485"
FT                   /product="mCG147485"
FT                   /note="gene_id=mCG147485.0 transcript_id=mCT187748.0
FT                   protein_id=mCP108721.0"
FT                   /protein_id="EDL14022.1"
FT                   /translation="MAKGKPKNPTNRNQDHSPSSERSTPTPPSPGHPNTTENLDPDLKT
FT                   FLMMMIEDIKKDIHKSLKELQESTAKELQALKEKQENTAKQVEIIKEKQEN"
FT   assembly_gap    15218719..15218738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15221369..15222089
FT                   /estimated_length=721
FT                   /gap_type="unknown"
FT   assembly_gap    15223957..15224051
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    15231501..15235637
FT                   /estimated_length=4137
FT                   /gap_type="unknown"
FT   assembly_gap    15238324..15238623
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    15245385..15250795
FT                   /estimated_length=5411
FT                   /gap_type="unknown"
FT   assembly_gap    15251686..15251973
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    15253956..15254324
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    15256421..15259444
FT                   /estimated_length=3024
FT                   /gap_type="unknown"
FT   assembly_gap    15260704..15262420
FT                   /estimated_length=1717
FT                   /gap_type="unknown"
FT   assembly_gap    15276916..15276935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15278187..15278264
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    15280911..15280930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15302616..15317968
FT                   /estimated_length=15353
FT                   /gap_type="unknown"
FT   assembly_gap    15320390..15324641
FT                   /estimated_length=4252
FT                   /gap_type="unknown"
FT   gene            15344651..15345801
FT                   /pseudo
FT                   /locus_tag="mCG_1030967"
FT                   /note="gene_id=mCG1030967.1"
FT   mRNA            15344651..15345801
FT                   /pseudo
FT                   /locus_tag="mCG_1030967"
FT                   /note="gene_id=mCG1030967.1 transcript_id=mCT148671.1
FT                   created on 16-AUG-2002"
FT   assembly_gap    15347323..15347380
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    15350631..15350650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15355627..15355646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15365396..15365415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15369984..15370605
FT                   /estimated_length=622
FT                   /gap_type="unknown"
FT   assembly_gap    15371533..15371849
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    15376538..15376557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15404804..15404960
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   gene            15409485..15412148
FT                   /pseudo
FT                   /locus_tag="mCG_1030943"
FT                   /note="gene_id=mCG1030943.1"
FT   mRNA            15409485..15412148
FT                   /pseudo
FT                   /locus_tag="mCG_1030943"
FT                   /note="gene_id=mCG1030943.1 transcript_id=mCT148647.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    15414630..15414649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15416181..15430537
FT                   /estimated_length=14357
FT                   /gap_type="unknown"
FT   assembly_gap    15431954..15431973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15439245..15439264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15443218..15444825
FT                   /estimated_length=1608
FT                   /gap_type="unknown"
FT   assembly_gap    15446201..15446424
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    15457978..15457997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15475091..15476338
FT                   /estimated_length=1248
FT                   /gap_type="unknown"
FT   assembly_gap    15498063..15498675
FT                   /estimated_length=613
FT                   /gap_type="unknown"
FT   assembly_gap    15500028..15500238
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    15505360..15506002
FT                   /estimated_length=643
FT                   /gap_type="unknown"
FT   assembly_gap    15508467..15508640
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    15518878..15518897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15526396..15526415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15538396..15546224
FT                   /estimated_length=7829
FT                   /gap_type="unknown"
FT   assembly_gap    15548737..15549285
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   assembly_gap    15570875..15570894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15580434..15580453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15610128..15610251
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    15620920..15620939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15624634..15624821
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   gene            15628896..15631507
FT                   /gene="Pou3f4"
FT                   /locus_tag="mCG_48623"
FT                   /note="gene_id=mCG48623.2"
FT   mRNA            15628896..15631507
FT                   /gene="Pou3f4"
FT                   /locus_tag="mCG_48623"
FT                   /product="POU domain, class 3, transcription factor 4"
FT                   /note="gene_id=mCG48623.2 transcript_id=mCT48806.2 created
FT                   on 07-AUG-2002"
FT   CDS             15628939..15630024
FT                   /codon_start=1
FT                   /gene="Pou3f4"
FT                   /locus_tag="mCG_48623"
FT                   /product="POU domain, class 3, transcription factor 4"
FT                   /note="gene_id=mCG48623.2 transcript_id=mCT48806.2
FT                   protein_id=mCP34552.1 partial"
FT                   /db_xref="GOA:A6H6L6"
FT                   /db_xref="InterPro:IPR000327"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013847"
FT                   /db_xref="InterPro:IPR016362"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:101894"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6L6"
FT                   /protein_id="EDL14021.1"
FT                   /translation="MATAASNPYSILSSSSLVHADSAGMQQGSPFRNPQKLLQSDYLQG
FT                   VPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHH
FT                   SPHTNHPNAWGASPAPNSSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASTQSLH
FT                   PVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTL
FT                   YGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKK
FT                   RTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPG
FT                   DQQPHEVYSHTVKTDASCHDL"
FT   assembly_gap    15630796..15630815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15639807..15639826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15645370..15645948
FT                   /estimated_length=579
FT                   /gap_type="unknown"
FT   assembly_gap    15654343..15656227
FT                   /estimated_length=1885
FT                   /gap_type="unknown"
FT   assembly_gap    15657892..15657911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15679315..15683800
FT                   /estimated_length=4486
FT                   /gap_type="unknown"
FT   assembly_gap    15686268..15700527
FT                   /estimated_length=14260
FT                   /gap_type="unknown"
FT   assembly_gap    15708477..15710251
FT                   /estimated_length=1775
FT                   /gap_type="unknown"
FT   assembly_gap    15717882..15717901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15722238..15722512
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    15732695..15733006
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    15736354..15736373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15754753..15754940
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    15761697..15768486
FT                   /estimated_length=6790
FT                   /gap_type="unknown"
FT   assembly_gap    15777316..15777335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15798453..15798472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15804779..15804798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15807064..15813684
FT                   /estimated_length=6621
FT                   /gap_type="unknown"
FT   assembly_gap    15820093..15820489
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    15821299..15821773
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   assembly_gap    15824466..15825047
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    15829181..15829200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15831494..15832372
FT                   /estimated_length=879
FT                   /gap_type="unknown"
FT   assembly_gap    15833144..15834028
FT                   /estimated_length=885
FT                   /gap_type="unknown"
FT   assembly_gap    15835249..15835369
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    15845769..15845788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15849729..15849748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15852602..15852684
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    15858827..15864845
FT                   /estimated_length=6019
FT                   /gap_type="unknown"
FT   assembly_gap    15868920..15868939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15870900..15871109
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    15886088..15886206
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    15904418..15904757
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    15911851..15911870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15913604..15913979
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    15915362..15919788
FT                   /estimated_length=4427
FT                   /gap_type="unknown"
FT   assembly_gap    15924084..15924235
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            15926268..15940125
FT                   /locus_tag="mCG_68164"
FT                   /note="gene_id=mCG68164.2"
FT   mRNA            join(15926268..15926326,15929137..15929190,
FT                   15935172..15935212,15936886..15937001,15938328..15940125)
FT                   /locus_tag="mCG_68164"
FT                   /product="mCG68164"
FT                   /note="gene_id=mCG68164.2 transcript_id=mCT68351.2 created
FT                   on 09-SEP-2002"
FT   CDS             join(15926310..15926326,15929137..15929190,
FT                   15935172..15935212,15936886..15937001,15938328..15940022)
FT                   /codon_start=1
FT                   /locus_tag="mCG_68164"
FT                   /product="mCG68164"
FT                   /note="gene_id=mCG68164.2 transcript_id=mCT68351.2
FT                   protein_id=mCP43424.2"
FT                   /db_xref="GOA:G3X9R0"
FT                   /db_xref="InterPro:IPR026189"
FT                   /db_xref="InterPro:IPR029354"
FT                   /db_xref="MGI:MGI:1914657"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9R0"
FT                   /protein_id="EDL14020.1"
FT                   /translation="MSLSKLDSEKLTIEDVQTSSSSCRREINTTTYDDYILSIQTSEKQ
FT                   NQEHFVLTFPKTPMPDKKKRSGPSELEVAVPIQVKRKIEKDQKPTHVWINQFLRDIFLK
FT                   SSFSRPFITQAPFKYLYNPQNHYTMAESRKSKNDERRKTLKIKFRGKISSCVVNLEPMR
FT                   TITNGEPEILGNTEKNPSKSSHKIKLPKTSNSTSETNLEYNNSKKTLEMSLRNGNKNSM
FT                   NFVLKGNAATCCKDNPNTDSKKSVEEFSDDISECINSSNMDLMLRLNEFRAEFTDLDVW
FT                   STNCSQNNAKKPLKTGGKKERDSDIDSGGSKDAKKEGKKKGKRESRKKRNTESSDAESG
FT                   DSKDGKKKSKHDKKNEIKKKKDTDSTGSGSGASMVSKKGKTEKKSTGKKSTGSTGSESV
FT                   DSKSTNKVKKQVKKGVMKKAVSTDSESDASSKKSKKDEKKENKGRKKKPIKDTESTDAD
FT                   SESEGDSTGKKNEKKDKKITKKGEKKDAKKNTASSESESDLGVNKKKTKIKEIVSFSDS
FT                   TSDSYSKAGRRKNVRRSDSESEDSSGFRVLKSTDDSEASSTDSKTGMPGMRRGFRSLSK
FT                   KTTFNERGKRSVTGRIPSSRERLPFPPCEPFRASPKPVHVCKCKESPSPKARYAPLVCL
FT                   LIINT"
FT   assembly_gap    15930784..15930912
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    15931657..15932902
FT                   /estimated_length=1246
FT                   /gap_type="unknown"
FT   assembly_gap    15937602..15937621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15944968..15944987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15945475..15946295
FT                   /estimated_length=821
FT                   /gap_type="unknown"
FT   assembly_gap    15946891..15951467
FT                   /estimated_length=4577
FT                   /gap_type="unknown"
FT   assembly_gap    15953904..15954445
FT                   /estimated_length=542
FT                   /gap_type="unknown"
FT   assembly_gap    15956794..15956815
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    15966883..15967703
FT                   /estimated_length=821
FT                   /gap_type="unknown"
FT   assembly_gap    15971956..15972791
FT                   /estimated_length=836
FT                   /gap_type="unknown"
FT   assembly_gap    15975086..15977024
FT                   /estimated_length=1939
FT                   /gap_type="unknown"
FT   assembly_gap    15978055..15978997
FT                   /estimated_length=943
FT                   /gap_type="unknown"
FT   gene            15979358..15979893
FT                   /locus_tag="mCG_60406"
FT                   /note="gene_id=mCG60406.1"
FT   mRNA            15979358..15979893
FT                   /locus_tag="mCG_60406"
FT                   /product="mCG60406"
FT                   /note="gene_id=mCG60406.1 transcript_id=mCT60589.2 created
FT                   on 15-AUG-2002"
FT   CDS             15979406..15979759
FT                   /codon_start=1
FT                   /locus_tag="mCG_60406"
FT                   /product="mCG60406"
FT                   /note="gene_id=mCG60406.1 transcript_id=mCT60589.2
FT                   protein_id=mCP41956.2"
FT                   /db_xref="GOA:D3YWP5"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR031952"
FT                   /db_xref="MGI:MGI:3800293"
FT                   /db_xref="UniProtKB/TrEMBL:D3YWP5"
FT                   /protein_id="EDL14019.1"
FT                   /translation="MMGTLVTCKDIPPWVKVPEDLKDPEVFQVHSLVLKSLFGPQGPRM
FT                   PHIEQVSQAVFELKNLESSKHTEVLIYGSQNNKIRAKWMLQSMAERYRLCQQRGVLKLE
FT                   EAMKTRELGQCTK"
FT   assembly_gap    15995126..15995314
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    15996875..15998027
FT                   /estimated_length=1153
FT                   /gap_type="unknown"
FT   assembly_gap    16002471..16002578
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    16010622..16010826
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    16012108..16012361
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    16013181..16014134
FT                   /estimated_length=954
FT                   /gap_type="unknown"
FT   assembly_gap    16023624..16023671
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    16029809..16029828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16039513..16039532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16041398..16047082
FT                   /estimated_length=5685
FT                   /gap_type="unknown"
FT   assembly_gap    16063193..16063377
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   gene            complement(16067856..16211626)
FT                   /gene="Rps6ka6"
FT                   /locus_tag="mCG_117315"
FT                   /note="gene_id=mCG117315.1"
FT   mRNA            complement(join(16067856..16069573,16070740..16070878,
FT                   16078686..16078805,16080315..16080391,16084784..16084945,
FT                   16087562..16087720,16088751..16088840,16089439..16089561,
FT                   16089956..16090068,16090641..16090743,16092811..16092869,
FT                   16093644..16093732,16093945..16094015,16097051..16097193,
FT                   16100865..16100902,16101623..16101729,16112506..16112585,
FT                   16114209..16114289,16115079..16115160,16119038..16119154,
FT                   16126062..16126121,16130123..16130185,16162259..16162390,
FT                   16211540..16211626))
FT                   /gene="Rps6ka6"
FT                   /locus_tag="mCG_117315"
FT                   /product="ribosomal protein S6 kinase polypeptide 6"
FT                   /note="gene_id=mCG117315.1 transcript_id=mCT118452.1
FT                   created on 09-AUG-2002"
FT   CDS             complement(join(16069442..16069573,16070740..16070878,
FT                   16078686..16078805,16080315..16080391,16084784..16084945,
FT                   16087562..16087720,16088751..16088840,16089439..16089561,
FT                   16089956..16090068,16090641..16090743,16092811..16092869,
FT                   16093644..16093732,16093945..16094015,16097051..16097193,
FT                   16100865..16100902,16101623..16101729,16112506..16112585,
FT                   16114209..16114289,16115079..16115160,16119038..16119154,
FT                   16126062..16126121,16130123..16130185,16162259..16162372))
FT                   /codon_start=1
FT                   /gene="Rps6ka6"
FT                   /locus_tag="mCG_117315"
FT                   /product="ribosomal protein S6 kinase polypeptide 6"
FT                   /note="gene_id=mCG117315.1 transcript_id=mCT118452.1
FT                   protein_id=mCP69897.1"
FT                   /protein_id="EDL14018.1"
FT                   /translation="MLNFRRTRHTPSGHRSNSNLNLFCCLPFFGCRRRSKSRPQVVFTM
FT                   KNAATVMREHERKEVNDLKMVDEPMEEGEPVSCRREELVKEIPITQHVKEGYEKADPAQ
FT                   FDLLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLRKASLKVRDRVRTKMERDILVEVN
FT                   HPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLAELALALDHLH
FT                   RLGIVYRDLKPENILLDEIGHIKLTDFGLSKESVDQEKKAYSFCGTVEYMAPEVVNRRG
FT                   HSQSADWWSYGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSAEAQSLLRMLF
FT                   KRNPANRLGSEGVEEVKRHAFFASIDWNKLYKREVQPPFRPASGKPDDTFCFDPEFTAK
FT                   TPKASANAHQLFKGFSFVATSIAEEYKITPVTSSNVLPIVQINGNAAQFSEAYELKEDI
FT                   GIGSYSVCKRCIHSASNVEFAVKIIDKNKRDPSEEIEILMRYGQHPNIISLKEVFDDGK
FT                   YVYLVTDLMKGGELLDRILKKKCFSEQEASNVLYVITKTVECLHSQGVVHRDLKPSNIL
FT                   YMDESAHPDSIKICDFGFAKQLRGENGLLLTPCYTANFVAPEVLTQQGYDAACDIWSLG
FT                   VLLYTMLAGYTPFSNGPNDTPEEILLRIGNGRFSLSGGIWGQYFHVEQSLLSHMLHMDP
FT                   HQRYTAEQVLKHPWITQREQLPRHQPNSDEPPQVVIEAVAAPYSVLARNPNRHHPILEP
FT                   VTASRLAQRRNMKKRTSTGL"
FT   assembly_gap    16073032..16073051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16074905..16075295
FT                   /estimated_length=391
FT                   /gap_type="unknown"
FT   assembly_gap    16076225..16076244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16078182..16078441
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    16095471..16095490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16104140..16104159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16125113..16125132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16143930..16144317
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   assembly_gap    16146444..16146574
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    16148704..16148775
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    16149658..16150077
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    16200124..16200196
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    16209975..16210756
FT                   /estimated_length=782
FT                   /gap_type="unknown"
FT   assembly_gap    16219324..16219514
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   gene            complement(16245135..>16245985)
FT                   /locus_tag="mCG_1030965"
FT                   /note="gene_id=mCG1030965.1"
FT   mRNA            complement(16245135..>16245985)
FT                   /locus_tag="mCG_1030965"
FT                   /product="mCG1030965"
FT                   /note="gene_id=mCG1030965.1 transcript_id=mCT148669.1
FT                   created on 16-AUG-2002"
FT   CDS             complement(16245687..>16245875)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030965"
FT                   /product="mCG1030965"
FT                   /note="gene_id=mCG1030965.1 transcript_id=mCT148669.1
FT                   protein_id=mCP69956.1"
FT                   /protein_id="EDL14017.1"
FT                   /translation="GPYIRESYQFVREMLSGGCKQTLIKMILSPFLWRSVQPLSLIVYN
FT                   HQQNSEIFNCCLLSVRW"
FT   assembly_gap    16247298..16247358
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   gene            16247377..16249714
FT                   /pseudo
FT                   /locus_tag="mCG_117314"
FT                   /note="gene_id=mCG117314.1"
FT   mRNA            16247377..16249714
FT                   /pseudo
FT                   /locus_tag="mCG_117314"
FT                   /note="gene_id=mCG117314.1 transcript_id=mCT118451.1
FT                   created on 09-AUG-2002"
FT   gene            complement(16250761..16465078)
FT                   /locus_tag="mCG_1030964"
FT                   /note="gene_id=mCG1030964.1"
FT   mRNA            complement(join(16250761..16252627,16258060..16258182,
FT                   16264460..16264543,16268286..16268365,16275846..16276053,
FT                   16297596..16297742,16324623..16324676,16334426..16335535,
FT                   16346136..16346282,16348129..16348200,16426417..16426462,
FT                   16464946..16465078))
FT                   /locus_tag="mCG_1030964"
FT                   /product="mCG1030964"
FT                   /note="gene_id=mCG1030964.1 transcript_id=mCT148668.1
FT                   created on 16-AUG-2002"
FT   CDS             complement(join(16252502..16252627,16258060..16258182,
FT                   16264460..16264543,16268286..16268365,16275846..16276053,
FT                   16297596..16297742,16324623..16324676,16334426..16335535,
FT                   16346136..16346282,16348129..16348200,16426417..16426462,
FT                   16464946..16465061))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030964"
FT                   /product="mCG1030964"
FT                   /note="gene_id=mCG1030964.1 transcript_id=mCT148668.1
FT                   protein_id=mCP69945.1"
FT                   /protein_id="EDL14016.1"
FT                   /translation="MAAFLVKETISALLKLQINLQKFKCNKLSTTIKFHKYLRFTNTNE
FT                   YQLLNETHHMCLVFSHLHLYISYQWRSPAVLYNMNLRSVFTVEQQRILQRYYENGMTNQ
FT                   SKNCFQLILQCAQETKLDFSVVRTWVGNKRRKMSSKSCESGAAGTVSGTSLAAPDITVR
FT                   NVVNIARPSSQQSSWTSANNDVIVTGIYSPVSSSSKQGTTKHTNTQITEAHKIPIQKAA
FT                   NKNDTELQLHIPVQRQVAHCKNASVLLGEKTIILSRQTSVLNAGNSVYNHTKKSYGSSP
FT                   VQASEMTVPQKPSVCQRPCKIEPVGIQRSYKPEHAGLASHNLCGQKPTIRDPCCRTQNL
FT                   EIREVFSLAVSDYPQRILGGNSTQKPASAEGTCLSIAMETGDAEDEYAREEELASMGAQ
FT                   ITSYSRFYESGNSLRAENQSTNLPGPGRNLPNSQMVNIRDLSDNVLYQTRDYHLTPRTS
FT                   LHTASSTMYSNTNPSRSNFSPHFVSSNQLRLSQNQNNYQISGNLSVPWITGCSRKRALQ
FT                   DRTQFSDRDLATLKKYWDNGMTSLGSVCREKIEAVAIELNVDCEIVRTWIGNRRRKYRL
FT                   MGIEVPPPRGGPADFSEQPESGSLSALTPGEEAGPEVGEDNDRNDEVSICLSEASSQEE
FT                   SNELIPNETRAHKDEEHQAVSADNVKIEIIDDEESDMISNSEVEQENSLLDYKNEEVRF
FT                   IENELEIQKQKYFKLQSFVRNLILAMKADDKDQQQALLSDLPPELEEMDCSHASPDPDD
FT                   TSLSVSSLSEKNASDSL"
FT   assembly_gap    16255058..16255201
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    16264732..16264751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16266850..16266916
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    16285717..16285736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16292402..16292705
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    16295976..16295995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16300811..16300830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16314775..16315969
FT                   /estimated_length=1195
FT                   /gap_type="unknown"
FT   assembly_gap    16325608..16325627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16359954..16359973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16362245..16362264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16364522..16364861
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    16366071..16366090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16370685..16372207
FT                   /estimated_length=1523
FT                   /gap_type="unknown"
FT   assembly_gap    16374289..16374570
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    16393960..16398248
FT                   /estimated_length=4289
FT                   /gap_type="unknown"
FT   assembly_gap    16411352..16411671
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    16418259..16418350
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    16422856..16423351
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   assembly_gap    16425983..16426122
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    16434516..16434535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16448074..16448093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16449288..16449307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16451261..16451734
FT                   /estimated_length=474
FT                   /gap_type="unknown"
FT   assembly_gap    16458097..16458116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16460493..16460512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16462863..16463547
FT                   /estimated_length=685
FT                   /gap_type="unknown"
FT   assembly_gap    16465271..16495307
FT                   /estimated_length=30037
FT                   /gap_type="unknown"
FT   assembly_gap    16496716..16497035
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    16500223..16500242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16512159..16513043
FT                   /estimated_length=885
FT                   /gap_type="unknown"
FT   assembly_gap    16513877..16514525
FT                   /estimated_length=649
FT                   /gap_type="unknown"
FT   assembly_gap    16516678..16516783
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    16524842..16524861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16539767..16540791
FT                   /estimated_length=1025
FT                   /gap_type="unknown"
FT   assembly_gap    16542196..16542215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16547953..16548172
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    16552251..16552270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16555872..16555891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16560395..16560414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16564042..16565581
FT                   /estimated_length=1540
FT                   /gap_type="unknown"
FT   gene            complement(16572065..16574530)
FT                   /pseudo
FT                   /locus_tag="mCG_1031015"
FT                   /note="gene_id=mCG1031015.1"
FT   mRNA            complement(16572065..16574530)
FT                   /pseudo
FT                   /locus_tag="mCG_1031015"
FT                   /note="gene_id=mCG1031015.1 transcript_id=mCT148719.1
FT                   created on 15-AUG-2002"
FT   assembly_gap    16573915..16573934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16580111..16580130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16584365..16584645
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    16595371..16595390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16598952..16598971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16600008..16600210
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    16607802..16608300
FT                   /estimated_length=499
FT                   /gap_type="unknown"
FT   assembly_gap    16612259..16612278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16663007..16663063
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    16666854..16667009
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    16671096..16671115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16672114..16672657
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    16677754..16677773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16682410..16683143
FT                   /pseudo
FT                   /locus_tag="mCG_1030942"
FT                   /note="gene_id=mCG1030942.1"
FT   mRNA            16682410..16683143
FT                   /pseudo
FT                   /locus_tag="mCG_1030942"
FT                   /note="gene_id=mCG1030942.1 transcript_id=mCT148646.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    16686022..16686540
FT                   /estimated_length=519
FT                   /gap_type="unknown"
FT   assembly_gap    16692271..16692290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16706461..16706480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16716106..16716746
FT                   /estimated_length=641
FT                   /gap_type="unknown"
FT   gene            16758645..16792170
FT                   /gene="Tex16"
FT                   /locus_tag="mCG_58530"
FT                   /note="gene_id=mCG58530.1"
FT   mRNA            join(16758645..16759500,16763249..16763338,
FT                   16783882..16786322,16791581..16792170)
FT                   /gene="Tex16"
FT                   /locus_tag="mCG_58530"
FT                   /product="testis expressed gene 16"
FT                   /note="gene_id=mCG58530.1 transcript_id=mCT58713.1 created
FT                   on 07-AUG-2002"
FT   CDS             join(16758675..16759500,16763249..16763338,
FT                   16783882..16786322,16791581..16791622)
FT                   /codon_start=1
FT                   /gene="Tex16"
FT                   /locus_tag="mCG_58530"
FT                   /product="testis expressed gene 16"
FT                   /note="gene_id=mCG58530.1 transcript_id=mCT58713.1
FT                   protein_id=mCP38735.2"
FT                   /protein_id="EDL14015.1"
FT                   /translation="MESESLWMISDSESYSVDSHTEKGRASVSKINLIQIDETEKPRTK
FT                   RYLMESDSEPSNTDSDSEGCELASAAVKYFIATKTFQQSSASSQFPKDSWSASRTINSD
FT                   SESPVMSSDSMKYMKKAETCKSTCNLERLKAAHKSESLQDWLDAKRKQLDSDNAGYWDS
FT                   SGKYQFSSIVPQESVGKRQGDLQTFQHSTEKKEVGSSSDKHQAQFGNERDQSDPKSKRY
FT                   LIKTETGLDNEGFQMDEEREGCLVESDFRDSEREAHLLEAHRLGARKKENRPPGFWRPI
FT                   ILPPKLAQDKKTEEQKSVQQKDNRVSRIQLTRYKSEDKNVRFEEASSSLSDKPLSQEKL
FT                   KKKHSYSFSPDSPTFTDEKHHRKASLKISGYKRQCKEYRYPHSCESLKYQISPIPLSSE
FT                   TCTSNVSSFVDSPTSKSPKSVTRKKSRRSITYSPEQGSQKCTRCFMEISNSSYHKCLIN
FT                   SDDSDSDSPLHGQISSHSKYSLRSKTIRHFKTSRNRPLSQSLDPQHSVVSRCSLHREDS
FT                   KHSIDSTSYLHCESCASLQNLKGSSVTHTISKTTKKIMGQHSTHGHISGPVRLSQSESK
FT                   FNLTAQPQNEDTPDVSDRNIKAEANVEDKLLYKDDTDHEDETNTEDETDGEDETDTEDE
FT                   DEDDTKDKKDPKDKSDPDGSDPKDGNSENNTDSNNGSQPSGSSGPTGGPDSSNDGDSKN
FT                   VTDHKSESDPTIDNATNSDVNLKYSTDETCTNNLDNASDLAEYFNHHNNADFKGRTNPA
FT                   SGNKTRTILDYISGSNNEDTGPRNTMIKEKIAYSENIRLLSNSYQNNVIKNGSEPSSNP
FT                   SPQNSYGLPKDLDSNSNINPSNATNNTVNPNYGAKSTSTAIYKKTAALNYYSDINDVTG
FT                   FTYEVRSSFVVNSNYFDRKKYAGRLSFALHTINAIDTNNVITCTSAVRSKFASEKTSVL
FT                   DTKHSPRFSRFRSFNVIISPNYNTKNSQNANKSSISNIYNLPATELEINILSVLKIIYG
FT                   NTPNFIAGTNYPDFLITSEFYEPLKLCRAYKIFDNQNIDAPFQDSAGYMDSHNSTYATG
FT                   SMVALDAKESGFLKYFPRIQNTIGIKDPSCPFKVFSNQNILVPSFDVIVEAELPDIMKF
FT                   TISSGAVNQLFQLRLQTGSRQNVDL"
FT   assembly_gap    16789158..16789177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16804857..16804876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16806984..16807732
FT                   /estimated_length=749
FT                   /gap_type="unknown"
FT   gene            16817845..16819214
FT                   /pseudo
FT                   /locus_tag="mCG_117312"
FT                   /note="gene_id=mCG117312.1"
FT   mRNA            16817845..16819214
FT                   /pseudo
FT                   /locus_tag="mCG_117312"
FT                   /note="gene_id=mCG117312.1 transcript_id=mCT118449.1
FT                   created on 09-AUG-2002"
FT   assembly_gap    16819404..16819423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16819646..16819665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16845013..16845032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16860387..16860406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16871369..16871388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16878003..16882803
FT                   /locus_tag="mCG_62900"
FT                   /note="gene_id=mCG62900.1"
FT   mRNA            join(16878003..16878025,16879448..16880408,
FT                   16882267..16882803)
FT                   /locus_tag="mCG_62900"
FT                   /product="mCG62900"
FT                   /note="gene_id=mCG62900.1 transcript_id=mCT63083.1 created
FT                   on 09-AUG-2002"
FT   CDS             join(16879631..16880408,16882267..16882628)
FT                   /codon_start=1
FT                   /locus_tag="mCG_62900"
FT                   /product="mCG62900"
FT                   /note="gene_id=mCG62900.1 transcript_id=mCT63083.1
FT                   protein_id=mCP31627.2"
FT                   /db_xref="GOA:F6UK53"
FT                   /db_xref="MGI:MGI:1918280"
FT                   /db_xref="UniProtKB/TrEMBL:F6UK53"
FT                   /protein_id="EDL14014.1"
FT                   /translation="MNQVVIATTPPLTKELESTALVKPKTSGLLRIEKIPIKYLWVPEF
FT                   QRLEVTGIASPEERGKGTAILVAGVPGKEELDDTEIPTLHFTGFVHLEALINKCSPSSE
FT                   YSRPGTPGNLWMESPENAESPGSDDMEVARSMYPFRERSIFRRSWAELLEAPLNSEGLH
FT                   IIQTEHIHNEENRDMGCNKLTLQEENQVIPLPKDQHFQALQGPFPLLPERPKLQRQRSR
FT                   SLPRNSEVGGQYLNTPEFKGSAEETPFFPRDHNLLTEENIKERHSMEGAWQRVIPSHSG
FT                   EHFPIMPRFDNSSIQGNFGIPEDNSARPRGNMRIQSNVNTIPMVNVGIPIDNPQVLKGN
FT                   TGVPRGSGFGVYMGNSGRPSGHVVSSPLIELSKIGEHQL"
FT   assembly_gap    16890458..16890477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16904172..16907845
FT                   /estimated_length=3674
FT                   /gap_type="unknown"
FT   assembly_gap    16915090..16915109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16916738..16916869
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    16917462..16919054
FT                   /estimated_length=1593
FT                   /gap_type="unknown"
FT   assembly_gap    16922692..16922711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16929390..16930422
FT                   /estimated_length=1033
FT                   /gap_type="unknown"
FT   assembly_gap    16946215..16946234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16948840..17010411
FT                   /gene="9430083G14Rik"
FT                   /locus_tag="mCG_49654"
FT                   /note="gene_id=mCG49654.2"
FT   mRNA            join(16948840..16948929,16971206..16971310,
FT                   16983650..16983769,16987214..16987268,16988713..16988811,
FT                   16991574..16991665,17001852..17001960,17009856..17010411)
FT                   /gene="9430083G14Rik"
FT                   /locus_tag="mCG_49654"
FT                   /product="RIKEN cDNA 9430083G14, transcript variant
FT                   mCT171578"
FT                   /note="gene_id=mCG49654.2 transcript_id=mCT171578.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(16948854..16948929,16971206..16971310,
FT                   16983650..16983769,16987214..16987268,16988713..16988811,
FT                   16991574..16991665,17001547..17001660,17001852..17001960,
FT                   17009856..17010411)
FT                   /gene="9430083G14Rik"
FT                   /locus_tag="mCG_49654"
FT                   /product="RIKEN cDNA 9430083G14, transcript variant
FT                   mCT49837"
FT                   /note="gene_id=mCG49654.2 transcript_id=mCT49837.2 created
FT                   on 13-FEB-2003"
FT   mRNA            join(16948859..16948929,16983650..16983769,
FT                   16987214..16987268,16988713..16988811,16991574..16991665,
FT                   17001852..>17001919)
FT                   /gene="9430083G14Rik"
FT                   /locus_tag="mCG_49654"
FT                   /product="RIKEN cDNA 9430083G14, transcript variant
FT                   mCT180225"
FT                   /note="gene_id=mCG49654.2 transcript_id=mCT180225.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(16948888..16948912,16971206..16971310,
FT                   16983650..16983769,16987214..16987268,16988713..16988811,
FT                   16991574..16991665,17001547..>17001649)
FT                   /gene="9430083G14Rik"
FT                   /locus_tag="mCG_49654"
FT                   /product="RIKEN cDNA 9430083G14, transcript variant
FT                   mCT180226"
FT                   /note="gene_id=mCG49654.2 transcript_id=mCT180226.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(16948915..16948929,16971206..16971310,
FT                   16983650..16983769,16987214..16987268,16988713..16988811,
FT                   16991574..16991665,17001547..17001660,17001852..17001960,
FT                   17009856..17009944)
FT                   /codon_start=1
FT                   /gene="9430083G14Rik"
FT                   /locus_tag="mCG_49654"
FT                   /product="RIKEN cDNA 9430083G14, isoform CRA_c"
FT                   /note="gene_id=mCG49654.2 transcript_id=mCT49837.2
FT                   protein_id=mCP30027.2 isoform=CRA_c"
FT                   /protein_id="EDL14012.1"
FT                   /translation="MAAFRMGKLTTIPAGLIYASINVRLAKEEEPKKQLVRPDQLPIYT
FT                   APPLHSKYVEEQPGNLQRGFASIRTTTVYYIGWCKSIYLFMKNGVMDTVQFGKDAYVYL
FT                   KNPPQDFLPKMGVITASGLAGLLSARKGSRFKKIAYPLGLATLGATVCYPAQSVIIAKI
FT                   TGKKAYATSQQIFQAIKSLWTQKSENESLPEPKEESKEGRSDEIHASLPDLKHSVSLPK
FT                   ELASATVIKSESTSGTTQFIPDPKLMDHGQSHPDDKDMYSTRS"
FT   CDS             join(16948915..16948929,16971206..16971310,
FT                   16983650..16983769,16987214..16987268,16988713..16988811,
FT                   16991574..16991665,17001852..17001960,17009856..17009944)
FT                   /codon_start=1
FT                   /gene="9430083G14Rik"
FT                   /locus_tag="mCG_49654"
FT                   /product="RIKEN cDNA 9430083G14, isoform CRA_a"
FT                   /note="gene_id=mCG49654.2 transcript_id=mCT171578.0
FT                   protein_id=mCP94497.0 isoform=CRA_a"
FT                   /protein_id="EDL14010.1"
FT                   /translation="MAAFRMGKLTTIPAGLIYASINVRLAKEEEPKKQLVRPDQLPIYT
FT                   APPLHSKYVEEQPGNLQRGFASIRTTTVYYIGWCKSIYLFMKNGVMDTVQFGKDAYVYL
FT                   KNPPQDFLPKMGVITASGLAGLLSARKGSRFKKIAYPLGLATLGATVCYPAQSVIIAKE
FT                   GRSDEIHASLPDLKHSVSLPKELASATVIKSESTSGTTQFIPDPKLMDHGQSHPDDKDM
FT                   YSTRS"
FT   CDS             join(16948915..16948929,16983650..16983769,
FT                   16987214..16987268,16988713..16988811,16991574..16991665,
FT                   17001852..>17001919)
FT                   /codon_start=1
FT                   /gene="9430083G14Rik"
FT                   /locus_tag="mCG_49654"
FT                   /product="RIKEN cDNA 9430083G14, isoform CRA_b"
FT                   /note="gene_id=mCG49654.2 transcript_id=mCT180225.0
FT                   protein_id=mCP103147.0 isoform=CRA_b"
FT                   /protein_id="EDL14011.1"
FT                   /translation="MAAFRLPIYTAPPLHSKYVEEQPGNLQRGFASIRTTTVYYIGWCK
FT                   SIYLFMKNGVMDTVQFGKDAYVYLKNPPQDFLPKMGVITASGLAGLLSARKGSRFKKIA
FT                   YPLGLATLGATVCYPAQSVIIAKEGRSDEIHASLPDLKHSVSLPK"
FT   assembly_gap    16969232..16969343
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   CDS             join(16971206..16971310,16983650..16983769,
FT                   16987214..16987268,16988713..16988811,16991574..16991665,
FT                   17001547..>17001649)
FT                   /codon_start=1
FT                   /gene="9430083G14Rik"
FT                   /locus_tag="mCG_49654"
FT                   /product="RIKEN cDNA 9430083G14, isoform CRA_d"
FT                   /note="gene_id=mCG49654.2 transcript_id=mCT180226.0
FT                   protein_id=mCP103148.0 isoform=CRA_d"
FT                   /protein_id="EDL14013.1"
FT                   /translation="MGKLTTIPAGLIYASINVRLAKEEEPKKQLVRPDQLPIYTAPPLH
FT                   SKYVEEQPGNLQRGFASIRTTTVYYIGWCKSIYLFMKNGVMDTVQFGKDAYVYLKNPPQ
FT                   DFLPKMGVITASGLAGLLSARKGSRFKKIAYPLGLATLGATVCYPAQSVIIAKITGKKA
FT                   YATSQQIFQAIKSLWTQKSENESLPEPK"
FT   assembly_gap    16973106..16973372
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    17000151..17000210
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    17006288..17006400
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    17008552..17008571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17010592..17011631
FT                   /estimated_length=1040
FT                   /gap_type="unknown"
FT   assembly_gap    17014262..17014281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17016978..17018312
FT                   /estimated_length=1335
FT                   /gap_type="unknown"
FT   gene            complement(17019557..17042065)
FT                   /locus_tag="mCG_65576"
FT                   /note="gene_id=mCG65576.2"
FT   mRNA            complement(join(17019557..17019881,17020624..17020664,
FT                   17024838..17024939,17025336..17025416,17034611..17034662,
FT                   17040278..17041152))
FT                   /locus_tag="mCG_65576"
FT                   /product="mCG65576, transcript variant mCT180349"
FT                   /note="gene_id=mCG65576.2 transcript_id=mCT180349.0 created
FT                   on 15-FEB-2003"
FT   mRNA            complement(join(17019558..17019881,17020624..17020664,
FT                   17024838..17024939,17025336..17025416,17034581..17034662,
FT                   17040278..17042065))
FT                   /locus_tag="mCG_65576"
FT                   /product="mCG65576, transcript variant mCT65759"
FT                   /note="gene_id=mCG65576.2 transcript_id=mCT65759.1 created
FT                   on 15-FEB-2003"
FT   CDS             complement(join(17019711..17019881,17020624..17020664,
FT                   17024838..17024939,17025336..17025416,17034611..17034662,
FT                   17040278..17041111))
FT                   /codon_start=1
FT                   /locus_tag="mCG_65576"
FT                   /product="mCG65576, isoform CRA_a"
FT                   /note="gene_id=mCG65576.2 transcript_id=mCT180349.0
FT                   protein_id=mCP103271.0 isoform=CRA_a"
FT                   /protein_id="EDL14008.1"
FT                   /translation="MCQSSGSQSSMKEFHMLQSGSNQPDMNDVDVWQSGTSQPGMHQMD
FT                   PWQWGHNYSGNTQSGQWTPGPNALVVGQFDSWQPVQPGMKYSESGPWSPRHLDMRQPSP
FT                   SQLATRQFDKWQQNPSMPGVRQLYTWQPTSSFSDTRQLEKFHPCPINLNMEQFWEAVSR
FT                   QPGTTQLGTNQLDTNQPDGTQSSQGGKTQSDKLEPSPRKPEMKGSQPDTSQSDSDHLDI
FT                   SQPGPSQLEPGESSMSDLNESQQRITQSPMGKKDSCSFFIRPAEPEDCPDILRLIKELA
FT                   SYEGMEEKVSLTERDLFRDGFGDNPLFYCLVAEAPSEQTESGVKTIGFAMYYFTYDPRI
FT                   GKLLHLEDFYITEDYQGIGIGADMLKKLSQIAINTECCGMQFLVIIWNQDSVEYYTRLG
FT                   ALDLSCEEGWHLFRFNLDDLLELAEEE"
FT   CDS             complement(join(17019711..17019881,17020624..17020664,
FT                   17024838..17024939,17025336..17025416,17034581..17034662,
FT                   17040278..17041081))
FT                   /codon_start=1
FT                   /locus_tag="mCG_65576"
FT                   /product="mCG65576, isoform CRA_b"
FT                   /note="gene_id=mCG65576.2 transcript_id=mCT65759.1
FT                   protein_id=mCP38965.2 isoform=CRA_b"
FT                   /protein_id="EDL14009.1"
FT                   /translation="MKEFHMLQSGSNQPDMNDVDVWQSGTSQPGMHQMDPWQWGHNYSG
FT                   NTQSGQWTPGPNALVVGQFDSWQPVQPGMKYSESGPWSPRHLDMRQPSPSQLATRQFDK
FT                   WQQNPSMPGVRQLYTWQPTSSFSDTRQLEKFHPCPINLNMEQFWEAVSRQPGTTQLGTN
FT                   QLDTNQPDGTQSSQGGKTQSDKLEPSPRKPEMKGSQPDTSQSDSDHLDISQPGPSQLEP
FT                   GESSMSDLNESQQRITQSPMGKKDSCSFFIRPAEPEDCPDILRLIKELASYEGMEEKVS
FT                   LTERGKMFCGNLPADLFRDGFGDNPLFYCLVAEAPSEQTESGVKTIGFAMYYFTYDPRI
FT                   GKLLHLEDFYITEDYQGIGIGADMLKKLSQIAINTECCGMQFLVIIWNQDSVEYYTRLG
FT                   ALDLSCEEGWHLFRFNLDDLLELAEEE"
FT   assembly_gap    17021312..17021331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17024418..17024437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17030703..17030819
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    17032395..17032771
FT                   /estimated_length=377
FT                   /gap_type="unknown"
FT   assembly_gap    17039907..17039952
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    17043109..17044484
FT                   /estimated_length=1376
FT                   /gap_type="unknown"
FT   assembly_gap    17051673..17051692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17058869..17090534
FT                   /estimated_length=31666
FT                   /gap_type="unknown"
FT   gene            complement(17090535..>17091658)
FT                   /locus_tag="mCG_1031012"
FT                   /note="gene_id=mCG1031012.1"
FT   mRNA            complement(join(17090535..17090893,17091247..>17091658))
FT                   /locus_tag="mCG_1031012"
FT                   /product="mCG1031012"
FT                   /note="gene_id=mCG1031012.1 transcript_id=mCT148716.1
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(17090818..17090893,17091247..>17091656))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031012"
FT                   /product="mCG1031012"
FT                   /note="gene_id=mCG1031012.1 transcript_id=mCT148716.1
FT                   protein_id=mCP69737.1"
FT                   /protein_id="EDL14007.1"
FT                   /translation="CVEFSYQEILLCGEQRKKLVHTEDPFTDEHKEKQEVEMLVKKCEM
FT                   KYGGKTRKYRTDQLQDLIDTAFGYDETHPFIDNSEVYDKLVPASLTTNYGGFYIDSGIL
FT                   QFLQASDTEEDDFIVNQKHKPPKVPKIKEDDIEVLIPTSLVLLAQMNTNCFRKLKMP"
FT   gene            17094186..17095232
FT                   /pseudo
FT                   /locus_tag="mCG_120416"
FT                   /note="gene_id=mCG120416.1"
FT   mRNA            join(17094186..17094375,17094398..17095232)
FT                   /pseudo
FT                   /locus_tag="mCG_120416"
FT                   /note="gene_id=mCG120416.1 transcript_id=mCT121605.1
FT                   created on 09-AUG-2002"
FT   assembly_gap    17094377..17094396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17096876..17097484
FT                   /estimated_length=609
FT                   /gap_type="unknown"
FT   assembly_gap    17099604..17099623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17108672..17111582
FT                   /estimated_length=2911
FT                   /gap_type="unknown"
FT   assembly_gap    17116455..17116474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            17120104..17182670
FT                   /gene="2010106E10Rik"
FT                   /locus_tag="mCG_8605"
FT                   /note="gene_id=mCG8605.2"
FT   mRNA            join(17120104..17120250,17122699..17122804,
FT                   17136380..17136571,17139177..17139300,17180576..17180658,
FT                   17181295..17181433,17182173..17182670)
FT                   /gene="2010106E10Rik"
FT                   /locus_tag="mCG_8605"
FT                   /product="RIKEN cDNA 2010106E10, transcript variant
FT                   mCT7373"
FT                   /note="gene_id=mCG8605.2 transcript_id=mCT7373.2 created on
FT                   15-FEB-2003"
FT   mRNA            join(17120104..17120250,17122699..17122804,
FT                   17136380..17136571,17139177..17139270,17180576..17180658,
FT                   17181295..17181433,17182173..17182669)
FT                   /gene="2010106E10Rik"
FT                   /locus_tag="mCG_8605"
FT                   /product="RIKEN cDNA 2010106E10, transcript variant
FT                   mCT180357"
FT                   /note="gene_id=mCG8605.2 transcript_id=mCT180357.0 created
FT                   on 15-FEB-2003"
FT   CDS             join(17120178..17120250,17122699..17122804,
FT                   17136380..17136571,17139177..17139300,17180576..17180658,
FT                   17181295..17181433,17182173..17182295)
FT                   /codon_start=1
FT                   /gene="2010106E10Rik"
FT                   /locus_tag="mCG_8605"
FT                   /product="RIKEN cDNA 2010106E10, isoform CRA_b"
FT                   /note="gene_id=mCG8605.2 transcript_id=mCT7373.2
FT                   protein_id=mCP9799.2 isoform=CRA_b"
FT                   /db_xref="GOA:A2ANY3"
FT                   /db_xref="InterPro:IPR002154"
FT                   /db_xref="MGI:MGI:1914965"
FT                   /db_xref="UniProtKB/TrEMBL:A2ANY3"
FT                   /protein_id="EDL14006.1"
FT                   /translation="MADCTFMLTQMLFISWFLMAHCSQPNCTSVKDFNNCLGNTTGFCP
FT                   ESIVCACKDGKPFCKCPNFRGQWGDYWYMGEKCDQLWNTLDLVLVATLPGIALAIIVGV
FT                   AIQIIHYCKGKSKKNGNHHRVEKSMSELRPQHNSAYGLGTDRNLPQPNQREVNTETHLS
FT                   NKNPWSLSNPEAFSRTSFSPSSQLSRTNSNFIAQEHKEDHPYNYPYLKWNASPGPSNPA
FT                   VNYGNSHLSATYAKPNFDFSTSGVPRAAYPPKEKKYSVYEESEITYKIGRANMIPNY"
FT   CDS             join(17120178..17120250,17122699..17122804,
FT                   17136380..17136571,17139177..17139270,17180576..17180658,
FT                   17181295..17181433,17182173..17182295)
FT                   /codon_start=1
FT                   /gene="2010106E10Rik"
FT                   /locus_tag="mCG_8605"
FT                   /product="RIKEN cDNA 2010106E10, isoform CRA_a"
FT                   /note="gene_id=mCG8605.2 transcript_id=mCT180357.0
FT                   protein_id=mCP103279.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D3Q9"
FT                   /db_xref="MGI:MGI:1914965"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D3Q9"
FT                   /protein_id="EDL14005.1"
FT                   /translation="MADCTFMLTQMLFISWFLMAHCSQPNCTSVKDFNNCLGNTTGFCP
FT                   ESIVCACKDGKPFCKCPNFRGQWGDYWYMGEKCDQLWNTLDLVLVATLPGIALAIIVGV
FT                   AIQIIHYCKGKSKKNGNHHRVEKSMSELRPQHNSAYGLGTDRNLPQPNQRENPWSLSNP
FT                   EAFSRTSFSPSSQLSRTNSNFIAQEHKEDHPYNYPYLKWNASPGPSNPAVNYGNSHLSA
FT                   TYAKPNFDFSTSGVPRAAYPPKEKKYSVYEESEITYKIGRANMIPNY"
FT   assembly_gap    17127101..17127120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17128163..17128182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17129077..17129096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17132813..17132903
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    17134300..17134372
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    17143622..17144158
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    17154971..17154990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17158461..17158480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17159708..17159727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17167662..17167873
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    17168676..17170001
FT                   /estimated_length=1326
FT                   /gap_type="unknown"
FT   assembly_gap    17177227..17177246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17178846..17179172
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    17198488..17198615
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    17205089..17206102
FT                   /estimated_length=1014
FT                   /gap_type="unknown"
FT   assembly_gap    17209920..17209939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17214754..17214773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17217900..17219335
FT                   /estimated_length=1436
FT                   /gap_type="unknown"
FT   gene            17221691..17251007
FT                   /locus_tag="mCG_8606"
FT                   /note="gene_id=mCG8606.2"
FT   mRNA            join(17221691..17221799,17232328..17232870,
FT                   17241387..17241542,17242174..17242311,17244597..17244731,
FT                   17249248..17249391,17249801..17251007)
FT                   /locus_tag="mCG_8606"
FT                   /product="mCG8606"
FT                   /note="gene_id=mCG8606.2 transcript_id=mCT7374.2 created on
FT                   09-AUG-2002"
FT   CDS             join(17221721..17221799,17232328..17232870,
FT                   17241387..17241542,17242174..17242311,17244597..17244731,
FT                   17249248..17249391,17249801..17250978)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8606"
FT                   /product="mCG8606"
FT                   /note="gene_id=mCG8606.2 transcript_id=mCT7374.2
FT                   protein_id=mCP9800.2"
FT                   /protein_id="EDL14004.1"
FT                   /translation="MESGGGSLGLHTSDARMAHTMIMQDFVAGMAGTAHIDGDHIVVSV
FT                   PEAVLVSDVVTDDGITLDHGLAAEVVHGPDIITETDVVTEGVIVPEAVLEADVAIEEDL
FT                   EEDDGDHILTSELITETVRVPEQVFVADLVSGPDGHLEHVVQDCVSGVDSPTMVSEEVL
FT                   VTNSDTETVIQAGGGVPGSTVTIKTEEDDDDDVKSTSEDYLMISLDDVGEKLEHMGNTP
FT                   LKIASDGSQEDVKEDAFGSEVIKVYIFKAEAEDDVEIGGTEIVTESEYSSGHSVAGVLD
FT                   QSRMQREKMVYMAVKDSSQEQDDISNADISNELCMEVIIGEEEGTPLEIPLQDCDVNKT
FT                   GSPVLSPASYGNTFDSALENRNTTAAQYLQICDSMNTNKVLKQKIKKRRRGETRQWQTA
FT                   VIIGPDGQPLTVYPCHICTKKFKSRGFLKRHMKNHPDHLMRKKYQCTDCDFTTNKKVSF
FT                   HNHLESHKLINKVDKTHEFTEYTRRYREASPLSSNKLILRDKEPKMHKCKYCDYETAEQ
FT                   GLLNRHLLAVHSKSFPHVCVECGKGFRHLSELKKHMRTHTGEKPYQCQYCAFRCADQSN
FT                   LKTHIKSKHGSNLPYKCEHCPQAFGDERELQRHLDLFQGHKTHQCPHCDHKSTNSSDLK
FT                   RHIISVHTKDFPHKCEVCDKGFHRPSELKKHSDIHKGRKIHQCRHCDFKTSDPFILSGH
FT                   ILSVHTKDQSLKCKRCKRGFRQQNELKKHMKTHTGRKIYQCEYCEYSTTDASGFKRHVI
FT                   SIHTKDYPHRCEFCKKGFRRPSEKKQHIMRHHKETLM"
FT   gene            complement(17255849..17315508)
FT                   /gene="Pof1b"
FT                   /locus_tag="mCG_145724"
FT                   /note="gene_id=mCG145724.0"
FT   mRNA            complement(join(17255849..17257863,17259979..17260093,
FT                   17261335..17261417,17262249..17262377,17263716..17263835,
FT                   17264123..17264275,17265442..17265555,17266400..17266492,
FT                   17273467..17273541,17274830..17274857,17279129..17279259,
FT                   17281538..17281711,17286423..17286524,17294780..17294860,
FT                   17300751..17300825,17315025..17315362,17315443..17315508))
FT                   /gene="Pof1b"
FT                   /locus_tag="mCG_145724"
FT                   /product="premature ovarian failure 1B"
FT                   /note="gene_id=mCG145724.0 transcript_id=mCT185342.0
FT                   created on 13-JUN-2003"
FT   CDS             complement(join(17257858..17257863,17259979..17260093,
FT                   17261335..17261417,17262249..17262377,17263716..17263835,
FT                   17264123..17264275,17265442..17265555,17266400..17266492,
FT                   17273467..17273541,17274830..17274857,17279129..17279259,
FT                   17281538..17281711,17286423..17286524,17294780..17294860,
FT                   17300751..17300825,17315025..17315309))
FT                   /codon_start=1
FT                   /gene="Pof1b"
FT                   /locus_tag="mCG_145724"
FT                   /product="premature ovarian failure 1B"
FT                   /note="gene_id=mCG145724.0 transcript_id=mCT185342.0
FT                   protein_id=mCP106600.0"
FT                   /db_xref="GOA:Q8K4L4"
FT                   /db_xref="InterPro:IPR026186"
FT                   /db_xref="MGI:MGI:1916943"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K4L4"
FT                   /protein_id="EDL14003.1"
FT                   /translation="MMSSSYWSETSSSSCGTQQPTEVLQCQPQHYHYYHQPSQAQQPPE
FT                   KNVVYERVRTYSGPMNKVVQALDPLGSREVLSPLKPASSYQSLVWSDHSQELYSPTLKI
FT                   STCAPSTLHITQNAEQELHSPTVKVTTYPQTTIRRYIVQNPEQEPLSPFLRGSQFFPGN
FT                   NVIYEKTIRKVEKLNTDQECCPQIQCHHHVIQQPQIIHSPHCQQSHSSHQIQCITENDS
FT                   NIGHELCHGGPSQIHEQVIIQDDGPEKLDPKYFGELLADLSRKNTDLYHCLLEHLERIG
FT                   GSKQDFESTDTSEDIESLIPKGLSEFTKQQIRYILQMRGMSDKSLRLVLSTFSNIREEL
FT                   GHLQNDLTSLENDKIRLEKDLAFKENQMKEYEELLASVRANNRQQQQGLQDSSAKCQSL
FT                   EENNLSLRHTLSDLEYRLKELEYCKRNLEQENKNLRIQVSETCTGPTLQAKMDEIGNHY
FT                   MEMVKNLRLDKDREISKLRSQLNQYQKDVSKREGSCSDFQFKLHELTSLLEEKDSLIKR
FT                   QSEELSKLRQEIYSSHNQPSCGGRTTITTKKYRTQYPILGLLYDDYEYIPPGSDTQTIV
FT                   IEKTEDKWTCP"
FT   assembly_gap    17258246..17258426
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    17264318..17264786
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   assembly_gap    17268444..17268463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17277900..17278805)
FT                   /pseudo
FT                   /locus_tag="mCG_3573"
FT                   /note="gene_id=mCG3573.2"
FT   mRNA            complement(17277900..17278805)
FT                   /pseudo
FT                   /locus_tag="mCG_3573"
FT                   /note="gene_id=mCG3573.2 transcript_id=mCT3398.2 created on
FT                   09-AUG-2002"
FT   assembly_gap    17280971..17280990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17287041..17287060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17297572..17297591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17301543..17301562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17302723..17303183
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    17306695..17306850
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    17307509..17307645
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    17319361..17319429
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    17325000..17325593
FT                   /estimated_length=594
FT                   /gap_type="unknown"
FT   assembly_gap    17327312..17327331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17329635..17345440
FT                   /estimated_length=15806
FT                   /gap_type="unknown"
FT   assembly_gap    17349236..17349263
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    17353584..17353603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17363930..17364101
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    17369136..17369215
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    17374075..17374755
FT                   /estimated_length=681
FT                   /gap_type="unknown"
FT   assembly_gap    17378329..17378373
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   gene            complement(17379636..17379910)
FT                   /pseudo
FT                   /locus_tag="mCG_1030963"
FT                   /note="gene_id=mCG1030963.1"
FT   mRNA            complement(17379636..17379910)
FT                   /pseudo
FT                   /locus_tag="mCG_1030963"
FT                   /note="gene_id=mCG1030963.1 transcript_id=mCT148667.1
FT                   created on 16-AUG-2002"
FT   assembly_gap    17385002..17385021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            17396748..17397760
FT                   /pseudo
FT                   /locus_tag="mCG_1030962"
FT                   /note="gene_id=mCG1030962.1"
FT   mRNA            17396748..17397760
FT                   /pseudo
FT                   /locus_tag="mCG_1030962"
FT                   /note="gene_id=mCG1030962.1 transcript_id=mCT148666.1
FT                   created on 16-AUG-2002"
FT   assembly_gap    17402520..17402773
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    17405047..17405583
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    17407592..17408162
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   assembly_gap    17417481..17417576
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    17423986..17424061
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    17426039..17426058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17427119..17427768)
FT                   /pseudo
FT                   /locus_tag="mCG_49025"
FT                   /note="gene_id=mCG49025.1"
FT   mRNA            complement(17427119..17427768)
FT                   /pseudo
FT                   /locus_tag="mCG_49025"
FT                   /note="gene_id=mCG49025.1 transcript_id=mCT49208.1 created
FT                   on 19-AUG-2002"
FT   assembly_gap    17429122..17429141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17437101..17437424
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    17438162..17438732
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   assembly_gap    17443365..17443411
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    17444918..17444937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17453961..17454368
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    17457400..17457419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17472012..17472262
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    17475147..17475455
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    17482126..17482145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17495008..17495027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17502346..17502469
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    17512224..17512243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17534081..17534100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17549250..17549371
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    17553839..17555570
FT                   /estimated_length=1732
FT                   /gap_type="unknown"
FT   assembly_gap    17559392..17559411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17560948..17560967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            17561002..17561454
FT                   /pseudo
FT                   /locus_tag="mCG_1030939"
FT                   /note="gene_id=mCG1030939.1"
FT   mRNA            17561002..17561454
FT                   /pseudo
FT                   /locus_tag="mCG_1030939"
FT                   /note="gene_id=mCG1030939.1 transcript_id=mCT148643.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    17562460..17562479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17563906..17563925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17566967..17566986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17588550..17589009
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    17590041..17590989
FT                   /estimated_length=949
FT                   /gap_type="unknown"
FT   assembly_gap    17609510..17610518
FT                   /estimated_length=1009
FT                   /gap_type="unknown"
FT   assembly_gap    17611704..17634974
FT                   /estimated_length=23271
FT                   /gap_type="unknown"
FT   gene            complement(17636635..17784411)
FT                   /gene="Chm"
FT                   /locus_tag="mCG_21749"
FT                   /note="gene_id=mCG21749.2"
FT   mRNA            complement(join(17636635..17639703,17643404..17643564,
FT                   17649131..17649229,17660583..17660679,17667239..17667302,
FT                   17669578..17669682,17677790..17677867,17711781..17712006,
FT                   17738609..17738733,17739987..17740059,17758420..17758486,
FT                   17784337..17784411))
FT                   /gene="Chm"
FT                   /locus_tag="mCG_21749"
FT                   /product="choroidermia"
FT                   /note="gene_id=mCG21749.2 transcript_id=mCT20684.2 created
FT                   on 07-AUG-2002"
FT   assembly_gap    17649782..17649825
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    17651236..17651467
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    17656857..17657329
FT                   /estimated_length=473
FT                   /gap_type="unknown"
FT   assembly_gap    17661365..17665113
FT                   /estimated_length=3749
FT                   /gap_type="unknown"
FT   assembly_gap    17679128..17679147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17693953..17693972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17695032..17696686
FT                   /estimated_length=1655
FT                   /gap_type="unknown"
FT   assembly_gap    17706361..17706798
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    17708872..17709610
FT                   /estimated_length=739
FT                   /gap_type="unknown"
FT   CDS             complement(join(17711982..17712006,17738609..17738733,
FT                   17739987..17740059,17758420..17758486,17784337..17784385))
FT                   /codon_start=1
FT                   /gene="Chm"
FT                   /locus_tag="mCG_21749"
FT                   /product="choroidermia"
FT                   /note="gene_id=mCG21749.2 transcript_id=mCT20684.2
FT                   protein_id=mCP14766.2"
FT                   /protein_id="EDL14002.1"
FT                   /translation="MADNLPSDFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGG
FT                   NWASFSFSGLLSWLKEYQENSDVVTENSMWQEQILENEEAILLSSKDKTIQHVEVFCYA
FT                   SIRGNYIF"
FT   assembly_gap    17712007..17720851
FT                   /estimated_length=8845
FT                   /gap_type="unknown"
FT   assembly_gap    17722010..17722029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17723052..17723399
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    17724622..17727380
FT                   /estimated_length=2759
FT                   /gap_type="unknown"
FT   assembly_gap    17728149..17728406
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    17736746..17736765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17743258..17743323
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    17751829..17751848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17757480..17757575
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    17762900..17762919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17773674..17773750
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    17777788..17777851
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    17794266..17794307
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    17796084..17796103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17800486..17800505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17803035..17805432
FT                   /estimated_length=2398
FT                   /gap_type="unknown"
FT   assembly_gap    17817873..17817892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17819159..17820805
FT                   /estimated_length=1647
FT                   /gap_type="unknown"
FT   gene            complement(17822926..17824744)
FT                   /pseudo
FT                   /locus_tag="mCG_50706"
FT                   /note="gene_id=mCG50706.1"
FT   mRNA            complement(join(17822926..17823240,17823647..17824744))
FT                   /pseudo
FT                   /locus_tag="mCG_50706"
FT                   /note="gene_id=mCG50706.1 transcript_id=mCT50889.2 created
FT                   on 19-AUG-2002"
XX
CO   join(complement(AAHY01214360.1:1..1073),gap(798),
CO   complement(AAHY01214361.1:1..2859),gap(243),AAHY01214362.1:1..1905,
CO   gap(255),AAHY01214363.1:1..2587,gap(122),
CO   complement(AAHY01214364.1:1..1574),gap(80),AAHY01214365.1:1..5167,gap(20),
CO   AAHY01214366.1:1..11248,gap(683),AAHY01214367.1:1..1945,gap(39),
CO   complement(AAHY01214368.1:1..3666),gap(39),AAHY01214369.1:1..4297,gap(368),
CO   AAHY01214370.1:1..5515,gap(20),AAHY01214371.1:1..5312,gap(58),
CO   AAHY01214372.1:1..6462,gap(48),AAHY01214373.1:1..2064,gap(20),
CO   complement(AAHY01214374.1:1..1141),gap(61),
CO   complement(AAHY01214375.1:1..1036),gap(20),AAHY01214376.1:1..37372,
CO   gap(285),AAHY01214377.1:1..18019,gap(506),
CO   complement(AAHY01214378.1:1..765),gap(181),AAHY01214379.1:1..1736,gap(30),
CO   AAHY01214380.1:1..4609,gap(108),AAHY01214381.1:1..21193,gap(160),
CO   AAHY01214382.1:1..1221,gap(75),AAHY01214383.1:1..24770,gap(160),
CO   AAHY01214384.1:1..1557,gap(20),complement(AAHY01214385.1:1..16109),gap(20),
CO   AAHY01214386.1:1..11038,gap(172),AAHY01214387.1:1..4445,gap(20),
CO   AAHY01214388.1:1..1055,gap(20),AAHY01214389.1:1..10836,gap(2185),
CO   complement(AAHY01214390.1:1..9360),gap(145),AAHY01214391.1:1..9481,
CO   gap(267),AAHY01214392.1:1..2247,gap(77),AAHY01214393.1:1..2340,gap(960),
CO   complement(AAHY01214394.1:1..1647),gap(67),AAHY01214395.1:1..3396,gap(568),
CO   complement(AAHY01214396.1:1..11873),gap(74),AAHY01214397.1:1..13217,
CO   gap(185),AAHY01214398.1:1..2827,gap(19664),
CO   complement(AAHY01214399.1:1..1490),gap(823),AAHY01214400.1:1..1960,
CO   gap(5486),complement(AAHY01214401.1:1..5833),gap(2524),
CO   complement(AAHY01214402.1:1..5556),gap(159),
CO   complement(AAHY01214403.1:1..36684),gap(118),
CO   complement(AAHY01214404.1:1..1784),gap(5910),AAHY01214405.1:1..5492,
CO   gap(102),complement(AAHY01214406.1:1..1649),gap(197),
CO   complement(AAHY01214407.1:1..1842),gap(3282),
CO   complement(AAHY01214408.1:1..16319),gap(136),
CO   complement(AAHY01214409.1:1..14512),gap(710),AAHY01214410.1:1..5562,
CO   gap(20),complement(AAHY01214411.1:1..7999),gap(20),AAHY01214412.1:1..7978,
CO   gap(224),complement(AAHY01214413.1:1..2949),gap(128),
CO   complement(AAHY01214414.1:1..2787),gap(1215),
CO   complement(AAHY01214415.1:1..31814),gap(421),AAHY01214416.1:1..3917,
CO   gap(20),AAHY01214417.1:1..2235,gap(1404),
CO   complement(AAHY01214418.1:1..1791),gap(688),
CO   complement(AAHY01214419.1:1..9548),gap(20),AAHY01214420.1:1..41019,
CO   gap(584),AAHY01214421.1:1..14239,gap(20),AAHY01214422.1:1..1617,gap(871),
CO   AAHY01214423.1:1..20842,gap(166),AAHY01214424.1:1..840,gap(20),
CO   AAHY01214425.1:1..16649,gap(20),complement(AAHY01214426.1:1..2204),
CO   gap(544),complement(AAHY01214427.1:1..990),gap(3223),
CO   complement(AAHY01214428.1:1..24304),gap(20),AAHY01214429.1:1..27881,
CO   gap(328),AAHY01214430.1:1..2458,gap(33),complement(AAHY01214431.1:1..5956),
CO   gap(7599),complement(AAHY01214432.1:1..26070),gap(20),
CO   complement(AAHY01214433.1:1..20025),gap(6957),
CO   complement(AAHY01214434.1:1..3293),gap(20),
CO   complement(AAHY01214435.1:1..26224),gap(20),
CO   complement(AAHY01214436.1:1..14492),gap(13848),
CO   complement(AAHY01214437.1:1..1106),gap(897),AAHY01214438.1:1..3553,
CO   gap(709),complement(AAHY01214439.1:1..19983),gap(20),
CO   complement(AAHY01214440.1:1..10818),gap(20),AAHY01214441.1:1..8335,
CO   gap(154),complement(AAHY01214442.1:1..7797),gap(43),
CO   complement(AAHY01214443.1:1..6910),gap(3619),
CO   complement(AAHY01214444.1:1..6230),gap(20),
CO   complement(AAHY01214445.1:1..5342),gap(526),
CO   complement(AAHY01214446.1:1..1064),gap(20),AAHY01214447.1:1..1392,gap(20),
CO   complement(AAHY01214448.1:1..4422),gap(20),AAHY01214449.1:1..5893,gap(435),
CO   AAHY01214450.1:1..2059,gap(1112),complement(AAHY01214451.1:1..9556),
CO   gap(858),complement(AAHY01214452.1:1..6479),gap(3471),
CO   complement(AAHY01214453.1:1..3894),gap(20),AAHY01214454.1:1..4872,gap(100),
CO   complement(AAHY01214455.1:1..61018),gap(550),AAHY01214456.1:1..618,
CO   gap(1099),AAHY01214457.1:1..4368,gap(20),AAHY01214458.1:1..8413,gap(244),
CO   AAHY01214459.1:1..2313,gap(650),complement(AAHY01214460.1:1..3360),
CO   gap(367),complement(AAHY01214461.1:1..4507),gap(353),
CO   complement(AAHY01214462.1:1..15212),gap(133),
CO   complement(AAHY01214463.1:1..2941),gap(1016),
CO   complement(AAHY01214464.1:1..4926),gap(89),
CO   complement(AAHY01214465.1:1..28938),gap(263),
CO   complement(AAHY01214466.1:1..12374),gap(1120),
CO   complement(AAHY01214467.1:1..3065),gap(20),AAHY01214468.1:1..434,gap(20),
CO   complement(AAHY01214469.1:1..4943),gap(218),
CO   complement(AAHY01214470.1:1..1550),gap(2105),
CO   complement(AAHY01214471.1:1..5138),gap(423),AAHY01214472.1:1..1011,
CO   gap(982),complement(AAHY01214473.1:1..8110),gap(195),
CO   complement(AAHY01214474.1:1..3449),gap(396),
CO   complement(AAHY01214475.1:1..1043),gap(232),
CO   complement(AAHY01214476.1:1..9059),gap(302),
CO   complement(AAHY01214477.1:1..15954),gap(20),
CO   complement(AAHY01214478.1:1..8045),gap(20),AAHY01214479.1:1..20502,gap(20),
CO   complement(AAHY01214480.1:1..25408),gap(379),AAHY01214481.1:1..1638,
CO   gap(1112),complement(AAHY01214482.1:1..3371),gap(72),
CO   complement(AAHY01214483.1:1..6998),gap(86),
CO   complement(AAHY01214484.1:1..1545),gap(664),AAHY01214485.1:1..3144,
CO   gap(354),complement(AAHY01214486.1:1..5163),gap(20),AAHY01214487.1:1..1805,
CO   gap(134),AAHY01214488.1:1..2436,gap(822),
CO   complement(AAHY01214489.1:1..7783),gap(88),AAHY01214490.1:1..33272,gap(20),
CO   AAHY01214491.1:1..11275,gap(20),complement(AAHY01214492.1:1..1318),gap(20),
CO   complement(AAHY01214493.1:1..4561),gap(216),AAHY01214494.1:1..6713,
CO   gap(639),complement(AAHY01214495.1:1..1411),gap(20),AAHY01214496.1:1..1479,
CO   gap(1336),complement(AAHY01214497.1:1..1919),gap(17700),
CO   complement(AAHY01214498.1:1..5458),gap(245),
CO   complement(AAHY01214499.1:1..10349),gap(20),
CO   complement(AAHY01214500.1:1..11605),gap(1135),
CO   complement(AAHY01214501.1:1..2606),gap(20),AAHY01214502.1:1..3202,gap(713),
CO   complement(AAHY01214503.1:1..8335),gap(20),AAHY01214504.1:1..6679,gap(394),
CO   complement(AAHY01214505.1:1..2016),gap(158),AAHY01214506.1:1..1637,
CO   gap(121),complement(AAHY01214507.1:1..5678),gap(20),
CO   complement(AAHY01214508.1:1..10502),gap(20),AAHY01214509.1:1..2575,
CO   gap(223),complement(AAHY01214510.1:1..7442),gap(1050),
CO   complement(AAHY01214511.1:1..3662),gap(278),
CO   complement(AAHY01214512.1:1..7945),gap(4351),
CO   complement(AAHY01214513.1:1..8537),gap(23028),AAHY01214514.1:1..9850,
CO   gap(877),complement(AAHY01214515.1:1..13810),gap(3124),
CO   complement(AAHY01214516.1:1..1254),gap(209),AAHY01214517.1:1..5654,gap(20),
CO   AAHY01214518.1:1..3557,gap(20),AAHY01214519.1:1..3523,gap(202),
CO   complement(AAHY01214520.1:1..1172),gap(239),
CO   complement(AAHY01214521.1:1..1273),gap(57),AAHY01214522.1:1..7718,gap(20),
CO   AAHY01214523.1:1..13070,gap(20),AAHY01214524.1:1..10888,gap(20),
CO   AAHY01214525.1:1..31619,gap(145),complement(AAHY01214526.1:1..19132),
CO   gap(2224),complement(AAHY01214527.1:1..90650),gap(20),
CO   complement(AAHY01214528.1:1..2686),gap(20),
CO   complement(AAHY01214529.1:1..3028),gap(20),
CO   complement(AAHY01214530.1:1..14174),gap(6766),AAHY01214531.1:1..928,
CO   gap(177),AAHY01214532.1:1..2687,gap(294),AAHY01214533.1:1..1298,gap(20),
CO   AAHY01214534.1:1..16038,gap(862),complement(AAHY01214535.1:1..15755),
CO   gap(20),AAHY01214536.1:1..20904,gap(20),complement(AAHY01214537.1:1..3716),
CO   gap(20),complement(AAHY01214538.1:1..28313),gap(179),
CO   complement(AAHY01214539.1:1..6188),gap(270),
CO   complement(AAHY01214540.1:1..9644),gap(20),AAHY01214541.1:1..17898,
CO   gap(151),AAHY01214542.1:1..9005,gap(156),AAHY01214543.1:1..4876,gap(20),
CO   complement(AAHY01214544.1:1..14728),gap(590),AAHY01214545.1:1..2448,
CO   gap(111),complement(AAHY01214546.1:1..9935),gap(153),
CO   complement(AAHY01214547.1:1..6668),gap(20),
CO   complement(AAHY01214548.1:1..2347),gap(20),AAHY01214549.1:1..2474,gap(20),
CO   complement(AAHY01214550.1:1..19135),gap(384),AAHY01214551.1:1..2492,
CO   gap(584),AAHY01214552.1:1..3589,gap(108),AAHY01214553.1:1..28280,gap(205),
CO   complement(AAHY01214554.1:1..2826),gap(517),AAHY01214555.1:1..5501,gap(47),
CO   AAHY01214556.1:1..10720,gap(364),AAHY01214557.1:1..3037,gap(20),
CO   AAHY01214558.1:1..5288,gap(20),AAHY01214559.1:1..4411,gap(20),
CO   AAHY01214560.1:1..1149,gap(20),complement(AAHY01214561.1:1..6034),gap(150),
CO   AAHY01214562.1:1..4614,gap(20),AAHY01214563.1:1..5058,gap(20),
CO   complement(AAHY01214564.1:1..5517),gap(20),
CO   complement(AAHY01214565.1:1..1756),gap(20),AAHY01214566.1:1..1221,gap(20),
CO   AAHY01214567.1:1..8096,gap(20),AAHY01214568.1:1..8774,gap(20),
CO   AAHY01214569.1:1..1867,gap(161),complement(AAHY01214570.1:1..4903),gap(20),
CO   complement(AAHY01214571.1:1..3377),gap(59),
CO   complement(AAHY01214572.1:1..9057),gap(137),
CO   complement(AAHY01214573.1:1..2446),gap(20),
CO   complement(AAHY01214574.1:1..21139),gap(20),
CO   complement(AAHY01214575.1:1..15546),gap(6439),
CO   complement(AAHY01214576.1:1..7978),gap(4329),
CO   complement(AAHY01214577.1:1..1626),gap(20),AAHY01214578.1:1..6532,gap(782),
CO   complement(AAHY01214579.1:1..47486),gap(35),AAHY01214580.1:1..3746,gap(45),
CO   AAHY01214581.1:1..5745,gap(20),AAHY01214582.1:1..17214,gap(20),
CO   AAHY01214583.1:1..2942,gap(20),AAHY01214584.1:1..6453,gap(1691),
CO   complement(AAHY01214585.1:1..18801),gap(1578),
CO   complement(AAHY01214586.1:1..4058),gap(116),AAHY01214587.1:1..3123,gap(20),
CO   complement(AAHY01214588.1:1..6000),gap(1519),AAHY01214589.1:1..1055,
CO   gap(634),AAHY01214590.1:1..1022,gap(1403),
CO   complement(AAHY01214591.1:1..2453),gap(282),
CO   complement(AAHY01214592.1:1..10087),gap(94),
CO   complement(AAHY01214593.1:1..4373),gap(20),AAHY01214594.1:1..13920,
CO   gap(2367),AAHY01214595.1:1..1071,gap(20),
CO   complement(AAHY01214596.1:1..3391),gap(20),
CO   complement(AAHY01214597.1:1..4280),gap(38),AAHY01214598.1:1..6611,gap(20),
CO   complement(AAHY01214599.1:1..4098),gap(30),AAHY01214600.1:1..6713,gap(134),
CO   complement(AAHY01214601.1:1..7216),gap(20),
CO   complement(AAHY01214602.1:1..8303),gap(1148),AAHY01214603.1:1..1311,
CO   gap(105),complement(AAHY01214604.1:1..3738),gap(1064),
CO   AAHY01214605.1:1..1289,gap(439),complement(AAHY01214606.1:1..5111),gap(67),
CO   complement(AAHY01214607.1:1..2355),gap(20),
CO   complement(AAHY01214608.1:1..8671),gap(20),
CO   complement(AAHY01214609.1:1..3754),gap(358),AAHY01214610.1:1..1242,
CO   gap(120),complement(AAHY01214611.1:1..3656),gap(5389),
CO   complement(AAHY01214612.1:1..5744),gap(323),
CO   complement(AAHY01214613.1:1..3119),gap(79),AAHY01214614.1:1..2236,gap(20),
CO   complement(AAHY01214615.1:1..11295),gap(20),
CO   complement(AAHY01214616.1:1..7466),gap(1291),AAHY01214617.1:1..14760,
CO   gap(20),complement(AAHY01214618.1:1..6750),gap(573),
CO   AAHY01214619.1:1..29697,gap(20),AAHY01214620.1:1..3951,gap(48),
CO   AAHY01214621.1:1..3898,gap(20),complement(AAHY01214622.1:1..10681),gap(20),
CO   AAHY01214623.1:1..3459,gap(921),complement(AAHY01214624.1:1..5268),
CO   gap(632),complement(AAHY01214625.1:1..33587),gap(405),
CO   complement(AAHY01214626.1:1..17463),gap(743),
CO   complement(AAHY01214627.1:1..1115),gap(252),
CO   complement(AAHY01214628.1:1..15756),gap(20),
CO   complement(AAHY01214629.1:1..3208),gap(216),AAHY01214630.1:1..1538,
CO   gap(587),complement(AAHY01214631.1:1..2925),gap(970),
CO   AAHY01214632.1:1..10616,gap(85),complement(AAHY01214633.1:1..23711),
CO   gap(121),complement(AAHY01214634.1:1..11457),gap(20),
CO   AAHY01214635.1:1..1756,gap(20),AAHY01214636.1:1..2193,gap(51),
CO   complement(AAHY01214637.1:1..1229),gap(65),
CO   complement(AAHY01214638.1:1..6040),gap(649),
CO   complement(AAHY01214639.1:1..15474),gap(231),
CO   complement(AAHY01214640.1:1..8349),gap(3549),
CO   complement(AAHY01214641.1:1..10454),gap(166),
CO   complement(AAHY01214642.1:1..4884),gap(20),
CO   complement(AAHY01214643.1:1..9093),gap(755),AAHY01214644.1:1..1928,
CO   gap(1599),AAHY01214645.1:1..5691,gap(182),
CO   complement(AAHY01214646.1:1..12743),gap(703),
CO   complement(AAHY01214647.1:1..2695),gap(755),
CO   complement(AAHY01214648.1:1..18401),gap(20),AAHY01214649.1:1..2600,
CO   gap(262),complement(AAHY01214650.1:1..1838),gap(149),
CO   complement(AAHY01214651.1:1..2872),gap(196),
CO   complement(AAHY01214652.1:1..13666),gap(1220),
CO   complement(AAHY01214653.1:1..8501),gap(238),
CO   complement(AAHY01214654.1:1..3528),gap(517),
CO   complement(AAHY01214655.1:1..23287),gap(20),
CO   complement(AAHY01214656.1:1..1622),gap(7433),
CO   complement(AAHY01214657.1:1..4556),gap(49),
CO   complement(AAHY01214658.1:1..7585),gap(20),
CO   complement(AAHY01214659.1:1..5224),gap(1039),
CO   complement(AAHY01214660.1:1..1160),gap(124),
CO   complement(AAHY01214661.1:1..6405),gap(20),
CO   complement(AAHY01214662.1:1..2774),gap(38),
CO   complement(AAHY01214663.1:1..7082),gap(49),AAHY01214664.1:1..24060,
CO   gap(868),complement(AAHY01214665.1:1..10151),gap(307),
CO   complement(AAHY01214666.1:1..28460),gap(5919),
CO   complement(AAHY01214667.1:1..4646),gap(105),
CO   complement(AAHY01214668.1:1..5762),gap(32),
CO   complement(AAHY01214669.1:1..16693),gap(265),AAHY01214670.1:1..5191,
CO   gap(87),AAHY01214671.1:1..3519,gap(20),complement(AAHY01214672.1:1..3109),
CO   gap(20),complement(AAHY01214673.1:1..1648),gap(20),AAHY01214674.1:1..6480,
CO   gap(1095),complement(AAHY01214675.1:1..10276),gap(1466),
CO   complement(AAHY01214676.1:1..329),gap(366),
CO   complement(AAHY01214677.1:1..3113),gap(54),
CO   complement(AAHY01214678.1:1..618),gap(20),
CO   complement(AAHY01214679.1:1..4730),gap(5297),
CO   complement(AAHY01214680.1:1..14124),gap(20),AAHY01214681.1:1..1369,gap(20),
CO   complement(AAHY01214682.1:1..7344),gap(20),
CO   complement(AAHY01214683.1:1..3511),gap(7301),
CO   complement(AAHY01214684.1:1..12044),gap(20),
CO   complement(AAHY01214685.1:1..13133),gap(343),
CO   complement(AAHY01214686.1:1..1570),gap(20),
CO   complement(AAHY01214687.1:1..8309),gap(20),
CO   complement(AAHY01214688.1:1..6666),gap(613),
CO   complement(AAHY01214689.1:1..5791),gap(261),AAHY01214690.1:1..3338,gap(20),
CO   complement(AAHY01214691.1:1..5402),gap(20),
CO   complement(AAHY01214692.1:1..4574),gap(222),AAHY01214693.1:1..1941,gap(20),
CO   complement(AAHY01214694.1:1..6230),gap(95),AAHY01214695.1:1..17315,
CO   gap(357),AAHY01214696.1:1..5990,gap(111),AAHY01214697.1:1..15531,gap(20),
CO   AAHY01214698.1:1..13409,gap(83),complement(AAHY01214699.1:1..3958),gap(20),
CO   complement(AAHY01214700.1:1..6782),gap(20),AAHY01214701.1:1..3648,gap(20),
CO   complement(AAHY01214702.1:1..24231),gap(54),AAHY01214703.1:1..4399,
CO   gap(539),complement(AAHY01214704.1:1..1725),gap(158),
CO   AAHY01214705.1:1..27742,gap(752),complement(AAHY01214706.1:1..2487),
CO   gap(20),AAHY01214707.1:1..4508,gap(20),AAHY01214708.1:1..7799,gap(20),
CO   complement(AAHY01214709.1:1..939),gap(238),
CO   complement(AAHY01214710.1:1..6694),gap(217),
CO   complement(AAHY01214711.1:1..8347),gap(435),
CO   complement(AAHY01214712.1:1..2333),gap(540),
CO   complement(AAHY01214713.1:1..5113),gap(150),
CO   complement(AAHY01214714.1:1..3537),gap(5204),AAHY01214715.1:1..7108,
CO   gap(20),AAHY01214716.1:1..5290,gap(222),complement(AAHY01214717.1:1..1719),
CO   gap(20),AAHY01214718.1:1..2133,gap(20),AAHY01214719.1:1..30900,gap(95),
CO   AAHY01214720.1:1..9556,gap(20),AAHY01214721.1:1..1914,gap(321),
CO   complement(AAHY01214722.1:1..4565),gap(69),AAHY01214723.1:1..55841,gap(20),
CO   complement(AAHY01214724.1:1..7977),gap(20),
CO   complement(AAHY01214725.1:1..6037),gap(2471),AAHY01214726.1:1..2197,
CO   gap(20),complement(AAHY01214727.1:1..4416),gap(20),AAHY01214728.1:1..1610,
CO   gap(20),complement(AAHY01214729.1:1..3827),gap(1008),
CO   AAHY01214730.1:1..5834,gap(20),complement(AAHY01214731.1:1..1878),gap(433),
CO   AAHY01214732.1:1..8578,gap(311),complement(AAHY01214733.1:1..4411),gap(20),
CO   AAHY01214734.1:1..5741,gap(20),AAHY01214735.1:1..18656,gap(2831),
CO   complement(AAHY01214736.1:1..19136),gap(34),AAHY01214737.1:1..792,gap(273),
CO   complement(AAHY01214738.1:1..12390),gap(115),
CO   complement(AAHY01214739.1:1..2099),gap(7244),
CO   complement(AAHY01214740.1:1..14863),gap(549),
CO   complement(AAHY01214741.1:1..12789),gap(2396),
CO   complement(AAHY01214742.1:1..3300),gap(20),AAHY01214743.1:1..10552,gap(20),
CO   complement(AAHY01214744.1:1..17575),gap(20),AAHY01214745.1:1..9621,gap(83),
CO   AAHY01214746.1:1..3255,gap(20),complement(AAHY01214747.1:1..29351),gap(20),
CO   complement(AAHY01214748.1:1..7906),gap(2029),
CO   complement(AAHY01214749.1:1..1655),gap(1544),
CO   complement(AAHY01214750.1:1..4905),gap(20),
CO   complement(AAHY01214751.1:1..12450),gap(756),
CO   complement(AAHY01214752.1:1..2138),gap(1769),
CO   complement(AAHY01214753.1:1..1764),gap(28),
CO   complement(AAHY01214754.1:1..2433),gap(20),AAHY01214755.1:1..2871,gap(20),
CO   AAHY01214756.1:1..18034,gap(20),complement(AAHY01214757.1:1..1270),
CO   gap(204),AAHY01214758.1:1..1204,gap(208),AAHY01214759.1:1..7552,gap(149),
CO   AAHY01214760.1:1..13155,gap(20),AAHY01214761.1:1..12904,gap(20),
CO   AAHY01214762.1:1..6318,gap(20),AAHY01214763.1:1..36350,gap(20),
CO   AAHY01214764.1:1..4097,gap(175),AAHY01214765.1:1..1206,gap(107),
CO   AAHY01214766.1:1..2050,gap(20),complement(AAHY01214767.1:1..15618),
CO   gap(5439),complement(AAHY01214768.1:1..8252),gap(304),
CO   complement(AAHY01214769.1:1..12301),gap(20),
CO   complement(AAHY01214770.1:1..4113),gap(20),AAHY01214771.1:1..23807,gap(77),
CO   AAHY01214772.1:1..8288,gap(20),AAHY01214773.1:1..4459,gap(20),
CO   AAHY01214774.1:1..8747,gap(20),complement(AAHY01214775.1:1..5149),gap(20),
CO   AAHY01214776.1:1..2229,gap(695),complement(AAHY01214777.1:1..2036),gap(53),
CO   AAHY01214778.1:1..10845,gap(20),AAHY01214779.1:1..14100,gap(232),
CO   complement(AAHY01214780.1:1..17833),gap(208),AAHY01214781.1:1..21269,
CO   gap(95),complement(AAHY01214782.1:1..10049),gap(758),
CO   complement(AAHY01214783.1:1..1522),gap(20),AAHY01214784.1:1..7974,gap(123),
CO   complement(AAHY01214785.1:1..11497),gap(871),AAHY01214786.1:1..755,gap(20),
CO   AAHY01214787.1:1..8229,gap(107),complement(AAHY01214788.1:1..14320),
CO   gap(303),complement(AAHY01214789.1:1..12359),gap(196),
CO   AAHY01214790.1:1..2063,gap(146),AAHY01214791.1:1..2999,gap(20),
CO   AAHY01214792.1:1..9215,gap(1050),AAHY01214793.1:1..6165,gap(498),
CO   complement(AAHY01214794.1:1..4688),gap(20),AAHY01214795.1:1..7476,gap(20),
CO   complement(AAHY01214796.1:1..25897),gap(36),
CO   complement(AAHY01214797.1:1..1388),gap(222),AAHY01214798.1:1..2941,gap(20),
CO   AAHY01214799.1:1..4167,gap(209),complement(AAHY01214800.1:1..3200),gap(20),
CO   complement(AAHY01214801.1:1..13247),gap(705),
CO   complement(AAHY01214802.1:1..26015),gap(20),AAHY01214803.1:1..2672,
CO   gap(1980),complement(AAHY01214804.1:1..5631),gap(20),
CO   AAHY01214805.1:1..13193,gap(563),AAHY01214806.1:1..2240,gap(425),
CO   AAHY01214807.1:1..1712,gap(605),complement(AAHY01214808.1:1..21523),
CO   gap(596),AAHY01214809.1:1..3377,gap(329),
CO   complement(AAHY01214810.1:1..4242),gap(20),
CO   complement(AAHY01214811.1:1..4241),gap(95),AAHY01214812.1:1..5834,gap(20),
CO   AAHY01214813.1:1..8289,gap(20),AAHY01214814.1:1..7933,gap(21),
CO   AAHY01214815.1:1..16729,gap(37),AAHY01214816.1:1..7723,gap(370),
CO   complement(AAHY01214817.1:1..9757),gap(1595),AAHY01214818.1:1..2659,
CO   gap(745),complement(AAHY01214819.1:1..4871),gap(340),
CO   AAHY01214820.1:1..2462,gap(20),AAHY01214821.1:1..15178,gap(20),
CO   AAHY01214822.1:1..10454,gap(20),AAHY01214823.1:1..6082,gap(181),
CO   AAHY01214824.1:1..4671,gap(597),AAHY01214825.1:1..17141,gap(20),
CO   AAHY01214826.1:1..7963,gap(34),AAHY01214827.1:1..21121,gap(20),
CO   complement(AAHY01214828.1:1..1162),gap(1747),AAHY01214829.1:1..1639,
CO   gap(63),complement(AAHY01214830.1:1..1898),gap(78),
CO   complement(AAHY01214831.1:1..13111),gap(20),AAHY01214832.1:1..3783,gap(20),
CO   AAHY01214833.1:1..7456,gap(20),AAHY01214834.1:1..8732,gap(316),
CO   AAHY01214835.1:1..4862,gap(24),AAHY01214836.1:1..1728,gap(210),
CO   AAHY01214837.1:1..3224,gap(20),complement(AAHY01214838.1:1..9130),gap(20),
CO   AAHY01214839.1:1..2662,gap(153),AAHY01214840.1:1..2897,gap(59),
CO   AAHY01214841.1:1..7216,gap(119),AAHY01214842.1:1..8387,gap(20),
CO   AAHY01214843.1:1..3204,gap(39),AAHY01214844.1:1..10841,gap(1106),
CO   complement(AAHY01214845.1:1..4356),gap(237),AAHY01214846.1:1..5138,
CO   gap(151),AAHY01214847.1:1..1213,gap(973),
CO   complement(AAHY01214848.1:1..3087),gap(1107),AAHY01214849.1:1..11001,
CO   gap(20),complement(AAHY01214850.1:1..2035),gap(671),AAHY01214851.1:1..5672,
CO   gap(234),complement(AAHY01214852.1:1..800),gap(195),
CO   complement(AAHY01214853.1:1..11470),gap(72),AAHY01214854.1:1..1988,
CO   gap(399),AAHY01214855.1:1..4802,gap(142),
CO   complement(AAHY01214856.1:1..2338),gap(239),
CO   complement(AAHY01214857.1:1..1339),gap(337),
CO   complement(AAHY01214858.1:1..1716),gap(72),
CO   complement(AAHY01214859.1:1..1525),gap(729),AAHY01214860.1:1..5001,gap(20),
CO   complement(AAHY01214861.1:1..1096),gap(452),
CO   complement(AAHY01214862.1:1..8915),gap(79),AAHY01214863.1:1..1788,gap(42),
CO   complement(AAHY01214864.1:1..1277),gap(20),AAHY01214865.1:1..2934,gap(122),
CO   complement(AAHY01214866.1:1..2774),gap(412),
CO   complement(AAHY01214867.1:1..1926),gap(20),
CO   complement(AAHY01214868.1:1..13663),gap(84),AAHY01214869.1:1..6848,
CO   gap(113),complement(AAHY01214870.1:1..7278),gap(20),AAHY01214871.1:1..3745,
CO   gap(187),AAHY01214872.1:1..4997,gap(20),AAHY01214873.1:1..4694,gap(29),
CO   AAHY01214874.1:1..9992,gap(457),AAHY01214875.1:1..2366,gap(29),
CO   complement(AAHY01214876.1:1..7276),gap(20),AAHY01214877.1:1..9801,gap(103),
CO   AAHY01214878.1:1..11150,gap(20),AAHY01214879.1:1..1856,gap(147),
CO   complement(AAHY01214880.1:1..4476),gap(348),
CO   complement(AAHY01214881.1:1..19235),gap(629),
CO   complement(AAHY01214882.1:1..2201),gap(924),AAHY01214883.1:1..2911,
CO   gap(132),AAHY01214884.1:1..22459,gap(130),
CO   complement(AAHY01214885.1:1..4857),gap(20),AAHY01214886.1:1..11347,
CO   gap(136),AAHY01214887.1:1..28125,gap(48),AAHY01214888.1:1..6417,gap(45),
CO   AAHY01214889.1:1..2212,gap(20),AAHY01214890.1:1..7445,gap(79),
CO   AAHY01214891.1:1..9793,gap(100),AAHY01214892.1:1..1931,gap(20),
CO   complement(AAHY01214893.1:1..3784),gap(20),AAHY01214894.1:1..5420,gap(181),
CO   complement(AAHY01214895.1:1..4647),gap(20),AAHY01214896.1:1..1772,gap(20),
CO   AAHY01214897.1:1..6064,gap(332),complement(AAHY01214898.1:1..3252),gap(20),
CO   complement(AAHY01214899.1:1..12942),gap(20),
CO   complement(AAHY01214900.1:1..2774),gap(20),
CO   complement(AAHY01214901.1:1..1201),gap(20),
CO   complement(AAHY01214902.1:1..14370),gap(157),
CO   complement(AAHY01214903.1:1..6225),gap(2003),
CO   complement(AAHY01214904.1:1..5618),gap(159),
CO   complement(AAHY01214905.1:1..1093),gap(20),
CO   complement(AAHY01214906.1:1..10272),gap(595),
CO   complement(AAHY01214907.1:1..16405),gap(36),
CO   complement(AAHY01214908.1:1..4393),gap(140),
CO   complement(AAHY01214909.1:1..1073),gap(955),AAHY01214910.1:1..1649,
CO   gap(586),AAHY01214911.1:1..3463,gap(20),AAHY01214912.1:1..10630,gap(20),
CO   complement(AAHY01214913.1:1..1634),gap(1222),AAHY01214914.1:1..383,
CO   gap(573),complement(AAHY01214915.1:1..2954),gap(20),AAHY01214916.1:1..1579,
CO   gap(199),complement(AAHY01214917.1:1..6324),gap(130),
CO   AAHY01214918.1:1..1492,gap(114),AAHY01214919.1:1..3774,gap(56),
CO   AAHY01214920.1:1..20316,gap(96),AAHY01214921.1:1..10698,gap(660),
CO   AAHY01214922.1:1..9385,gap(196),complement(AAHY01214923.1:1..15144),
CO   gap(20),complement(AAHY01214924.1:1..4871),gap(28),
CO   complement(AAHY01214925.1:1..4639),gap(353),
CO   complement(AAHY01214926.1:1..1650),gap(1940),
CO   complement(AAHY01214927.1:1..6057),gap(18958),AAHY01214928.1:1..1671,
CO   gap(20),AAHY01214929.1:1..1361,gap(20),complement(AAHY01214930.1:1..1356),
CO   gap(106),complement(AAHY01214931.1:1..6605),gap(502),
CO   AAHY01214932.1:1..7483,gap(45),AAHY01214933.1:1..19261,gap(345),
CO   complement(AAHY01214934.1:1..1501),gap(20),AAHY01214935.1:1..4351,gap(342),
CO   complement(AAHY01214936.1:1..2144),gap(31),AAHY01214937.1:1..1876,gap(20),
CO   complement(AAHY01214938.1:1..4197),gap(928),
CO   complement(AAHY01214939.1:1..898),gap(680),
CO   complement(AAHY01214940.1:1..1104),gap(145),AAHY01214941.1:1..13590,
CO   gap(20),AAHY01214942.1:1..3391,gap(20),AAHY01214943.1:1..1711,gap(177),
CO   AAHY01214944.1:1..1323,gap(354),AAHY01214945.1:1..1232,gap(73),
CO   AAHY01214946.1:1..11008,gap(1014),complement(AAHY01214947.1:1..8447),
CO   gap(361),complement(AAHY01214948.1:1..4969),gap(138),
CO   complement(AAHY01214949.1:1..14787),gap(45),
CO   complement(AAHY01214950.1:1..6262),gap(140),
CO   complement(AAHY01214951.1:1..3192),gap(20),AAHY01214952.1:1..24051,
CO   gap(214),complement(AAHY01214953.1:1..627),gap(75),AAHY01214954.1:1..6800,
CO   gap(159),complement(AAHY01214955.1:1..9390),gap(3961),
CO   complement(AAHY01214956.1:1..10969),gap(409),
CO   complement(AAHY01214957.1:1..2950),gap(130),
CO   complement(AAHY01214958.1:1..3870),gap(20),
CO   complement(AAHY01214959.1:1..13340),gap(39),
CO   complement(AAHY01214960.1:1..6854),gap(153),
CO   complement(AAHY01214961.1:1..20814),gap(2414),
CO   complement(AAHY01214962.1:1..9282),gap(20),AAHY01214963.1:1..10558,
CO   gap(122),complement(AAHY01214964.1:1..13935),gap(66),
CO   AAHY01214965.1:1..14971,gap(94),complement(AAHY01214966.1:1..5304),gap(20),
CO   AAHY01214967.1:1..61793,gap(83),complement(AAHY01214968.1:1..4283),
CO   gap(3644),complement(AAHY01214969.1:1..17079),gap(20),
CO   complement(AAHY01214970.1:1..8551),gap(20),AAHY01214971.1:1..1116,gap(20),
CO   AAHY01214972.1:1..8263,gap(20),complement(AAHY01214973.1:1..37417),
CO   gap(399),complement(AAHY01214974.1:1..10445),gap(362),
CO   AAHY01214975.1:1..1687,gap(134),AAHY01214976.1:1..1585,gap(126),
CO   complement(AAHY01214977.1:1..2281),gap(20),AAHY01214978.1:1..3250,gap(20),
CO   complement(AAHY01214979.1:1..1993),gap(378),
CO   complement(AAHY01214980.1:1..30227),gap(20),AAHY01214981.1:1..1597,gap(20),
CO   AAHY01214982.1:1..2569,gap(3450),complement(AAHY01214983.1:1..5760),
CO   gap(501),complement(AAHY01214984.1:1..1922),gap(20),
CO   complement(AAHY01214985.1:1..8995),gap(386),
CO   complement(AAHY01214986.1:1..5635),gap(359),AAHY01214987.1:1..1866,
CO   gap(328),complement(AAHY01214988.1:1..3258),gap(157),
CO   complement(AAHY01214989.1:1..1214),gap(20),
CO   complement(AAHY01214990.1:1..5593),gap(97),
CO   complement(AAHY01214991.1:1..7712),gap(715),
CO   complement(AAHY01214992.1:1..11602),gap(55),
CO   complement(AAHY01214993.1:1..19432),gap(243),
CO   complement(AAHY01214994.1:1..8513),gap(1098),AAHY01214995.1:1..5754,
CO   gap(312),complement(AAHY01214996.1:1..23845),gap(39),
CO   complement(AAHY01214997.1:1..106689),gap(4967),AAHY01214998.1:1..2970,
CO   gap(89),complement(AAHY01214999.1:1..74105),gap(20),
CO   complement(AAHY01215000.1:1..18748),gap(20),
CO   complement(AAHY01215001.1:1..36011),gap(89),
CO   complement(AAHY01215002.1:1..58002),gap(5108),
CO   complement(AAHY01215003.1:1..10903),gap(20),
CO   complement(AAHY01215004.1:1..10020),gap(20),AAHY01215005.1:1..3309,
CO   gap(851),complement(AAHY01215006.1:1..7654),gap(20),
CO   complement(AAHY01215007.1:1..11694),gap(20),
CO   complement(AAHY01215008.1:1..7630),gap(432),AAHY01215009.1:1..6946,
CO   gap(155),complement(AAHY01215010.1:1..6625),gap(20),
CO   complement(AAHY01215011.1:1..7853),gap(183),
CO   complement(AAHY01215012.1:1..9195),gap(20),
CO   complement(AAHY01215013.1:1..7726),gap(20),
CO   complement(AAHY01215014.1:1..43923),gap(20),
CO   complement(AAHY01215015.1:1..10856),gap(20),
CO   complement(AAHY01215016.1:1..8951),gap(1478),
CO   complement(AAHY01215017.1:1..2625),gap(1066),
CO   complement(AAHY01215018.1:1..1927),gap(20),
CO   complement(AAHY01215019.1:1..4844),gap(159),
CO   complement(AAHY01215020.1:1..9283),gap(20),
CO   complement(AAHY01215021.1:1..23097),gap(49),AAHY01215022.1:1..4639,
CO   gap(197),complement(AAHY01215023.1:1..3774),gap(1145),
CO   complement(AAHY01215024.1:1..2523),gap(243),AAHY01215025.1:1..3542,
CO   gap(746),AAHY01215026.1:1..10872,gap(261),
CO   complement(AAHY01215027.1:1..6914),gap(858),
CO   complement(AAHY01215028.1:1..10179),gap(2811),AAHY01215029.1:1..2030,
CO   gap(579),AAHY01215030.1:1..3064,gap(20),complement(AAHY01215031.1:1..1280),
CO   gap(1999),AAHY01215032.1:1..3245,gap(20),
CO   complement(AAHY01215033.1:1..4983),gap(20),AAHY01215034.1:1..15200,gap(56),
CO   complement(AAHY01215035.1:1..4795),gap(20),AAHY01215036.1:1..16635,gap(20),
CO   AAHY01215037.1:1..8041,gap(20),AAHY01215038.1:1..1946,gap(1679),
CO   complement(AAHY01215039.1:1..4070),gap(511),AAHY01215040.1:1..2816,
CO   gap(573),complement(AAHY01215041.1:1..8327),gap(20),AAHY01215042.1:1..1888,
CO   gap(211),complement(AAHY01215043.1:1..39267),gap(483),
CO   complement(AAHY01215044.1:1..8312),gap(20),
CO   complement(AAHY01215045.1:1..6886),gap(20),
CO   complement(AAHY01215046.1:1..6728),gap(20),AAHY01215047.1:1..9343,gap(124),
CO   AAHY01215048.1:1..3882,gap(20),complement(AAHY01215049.1:1..7231),gap(58),
CO   complement(AAHY01215050.1:1..17454),gap(1175),
CO   complement(AAHY01215051.1:1..1390),gap(249),
CO   complement(AAHY01215052.1:1..9469),gap(417),AAHY01215053.1:1..2823,gap(30),
CO   complement(AAHY01215054.1:1..10284),gap(20),
CO   complement(AAHY01215055.1:1..4231),gap(92),
CO   complement(AAHY01215056.1:1..7628),gap(133),
CO   complement(AAHY01215057.1:1..6298),gap(912),
CO   complement(AAHY01215058.1:1..1119),gap(54),AAHY01215059.1:1..1251,gap(46),
CO   complement(AAHY01215060.1:1..7230),gap(245),
CO   complement(AAHY01215061.1:1..1690),gap(20),
CO   complement(AAHY01215062.1:1..9711),gap(20),
CO   complement(AAHY01215063.1:1..20163),gap(527),
CO   complement(AAHY01215064.1:1..2134),gap(84),AAHY01215065.1:1..3834,gap(291),
CO   AAHY01215066.1:1..3349,gap(315),AAHY01215067.1:1..10828,gap(28),
CO   complement(AAHY01215068.1:1..13449),gap(23),
CO   complement(AAHY01215069.1:1..1868),gap(717),
CO   complement(AAHY01215070.1:1..8387),gap(1031),AAHY01215071.1:1..3356,
CO   gap(179),AAHY01215072.1:1..3246,gap(120),
CO   complement(AAHY01215073.1:1..10258),gap(20),
CO   complement(AAHY01215074.1:1..5054),gap(20),AAHY01215075.1:1..2980,gap(907),
CO   complement(AAHY01215076.1:1..5174),gap(153),
CO   complement(AAHY01215077.1:1..20499),gap(138),AAHY01215078.1:1..3121,
CO   gap(559),complement(AAHY01215079.1:1..4678),gap(175),
CO   complement(AAHY01215080.1:1..3282),gap(1940),
CO   complement(AAHY01215081.1:1..1000),gap(253),
CO   complement(AAHY01215082.1:1..11371),gap(267),AAHY01215083.1:1..2268,
CO   gap(3689),AAHY01215084.1:1..3697,gap(20),AAHY01215085.1:1..1891,gap(59),
CO   complement(AAHY01215086.1:1..1790),gap(176),
CO   complement(AAHY01215087.1:1..2187),gap(20),AAHY01215088.1:1..5858,gap(117),
CO   complement(AAHY01215089.1:1..4171),gap(62),
CO   complement(AAHY01215090.1:1..2587),gap(20),
CO   complement(AAHY01215091.1:1..25917),gap(1356),
CO   complement(AAHY01215092.1:1..13804),gap(128),
CO   complement(AAHY01215093.1:1..5685),gap(1144),AAHY01215094.1:1..418,
CO   gap(115),complement(AAHY01215095.1:1..23731),gap(155),
CO   AAHY01215096.1:1..6832,gap(118),AAHY01215097.1:1..3682,gap(705),
CO   AAHY01215098.1:1..1084,gap(20),complement(AAHY01215099.1:1..1863),gap(149),
CO   AAHY01215100.1:1..5492,gap(151),complement(AAHY01215101.1:1..1486),gap(20),
CO   complement(AAHY01215102.1:1..1144),gap(267),AAHY01215103.1:1..3467,gap(20),
CO   complement(AAHY01215104.1:1..1564),gap(552),AAHY01215105.1:1..2136,gap(20),
CO   complement(AAHY01215106.1:1..15128),gap(20),
CO   complement(AAHY01215107.1:1..4571),gap(173),
CO   complement(AAHY01215108.1:1..2423),gap(20),AAHY01215109.1:1..4265,gap(20),
CO   AAHY01215110.1:1..1811,gap(388),complement(AAHY01215111.1:1..3371),
CO   gap(238),complement(AAHY01215112.1:1..1280),gap(191),
CO   complement(AAHY01215113.1:1..4168),gap(741),
CO   complement(AAHY01215114.1:1..16046),gap(1577),
CO   complement(AAHY01215115.1:1..2081),gap(20),AAHY01215116.1:1..9323,gap(496),
CO   AAHY01215117.1:1..781,gap(4204),complement(AAHY01215118.1:1..37023),
CO   gap(503),AAHY01215119.1:1..1563,gap(73),AAHY01215120.1:1..4050,gap(395),
CO   complement(AAHY01215121.1:1..23840),gap(20),AAHY01215122.1:1..1242,gap(20),
CO   AAHY01215123.1:1..3370,gap(6313),AAHY01215124.1:1..37610,gap(82),
CO   complement(AAHY01215125.1:1..2432),gap(157),
CO   complement(AAHY01215126.1:1..8568),gap(103),
CO   complement(AAHY01215127.1:1..2484),gap(48),AAHY01215128.1:1..21046,gap(90),
CO   AAHY01215129.1:1..2383,gap(20),AAHY01215130.1:1..11455,gap(438),
CO   AAHY01215131.1:1..2133,gap(897),complement(AAHY01215132.1:1..13823),
CO   gap(20),AAHY01215133.1:1..7905,gap(865),complement(AAHY01215134.1:1..2414),
CO   gap(1413),complement(AAHY01215135.1:1..2011),gap(288),
CO   complement(AAHY01215136.1:1..5777),gap(100),AAHY01215137.1:1..37494,
CO   gap(47),AAHY01215138.1:1..2245,gap(69),complement(AAHY01215139.1:1..11252),
CO   gap(20),AAHY01215140.1:1..416,gap(843),complement(AAHY01215141.1:1..1201),
CO   gap(1862),AAHY01215142.1:1..9306,gap(343),
CO   complement(AAHY01215143.1:1..1426),gap(1757),AAHY01215144.1:1..1773,
CO   gap(450),complement(AAHY01215145.1:1..2277),gap(20),
CO   complement(AAHY01215146.1:1..6392),gap(311),AAHY01215147.1:1..970,gap(85),
CO   AAHY01215148.1:1..6089,gap(20),AAHY01215149.1:1..15604,gap(1041),
CO   complement(AAHY01215150.1:1..4483),gap(20),
CO   complement(AAHY01215151.1:1..988),gap(619),AAHY01215152.1:1..9214,gap(51),
CO   AAHY01215153.1:1..9028,gap(215),AAHY01215154.1:1..22873,gap(120),
CO   complement(AAHY01215155.1:1..14583),gap(550),AAHY01215156.1:1..8269,
CO   gap(632),AAHY01215157.1:1..2606,gap(42),AAHY01215158.1:1..4103,gap(20),
CO   AAHY01215159.1:1..9346,gap(20),complement(AAHY01215160.1:1..4440),gap(289),
CO   AAHY01215161.1:1..3660,gap(94),AAHY01215162.1:1..18464,gap(202),
CO   complement(AAHY01215163.1:1..9659),gap(20),AAHY01215164.1:1..2416,gap(20),
CO   complement(AAHY01215165.1:1..5240),gap(998),
CO   complement(AAHY01215166.1:1..1828),gap(20),
CO   complement(AAHY01215167.1:1..14098),gap(20),AAHY01215168.1:1..938,gap(425),
CO   AAHY01215169.1:1..10044,gap(20),AAHY01215170.1:1..2546,gap(2088),
CO   complement(AAHY01215171.1:1..1988),gap(327),AAHY01215172.1:1..2892,gap(50),
CO   AAHY01215173.1:1..3225,gap(20),complement(AAHY01215174.1:1..2586),gap(20),
CO   AAHY01215175.1:1..5353,gap(116),AAHY01215176.1:1..758,gap(923),
CO   AAHY01215177.1:1..3082,gap(95),complement(AAHY01215178.1:1..3107),gap(20),
CO   AAHY01215179.1:1..7787,gap(20),complement(AAHY01215180.1:1..1292),gap(20),
CO   complement(AAHY01215181.1:1..1485),gap(20),AAHY01215182.1:1..7628,gap(20),
CO   AAHY01215183.1:1..28356,gap(136),AAHY01215184.1:1..3505,gap(20),
CO   complement(AAHY01215185.1:1..1611),gap(20),AAHY01215186.1:1..1555,gap(163),
CO   complement(AAHY01215187.1:1..5806),gap(352),AAHY01215188.1:1..1708,
CO   gap(2643),AAHY01215189.1:1..656,gap(34),AAHY01215190.1:1..9326,gap(24),
CO   AAHY01215191.1:1..1173,gap(578),AAHY01215192.1:1..2494,gap(148),
CO   AAHY01215193.1:1..1658,gap(192),AAHY01215194.1:1..10664,gap(85),
CO   AAHY01215195.1:1..16980,gap(168),complement(AAHY01215196.1:1..10031),
CO   gap(20),AAHY01215197.1:1..31026,gap(410),AAHY01215198.1:1..1222,gap(20),
CO   complement(AAHY01215199.1:1..6321),gap(20),AAHY01215200.1:1..3181,gap(20),
CO   complement(AAHY01215201.1:1..1489),gap(652),
CO   complement(AAHY01215202.1:1..1578),gap(20),AAHY01215203.1:1..7033,gap(233),
CO   AAHY01215204.1:1..11023,gap(20),complement(AAHY01215205.1:1..3430),gap(20),
CO   AAHY01215206.1:1..4008,gap(31),AAHY01215207.1:1..6534,gap(241),
CO   AAHY01215208.1:1..7745,gap(45),AAHY01215209.1:1..15273,gap(20),
CO   complement(AAHY01215210.1:1..3435),gap(20),AAHY01215211.1:1..6161,gap(278),
CO   AAHY01215212.1:1..6284,gap(20),complement(AAHY01215213.1:1..2464),gap(20),
CO   complement(AAHY01215214.1:1..5215),gap(20),
CO   complement(AAHY01215215.1:1..2776),gap(828),
CO   complement(AAHY01215216.1:1..9036),gap(114),AAHY01215217.1:1..3731,gap(20),
CO   AAHY01215218.1:1..15628,gap(21),AAHY01215219.1:1..1233,gap(20),
CO   AAHY01215220.1:1..9544,gap(20),AAHY01215221.1:1..7432,gap(843),
CO   AAHY01215222.1:1..4202,gap(20),complement(AAHY01215223.1:1..9172),gap(32),
CO   complement(AAHY01215224.1:1..9610),gap(42),AAHY01215225.1:1..19161,
CO   gap(140),AAHY01215226.1:1..4095,gap(509),AAHY01215227.1:1..1038,gap(2012),
CO   complement(AAHY01215228.1:1..19676),gap(718),AAHY01215229.1:1..1193,
CO   gap(26),AAHY01215230.1:1..2588,gap(102),AAHY01215231.1:1..7960,gap(184),
CO   AAHY01215232.1:1..11071,gap(348),complement(AAHY01215233.1:1..15938),
CO   gap(87),AAHY01215234.1:1..5762,gap(20),AAHY01215235.1:1..6224,gap(20),
CO   AAHY01215236.1:1..6002,gap(296),AAHY01215237.1:1..6635,gap(20),
CO   AAHY01215238.1:1..12755,gap(455),complement(AAHY01215239.1:1..27722),
CO   gap(2204),AAHY01215240.1:1..1038,gap(20),AAHY01215241.1:1..3874,gap(41),
CO   complement(AAHY01215242.1:1..1753),gap(64),
CO   complement(AAHY01215243.1:1..2169),gap(171),
CO   complement(AAHY01215244.1:1..4762),gap(2424),
CO   complement(AAHY01215245.1:1..1610),gap(20),
CO   complement(AAHY01215246.1:1..8404),gap(28),
CO   complement(AAHY01215247.1:1..2404),gap(334),
CO   complement(AAHY01215248.1:1..1654),gap(352),
CO   complement(AAHY01215249.1:1..2065),gap(105),
CO   complement(AAHY01215250.1:1..2766),gap(20),
CO   complement(AAHY01215251.1:1..1255),gap(1949),
CO   complement(AAHY01215252.1:1..9357),gap(5586),
CO   complement(AAHY01215253.1:1..2727),gap(7779),
CO   complement(AAHY01215254.1:1..4815),gap(1536),
CO   complement(AAHY01215255.1:1..5260),gap(90),
CO   complement(AAHY01215256.1:1..7022),gap(20),AAHY01215257.1:1..1423,
CO   gap(4434),complement(AAHY01215258.1:1..6326),gap(20),AAHY01215259.1:1..778,
CO   gap(467),AAHY01215260.1:1..1352,gap(20),complement(AAHY01215261.1:1..1279),
CO   gap(392),complement(AAHY01215262.1:1..1836),gap(889),
CO   complement(AAHY01215263.1:1..1204),gap(20),AAHY01215264.1:1..1959,gap(20),
CO   complement(AAHY01215265.1:1..1191),gap(20),
CO   complement(AAHY01215266.1:1..1018),gap(48446),
CO   complement(AAHY01215267.1:1..3303),gap(1097),
CO   complement(AAHY01215268.1:1..7996),gap(1277),
CO   complement(AAHY01215269.1:1..2753),gap(20),
CO   complement(AAHY01215270.1:1..2357),gap(1168),
CO   complement(AAHY01215271.1:1..1035),gap(210),
CO   complement(AAHY01215272.1:1..724),gap(184),
CO   complement(AAHY01215273.1:1..14234),gap(20),
CO   complement(AAHY01215274.1:1..12881),gap(20),
CO   complement(AAHY01215275.1:1..748),gap(102),
CO   complement(AAHY01215276.1:1..1525),gap(594),
CO   complement(AAHY01215277.1:1..15221),gap(20),AAHY01215278.1:1..3739,
CO   gap(510),AAHY01215279.1:1..977,gap(546),AAHY01215280.1:1..1460,gap(618),
CO   AAHY01215281.1:1..13976,gap(20),AAHY01215282.1:1..7612,gap(26),
CO   complement(AAHY01215283.1:1..11112),gap(20),
CO   complement(AAHY01215284.1:1..9382),gap(20),
CO   complement(AAHY01215285.1:1..1633),gap(20),AAHY01215286.1:1..753,gap(172),
CO   AAHY01215287.1:1..6184,gap(20),AAHY01215288.1:1..1604,gap(20),
CO   AAHY01215289.1:1..4965,gap(523),AAHY01215290.1:1..1066,gap(20),
CO   AAHY01215291.1:1..1131,gap(5315),AAHY01215292.1:1..4718,gap(20),
CO   AAHY01215293.1:1..4377,gap(410),complement(AAHY01215294.1:1..1246),
CO   gap(1339),complement(AAHY01215295.1:1..1151),gap(20),
CO   AAHY01215296.1:1..5469,gap(109),complement(AAHY01215297.1:1..2884),
CO   gap(126),AAHY01215298.1:1..1692,gap(114),
CO   complement(AAHY01215299.1:1..5678),gap(1014),AAHY01215300.1:1..12238,
CO   gap(20),complement(AAHY01215301.1:1..2798),gap(20),
CO   complement(AAHY01215302.1:1..1551),gap(179),
CO   complement(AAHY01215303.1:1..1930),gap(103),AAHY01215304.1:1..4402,gap(28),
CO   complement(AAHY01215305.1:1..7705),gap(10776),
CO   complement(AAHY01215306.1:1..1543),gap(20),
CO   complement(AAHY01215307.1:1..10187),gap(20),AAHY01215308.1:1..1060,
CO   gap(294),complement(AAHY01215309.1:1..2498),gap(20),AAHY01215310.1:1..6974,
CO   gap(20),complement(AAHY01215311.1:1..15236),gap(214),
CO   complement(AAHY01215312.1:1..3406),gap(474),AAHY01215313.1:1..3468,gap(20),
CO   complement(AAHY01215314.1:1..796),gap(3685),
CO   complement(AAHY01215315.1:1..5312),gap(5515),
CO   complement(AAHY01215316.1:1..5549),gap(33),
CO   complement(AAHY01215317.1:1..18310),gap(218),AAHY01215318.1:1..3084,
CO   gap(20),AAHY01215319.1:1..2221,gap(238),complement(AAHY01215320.1:1..3224),
CO   gap(1372),complement(AAHY01215321.1:1..10977),gap(124),
CO   complement(AAHY01215322.1:1..10926),gap(20),
CO   complement(AAHY01215323.1:1..9669),gap(20),AAHY01215324.1:1..2185,gap(44),
CO   complement(AAHY01215325.1:1..11110),gap(242),AAHY01215326.1:1..1070,
CO   gap(625),complement(AAHY01215327.1:1..22204),gap(26),
CO   complement(AAHY01215328.1:1..4265),gap(38),
CO   complement(AAHY01215329.1:1..1760),gap(20),
CO   complement(AAHY01215330.1:1..3578),gap(272),
CO   complement(AAHY01215331.1:1..14911),gap(20),
CO   complement(AAHY01215332.1:1..10170),gap(1046),
CO   complement(AAHY01215333.1:1..3295),gap(254),
CO   complement(AAHY01215334.1:1..21354),gap(21),
CO   complement(AAHY01215335.1:1..3951),gap(20),
CO   complement(AAHY01215336.1:1..44183),gap(344),
CO   complement(AAHY01215337.1:1..1777),gap(1480),
CO   complement(AAHY01215338.1:1..9161),gap(106),AAHY01215339.1:1..9862,
CO   gap(143),complement(AAHY01215340.1:1..149097),gap(342),
CO   AAHY01215341.1:1..10687,gap(167),AAHY01215342.1:1..1086,gap(117),
CO   AAHY01215343.1:1..3501,gap(751),AAHY01215344.1:1..6068,gap(302),
CO   complement(AAHY01215345.1:1..859),gap(36),AAHY01215346.1:1..3525,gap(20),
CO   complement(AAHY01215347.1:1..1031),gap(1212),
CO   complement(AAHY01215348.1:1..4038),gap(272),AAHY01215349.1:1..16125,
CO   gap(227),complement(AAHY01215350.1:1..9051),gap(165),
CO   complement(AAHY01215351.1:1..14616),gap(213),AAHY01215352.1:1..10186,
CO   gap(127),AAHY01215353.1:1..2959,gap(20),AAHY01215354.1:1..4786,gap(265),
CO   AAHY01215355.1:1..1566,gap(20),AAHY01215356.1:1..2012,gap(1086),
CO   complement(AAHY01215357.1:1..3443),gap(714),AAHY01215358.1:1..2638,
CO   gap(619),complement(AAHY01215359.1:1..5608),gap(212),
CO   complement(AAHY01215360.1:1..5106),gap(20),
CO   complement(AAHY01215361.1:1..1622),gap(20),
CO   complement(AAHY01215362.1:1..2422),gap(20),AAHY01215363.1:1..2301,gap(20),
CO   AAHY01215364.1:1..1601,gap(64),AAHY01215365.1:1..1834,gap(20),
CO   complement(AAHY01215366.1:1..6485),gap(87),AAHY01215367.1:1..1096,gap(20),
CO   complement(AAHY01215368.1:1..1359),gap(893),
CO   complement(AAHY01215369.1:1..2123),gap(20),
CO   complement(AAHY01215370.1:1..10043),gap(20),AAHY01215371.1:1..1074,
CO   gap(615),complement(AAHY01215372.1:1..9967),gap(138),
CO   complement(AAHY01215373.1:1..8774),gap(298),
CO   complement(AAHY01215374.1:1..3152),gap(237),
CO   complement(AAHY01215375.1:1..2079),gap(904),AAHY01215376.1:1..3267,
CO   gap(340),complement(AAHY01215377.1:1..1805),gap(186),
CO   complement(AAHY01215378.1:1..7323),gap(433),
CO   complement(AAHY01215379.1:1..36848),gap(20),
CO   complement(AAHY01215380.1:1..1406),gap(1957),AAHY01215381.1:1..1875,
CO   gap(953),AAHY01215382.1:1..15907,gap(366),AAHY01215383.1:1..778,gap(1010),
CO   complement(AAHY01215384.1:1..5990),gap(529),AAHY01215385.1:1..12133,
CO   gap(419),AAHY01215386.1:1..9758,gap(902),
CO   complement(AAHY01215387.1:1..4939),gap(20),
CO   complement(AAHY01215388.1:1..2460),gap(20),
CO   complement(AAHY01215389.1:1..13223),gap(20),AAHY01215390.1:1..3420,
CO   gap(817),complement(AAHY01215391.1:1..29032),gap(20),
CO   complement(AAHY01215392.1:1..4887),gap(272),
CO   complement(AAHY01215393.1:1..1590),gap(20),
CO   complement(AAHY01215394.1:1..7027),gap(255),AAHY01215395.1:1..3704,gap(55),
CO   complement(AAHY01215396.1:1..902),gap(915),
CO   complement(AAHY01215397.1:1..4472),gap(120),
CO   complement(AAHY01215398.1:1..3440),gap(332),AAHY01215399.1:1..9738,
CO   gap(319),complement(AAHY01215400.1:1..22465),gap(643),
CO   AAHY01215401.1:1..1217,gap(131),AAHY01215402.1:1..4296,gap(119),
CO   complement(AAHY01215403.1:1..6818),gap(63),AAHY01215404.1:1..5409,gap(20),
CO   complement(AAHY01215405.1:1..1764),gap(188),
CO   complement(AAHY01215406.1:1..835),gap(138),
CO   complement(AAHY01215407.1:1..18054),gap(20),
CO   complement(AAHY01215408.1:1..20369),gap(20),
CO   complement(AAHY01215409.1:1..3054),gap(54),AAHY01215410.1:1..9362,gap(20),
CO   AAHY01215411.1:1..12247,gap(20),AAHY01215412.1:1..3788,gap(1637),
CO   AAHY01215413.1:1..5448,gap(74),AAHY01215414.1:1..7929,gap(20),
CO   AAHY01215415.1:1..6105,gap(20),AAHY01215416.1:1..19864,gap(20),
CO   complement(AAHY01215417.1:1..1644),gap(20),
CO   complement(AAHY01215418.1:1..1641),gap(334),
CO   complement(AAHY01215419.1:1..1052),gap(95),
CO   complement(AAHY01215420.1:1..8783),gap(20),AAHY01215421.1:1..5624,gap(20),
CO   complement(AAHY01215422.1:1..35863),gap(92),AAHY01215423.1:1..3210,
CO   gap(379),AAHY01215424.1:1..15301,gap(688),AAHY01215425.1:1..9987,gap(20),
CO   AAHY01215426.1:1..2525,gap(20),AAHY01215427.1:1..12307,gap(20),
CO   AAHY01215428.1:1..13264,gap(1053),AAHY01215429.1:1..2133,gap(20),
CO   complement(AAHY01215430.1:1..6197),gap(2867),
CO   complement(AAHY01215431.1:1..19169),gap(178),AAHY01215432.1:1..5966,
CO   gap(406),AAHY01215433.1:1..616,gap(318),AAHY01215434.1:1..11350,gap(1500),
CO   complement(AAHY01215435.1:1..7938),gap(118),
CO   complement(AAHY01215436.1:1..1108),gap(106),AAHY01215437.1:1..11529,
CO   gap(20),complement(AAHY01215438.1:1..4902),gap(20),
CO   complement(AAHY01215439.1:1..4116),gap(20),
CO   complement(AAHY01215440.1:1..5405),gap(20),
CO   complement(AAHY01215441.1:1..3756),gap(115),AAHY01215442.1:1..3199,
CO   gap(274),complement(AAHY01215443.1:1..1788),gap(20),
CO   complement(AAHY01215444.1:1..1707),gap(575),AAHY01215445.1:1..2256,
CO   gap(870),AAHY01215446.1:1..1301,gap(6599),
CO   complement(AAHY01215447.1:1..3119),gap(486),
CO   complement(AAHY01215448.1:1..39100),gap(20),AAHY01215449.1:1..1867,
CO   gap(668),complement(AAHY01215450.1:1..7434),gap(20),
CO   complement(AAHY01215451.1:1..4960),gap(20),
CO   complement(AAHY01215452.1:1..2391),gap(260),
CO   complement(AAHY01215453.1:1..2158),gap(69),
CO   complement(AAHY01215454.1:1..2635),gap(266),
CO   complement(AAHY01215455.1:1..11371),gap(103),
CO   complement(AAHY01215456.1:1..4824),gap(583),AAHY01215457.1:1..8432,gap(84),
CO   AAHY01215458.1:1..8297,gap(20),AAHY01215459.1:1..1345,gap(210),
CO   AAHY01215460.1:1..1765,gap(20),complement(AAHY01215461.1:1..3093),
CO   gap(1259),complement(AAHY01215462.1:1..2155),gap(387),
CO   complement(AAHY01215463.1:1..2187),gap(236),
CO   complement(AAHY01215464.1:1..2768),gap(120),AAHY01215465.1:1..2614,
CO   gap(138),complement(AAHY01215466.1:1..10895),gap(20),
CO   AAHY01215467.1:1..8823,gap(107),complement(AAHY01215468.1:1..7988),
CO   gap(829),complement(AAHY01215469.1:1..8303),gap(121),
CO   AAHY01215470.1:1..10598,gap(947),AAHY01215471.1:1..25503,gap(484),
CO   AAHY01215472.1:1..1476,gap(68),AAHY01215473.1:1..19908,gap(107),
CO   AAHY01215474.1:1..40205,gap(462),AAHY01215475.1:1..1410,gap(20),
CO   AAHY01215476.1:1..8156,gap(20),complement(AAHY01215477.1:1..17234),gap(20),
CO   AAHY01215478.1:1..2379,gap(80),AAHY01215479.1:1..23993,gap(20),
CO   AAHY01215480.1:1..11293,gap(408),complement(AAHY01215481.1:1..3621),
CO   gap(93),complement(AAHY01215482.1:1..8667),gap(768),AAHY01215483.1:1..1559,
CO   gap(64),AAHY01215484.1:1..12126,gap(630),AAHY01215485.1:1..5536,gap(20),
CO   complement(AAHY01215486.1:1..1195),gap(16809),AAHY01215487.1:1..4025,
CO   gap(44),AAHY01215488.1:1..3228,gap(236),complement(AAHY01215489.1:1..3381),
CO   gap(20),complement(AAHY01215490.1:1..7544),gap(59),AAHY01215491.1:1..3246,
CO   gap(68),complement(AAHY01215492.1:1..2349),gap(2097),
CO   complement(AAHY01215493.1:1..10813),gap(664),AAHY01215494.1:1..22612,
CO   gap(456),AAHY01215495.1:1..3732,gap(20),complement(AAHY01215496.1:1..7978),
CO   gap(20),complement(AAHY01215497.1:1..3823),gap(20),
CO   complement(AAHY01215498.1:1..4922),gap(25),AAHY01215499.1:1..9866,gap(283),
CO   AAHY01215500.1:1..1360,gap(308),AAHY01215501.1:1..1009,gap(491),
CO   complement(AAHY01215502.1:1..32557),gap(222),
CO   complement(AAHY01215503.1:1..12303),gap(20),
CO   complement(AAHY01215504.1:1..5322),gap(16006),
CO   complement(AAHY01215505.1:1..2728),gap(666),
CO   complement(AAHY01215506.1:1..3949),gap(313),
CO   complement(AAHY01215507.1:1..774),gap(2011),
CO   complement(AAHY01215508.1:1..3844),gap(494),
CO   complement(AAHY01215509.1:1..9506),gap(20),
CO   complement(AAHY01215510.1:1..2648),gap(101),
CO   complement(AAHY01215511.1:1..6717),gap(20),
CO   complement(AAHY01215512.1:1..8879),gap(4516),AAHY01215513.1:1..1471,
CO   gap(20),complement(AAHY01215514.1:1..2088),gap(1521),
CO   AAHY01215515.1:1..2435,gap(608),AAHY01215516.1:1..1465,gap(492),
CO   complement(AAHY01215517.1:1..2546),gap(170),
CO   complement(AAHY01215518.1:1..2429),gap(20),
CO   complement(AAHY01215519.1:1..13564),gap(20),
CO   complement(AAHY01215520.1:1..13551),gap(158),
CO   complement(AAHY01215521.1:1..1653),gap(20),
CO   complement(AAHY01215522.1:1..2853),gap(20),
CO   complement(AAHY01215523.1:1..31228),gap(537),
CO   complement(AAHY01215524.1:1..1481),gap(5880),
CO   complement(AAHY01215525.1:1..4501),gap(1141),AAHY01215526.1:1..20188,
CO   gap(166),AAHY01215527.1:1..21016,gap(442),
CO   complement(AAHY01215528.1:1..2032),gap(38),
CO   complement(AAHY01215529.1:1..6668),gap(5462),AAHY01215530.1:1..3204,
CO   gap(1291),AAHY01215531.1:1..6589,gap(722),AAHY01215532.1:1..5282,gap(710),
CO   complement(AAHY01215533.1:1..6129),gap(156),
CO   complement(AAHY01215534.1:1..3002),gap(56),
CO   complement(AAHY01215535.1:1..1517),gap(81),
CO   complement(AAHY01215536.1:1..13668),gap(206),AAHY01215537.1:1..1230,
CO   gap(20),AAHY01215538.1:1..3524,gap(1105),AAHY01215539.1:1..11482,gap(841),
CO   complement(AAHY01215540.1:1..8014),gap(47),
CO   complement(AAHY01215541.1:1..7300),gap(283),AAHY01215542.1:1..2283,
CO   gap(277),AAHY01215543.1:1..2698,gap(20),AAHY01215544.1:1..6426,gap(421),
CO   AAHY01215545.1:1..10366,gap(401),AAHY01215546.1:1..25252,gap(149),
CO   AAHY01215547.1:1..1095,gap(62),complement(AAHY01215548.1:1..25173),gap(33),
CO   AAHY01215549.1:1..5249,gap(169),complement(AAHY01215550.1:1..4675),gap(20),
CO   complement(AAHY01215551.1:1..12678),gap(20),
CO   complement(AAHY01215552.1:1..2409),gap(220),AAHY01215553.1:1..12512,
CO   gap(117),complement(AAHY01215554.1:1..30682),gap(781),
CO   complement(AAHY01215555.1:1..2693),gap(2711),
CO   complement(AAHY01215556.1:1..1264),gap(207),
CO   complement(AAHY01215557.1:1..3552),gap(250),
CO   complement(AAHY01215558.1:1..1611),gap(350),AAHY01215559.1:1..1763,gap(20),
CO   complement(AAHY01215560.1:1..4193),gap(518),
CO   complement(AAHY01215561.1:1..1155),gap(1680),AAHY01215562.1:1..1253,
CO   gap(649),complement(AAHY01215563.1:1..8631),gap(82),
CO   complement(A