Dbfetch

ID   CH466563; SV 1; linear; genomic DNA; CON; MUS; 18610753 BP.
XX
AC   CH466563;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009832507 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-18610753
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-18610753
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 49247271eba48c41e5018aabc61d66c5.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000221.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000005583; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017756; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017778; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021537; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021565; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021569; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021573; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021575; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021579; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021583; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021587; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021589; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021591; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021600; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021604; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021608; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034152; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034575; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036123; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050708; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051098; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057649; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060969; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062382; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069170; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000093668; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020731; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020738; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020739; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020741; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020745; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020750; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020751; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020753; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020754; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020759; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020760; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020761; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020765; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020768; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020770; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020772; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020773; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020783; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020786; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020789; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020790; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020791; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020797; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020687; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020694; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020695; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020697; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020701; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020706; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020707; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020709; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020710; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020715; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020716; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020717; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020721; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020723; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020726; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020728; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020729; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020739; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020745; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020746; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020747; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020751; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020662; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020669; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020670; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020672; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020675; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020680; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020681; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020683; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020684; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020689; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020690; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020691; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020695; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020697; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020699; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020701; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020702; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020712; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020715; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020718; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020719; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020720; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020724; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020684; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020691; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020692; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020694; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020698; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020703; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020704; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020706; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020707; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020712; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020713; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020714; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020718; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020720; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020722; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020724; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020725; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020735; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020738; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020741; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020742; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020743; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020747; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032214; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020479; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020486; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020487; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020489; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020492; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020497; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020498; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020500; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020501; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020506; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020507; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020508; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020512; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020514; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020516; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020518; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020519; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020529; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020532; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020535; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020536; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020537; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020541; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021121; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021128; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021129; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021131; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021135; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021140; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021141; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021143; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021144; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021149; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021150; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021151; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021155; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021157; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021159; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021161; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021162; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021172; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021175; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021178; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021179; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021180; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021184; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019996; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020003; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020004; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020006; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020009; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020014; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020015; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020017; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020018; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020023; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020024; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020025; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020029; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020032; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020034; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020036; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020037; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020047; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020050; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020053; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020054; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020055; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020059; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031258; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020437; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020444; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020445; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020447; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020451; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020456; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020457; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020459; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020460; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020465; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020466; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020467; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020471; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020473; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020475; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020477; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020478; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020488; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020491; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020494; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020495; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020496; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020500; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020563; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020570; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020571; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020573; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020576; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020581; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020582; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020584; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020585; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020590; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020591; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020592; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020596; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020598; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020600; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020602; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020603; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020613; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020616; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020619; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020620; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020621; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020625; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020543; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020550; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020551; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020553; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020556; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020561; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020562; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020564; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020565; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020570; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020571; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020572; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020576; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020578; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020580; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020582; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020583; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020593; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020596; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020599; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020600; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020601; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020605; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032003; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020635; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020642; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020643; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020645; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020649; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020654; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020655; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020657; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020658; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020663; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020664; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020665; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020669; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020671; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020673; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020675; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020676; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020686; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020689; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020692; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020693; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020694; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020698; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032130; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020571; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020578; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020579; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020581; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020584; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020589; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020590; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020592; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020593; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020598; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020599; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020600; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020604; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020607; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020609; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020611; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020612; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020622; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020625; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020628; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020629; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020630; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020634; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021160; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021167; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021168; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021170; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021174; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021179; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021180; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021182; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021183; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021188; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021189; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021190; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021194; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021197; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021199; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021201; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021202; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021212; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021215; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021218; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021219; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021220; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021224; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019750; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019757; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019758; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019760; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019763; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019768; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019769; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019771; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019772; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019777; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019778; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019779; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019783; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019785; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019787; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019789; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019790; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019800; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019803; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019806; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019807; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019808; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019812; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020053; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020060; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020061; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020063; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020067; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020072; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020073; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020075; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020076; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020081; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020082; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020083; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020087; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020089; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020091; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020093; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020094; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020104; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020107; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020110; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020111; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020112; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020117; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031375; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000017900; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022009; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022048; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022053; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022057; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022082; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022091; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022095; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035934; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036208; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044081; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057598; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077337; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078764; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090860; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094434; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099384; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109565; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146749; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147566; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000175955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199450; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000223120; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037523; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037541; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037542; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037548; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037554; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037565; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037572; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037576; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037577; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037586; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037588; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037589; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037607; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037610; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037613; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037616; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037617; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037648; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037659; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037680; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037681; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037682; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037730; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0037467; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037485; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037486; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037492; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037498; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037511; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037518; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037522; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037523; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037532; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037534; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037535; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037553; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037555; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037559; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037562; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037563; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037592; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037624; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037625; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037626; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0037672; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0037433; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037451; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037452; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037458; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037463; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037476; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037483; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037488; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037489; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037498; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037500; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037501; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037520; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037522; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037524; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037527; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037528; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037557; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037568; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037589; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037590; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037591; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0037637; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037484; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037502; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037503; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037509; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037515; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037528; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037535; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037539; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037540; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037549; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037551; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037552; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037570; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037572; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037574; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037577; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037578; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037607; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037617; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037637; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037638; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037639; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037685; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083850; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037237; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037255; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037256; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037262; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037267; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037280; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037287; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037292; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037293; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037303; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037305; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037306; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037325; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037327; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037329; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037332; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037333; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037362; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037373; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037393; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037394; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037395; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037441; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0037944; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0037962; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0037963; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0037969; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0037975; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0037986; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0037993; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0037997; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0037999; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038007; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038009; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038010; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038028; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038030; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038032; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038035; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038036; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038066; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038077; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038096; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038097; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038098; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038144; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037188; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037207; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037208; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037216; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037221; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037232; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037239; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037244; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037245; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037255; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037257; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037259; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037278; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037282; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037285; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037288; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037289; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037320; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037332; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037354; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037355; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037356; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037402; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083938; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0037142; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037161; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037162; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037168; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037174; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037187; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037194; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037199; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037200; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037210; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037211; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037212; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037230; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037232; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037234; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037237; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037238; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037268; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037279; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037300; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037301; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037302; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0037347; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0037292; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037310; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037311; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037317; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037322; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037335; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037342; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037346; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037347; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037356; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037357; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037358; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037376; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037378; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037380; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037383; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037384; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037413; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037424; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037445; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037446; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037447; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0037493; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0037255; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037273; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037274; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037280; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037285; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037298; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037305; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037309; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037310; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037319; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037321; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037322; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037340; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037342; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037345; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037348; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037349; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037378; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037389; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037410; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037411; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037412; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0037458; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083404; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0037410; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037428; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037429; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037435; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037441; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037452; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037459; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037463; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037464; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037473; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037475; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037476; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037494; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037496; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037499; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037502; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037503; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037532; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037543; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037562; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037563; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037564; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0037610; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083565; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037250; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037268; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037269; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037275; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037280; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037292; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037299; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037303; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037304; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037313; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037315; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037317; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037335; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037338; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037341; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037344; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037345; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037372; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037383; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037404; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037405; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037406; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037449; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0037997; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038015; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038016; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038022; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038028; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038039; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038046; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038050; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038051; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038060; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038062; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038064; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038082; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038085; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038088; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038091; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038092; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038121; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038132; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038151; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038152; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038153; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038199; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036824; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036844; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036845; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036853; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036858; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036869; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036876; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036881; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036882; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036891; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036893; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036895; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036913; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036916; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036918; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036921; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036922; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036952; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036965; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036985; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036986; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036987; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037037; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036638; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036658; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036659; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036665; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036671; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036682; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036689; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036693; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036694; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036703; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036705; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036707; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036725; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036727; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036730; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036733; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036734; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036763; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036774; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036795; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036796; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036797; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036845; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082475; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..18610753
FT                   /organism="Mus musculus"
FT                   /chromosome="13"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    3555..4143
FT                   /estimated_length=589
FT                   /gap_type="unknown"
FT   assembly_gap    8172..8566
FT                   /estimated_length=395
FT                   /gap_type="unknown"
FT   assembly_gap    9438..12771
FT                   /estimated_length=3334
FT                   /gap_type="unknown"
FT   assembly_gap    18394..20355
FT                   /estimated_length=1962
FT                   /gap_type="unknown"
FT   assembly_gap    28403..29424
FT                   /estimated_length=1022
FT                   /gap_type="unknown"
FT   assembly_gap    30994..31324
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    35570..35589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36659..36678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40241..40566
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    60243..61591
FT                   /estimated_length=1349
FT                   /gap_type="unknown"
FT   assembly_gap    64709..65412
FT                   /estimated_length=704
FT                   /gap_type="unknown"
FT   gene            complement(67214..>88515)
FT                   /gene="Mtrr"
FT                   /locus_tag="mCG_2920"
FT                   /note="gene_id=mCG2920.2"
FT   mRNA            complement(join(67214..68863,70760..70942,71040..71132,
FT                   71550..71668,72510..72696,73382..73424,75202..75382,
FT                   76434..76522,77509..77662,79021..79143,81468..81840,
FT                   84040..84157,85974..86127,86985..87149,88450..88515))
FT                   /gene="Mtrr"
FT                   /locus_tag="mCG_2920"
FT                   /product="5-methyltetrahydrofolate-homocysteine
FT                   methyltransferase reductase, transcript variant mCT2387"
FT                   /note="gene_id=mCG2920.2 transcript_id=mCT2387.2 created on
FT                   23-SEP-2002"
FT   mRNA            complement(join(67705..68863,70760..70942,71040..71132,
FT                   71550..71668,72510..72696,73382..73424,75202..75382,
FT                   76434..76522,77509..77662,79021..79143,81468..81840,
FT                   84040..84157,85988..86127,86985..87149,88450..>88515))
FT                   /gene="Mtrr"
FT                   /locus_tag="mCG_2920"
FT                   /product="5-methyltetrahydrofolate-homocysteine
FT                   methyltransferase reductase, transcript variant mCT193518"
FT                   /note="gene_id=mCG2920.2 transcript_id=mCT193518.0 created
FT                   on 09-MAR-2004"
FT   gene            67711..68350
FT                   /locus_tag="mCG_1049937"
FT                   /note="gene_id=mCG1049937.1"
FT   mRNA            67711..68350
FT                   /locus_tag="mCG_1049937"
FT                   /product="mCG1049937"
FT                   /note="gene_id=mCG1049937.1 transcript_id=mCT167641.1
FT                   created on 23-SEP-2002"
FT   CDS             68095..68217
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049937"
FT                   /product="mCG1049937"
FT                   /note="gene_id=mCG1049937.1 transcript_id=mCT167641.1
FT                   protein_id=mCP54796.1"
FT                   /protein_id="EDL37005.1"
FT                   /translation="MQMPLSCKMVTLKVNMMKMAEYYIKYISKYISSCMKTFIL"
FT   CDS             complement(join(68719..68863,70760..70942,71040..71132,
FT                   71550..71668,72510..72696,73382..73424,75202..75382,
FT                   76434..76522,77509..77662,79021..79143,81468..81840,
FT                   84040..84157,85974..86127,86985..87113))
FT                   /codon_start=1
FT                   /gene="Mtrr"
FT                   /locus_tag="mCG_2920"
FT                   /product="5-methyltetrahydrofolate-homocysteine
FT                   methyltransferase reductase, isoform CRA_b"
FT                   /note="gene_id=mCG2920.2 transcript_id=mCT2387.2
FT                   protein_id=mCP14062.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C1A3"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="MGI:MGI:1891037"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C1A3"
FT                   /protein_id="EDL37004.1"
FT                   /translation="MRRFLLLYATQRGQAKAIAEEISEQAVSHGFSADLHCISESEKYD
FT                   LKTETGPLVMVVSTTGTGDPPDTARKFVKEIHNKTLPTDYFAHLRYGLLGLGDSEYTYF
FT                   CNGGKVIDKRLQELGAQRFYDTGHADDCVGLELVVEPWIDGLWAALTKHFKSLGGQENM
FT                   SDTLSRASDAPLSTAMKPELLHIQSQVELLRLEDVGERDSELREQNETNRGQQGRIEDF
FT                   DSSLVHSVPPLSQSSLSIPAVPPEYLEVHLQESLGQEENQASVPSGDPSFQVPISKAIR
FT                   LTTNDAVKSTLLLELDISKIEFSHQPGDSFNVTCPNSDREVEELLQRLQLADKRAHRVI
FT                   LKIKTDTKKKGAALPAHVPEGRSLQFILTWCLEIRAVPKKAFLRALAEHTSSATEKRRL
FT                   QELCSKQGAADYNRFIRDASVCLLDLLLTFPSCQPPLSLLLEHLPKLQPRPYSCASSSL
FT                   RHPDKLHFVFNIVEFPPSTTAASPRKGVCTGWLATLVAPFLQPNTDVSNADSGDTLAPE
FT                   IRISPRATNAFHLPEDPSAPIIMVGPGTGVAPFVGFLQHREKLQEQHPDGKFGAMWLFF
FT                   GCRHKDRDYLFREELRHFLKTGVLTHLKVSFSRDAAPDGEEAPAKYVQDNLQRHSQQVA
FT                   RTLLQENGYIYVCGDAKNMAKDVNDTLIGIISNEAGVDKLEAMKTLATLKQEKRYLQDI
FT                   WS"
FT   CDS             complement(join(68719..68863,70760..70942,71040..71132,
FT                   71550..71668,72510..72696,73382..73424,75202..75382,
FT                   76434..76522,77509..77662,79021..79143,81468..81840,
FT                   84040..84157,85988..>86093))
FT                   /codon_start=1
FT                   /gene="Mtrr"
FT                   /locus_tag="mCG_2920"
FT                   /product="5-methyltetrahydrofolate-homocysteine
FT                   methyltransferase reductase, isoform CRA_a"
FT                   /note="gene_id=mCG2920.2 transcript_id=mCT193518.0
FT                   protein_id=mCP114494.0 isoform=CRA_a"
FT                   /protein_id="EDL37003.1"
FT                   /translation="WLYLPRVQETHLTQPGSLLKKYTTRHSPRTILLTCGLGDSEYTYF
FT                   CNGGKVIDKRLQELGAQRFYDTGHADDCVGLELVVEPWIDGLWAALTKHFKSLGGQENM
FT                   SDTLSRASDAPLSTAMKPELLHIQSQVELLRLEDVGERDSELREQNETNRGQQGRIEDF
FT                   DSSLVHSVPPLSQSSLSIPAVPPEYLEVHLQESLGQEENQASVPSGDPSFQVPISKAIR
FT                   LTTNDAVKSTLLLELDISKIEFSHQPGDSFNVTCPNSDREVEELLQRLQLADKRAHRVI
FT                   LKIKTDTKKKGAALPAHVPEGRSLQFILTWCLEIRAVPKKAFLRALAEHTSSATEKRRL
FT                   QELCSKQGAADYNRFIRDASVCLLDLLLTFPSCQPPLSLLLEHLPKLQPRPYSCASSSL
FT                   RHPDKLHFVFNIVEFPPSTTAASPRKGVCTGWLATLVAPFLQPNTDVSNADSGDTLAPE
FT                   IRISPRATNAFHLPEDPSAPIIMVGPGTGVAPFVGFLQHREKLQEQHPDGKFGAMWLFF
FT                   GCRHKDRDYLFREELRHFLKTGVLTHLKVSFSRDAAPDGEEAPAKYVQDNLQRHSQQVA
FT                   RTLLQENGYIYVCGDAKNMAKDVNDTLIGIISNEAGVDKLEAMKTLATLKQEKRYLQDI
FT                   WS"
FT   gene            88628..98743
FT                   /gene="Fastkd3"
FT                   /locus_tag="mCG_2924"
FT                   /note="gene_id=mCG2924.2"
FT   mRNA            join(88628..88737,89942..91405,91584..91669,94071..94245,
FT                   95730..95799,96516..96630,98337..98743)
FT                   /gene="Fastkd3"
FT                   /locus_tag="mCG_2924"
FT                   /product="FAST kinase domains 3, transcript variant
FT                   mCT173760"
FT                   /note="gene_id=mCG2924.2 transcript_id=mCT173760.0 created
FT                   on 23-SEP-2002"
FT   mRNA            join(88628..88737,90539..90761,91584..91669,94071..94245,
FT                   95730..95799,96516..96630,98337..98743)
FT                   /gene="Fastkd3"
FT                   /locus_tag="mCG_2924"
FT                   /product="FAST kinase domains 3, transcript variant
FT                   mCT2382"
FT                   /note="gene_id=mCG2924.2 transcript_id=mCT2382.2 created on
FT                   23-SEP-2002"
FT   mRNA            join(<88649..88737,89942..91405,91584..91669,94071..94245,
FT                   95633..95799,96516..96630,98337..98743)
FT                   /gene="Fastkd3"
FT                   /locus_tag="mCG_2924"
FT                   /product="FAST kinase domains 3, transcript variant
FT                   mCT193525"
FT                   /note="gene_id=mCG2924.2 transcript_id=mCT193525.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<88656..88737,89942..91405,91584..91669,94071..94245,
FT                   95633..95646)
FT                   /codon_start=1
FT                   /gene="Fastkd3"
FT                   /locus_tag="mCG_2924"
FT                   /product="FAST kinase domains 3, isoform CRA_c"
FT                   /note="gene_id=mCG2924.2 transcript_id=mCT193525.0
FT                   protein_id=mCP114496.0 isoform=CRA_c"
FT                   /protein_id="EDL37008.1"
FT                   /translation="GAASVYGRSRGSEAPCLSCPGCGLEPLVTCCEFYGMAFITLRRAF
FT                   CHKSILWIPGAVVALKIHPASHAQKAVTDRLSVCFCSLQPELFRVRFHHAYCKNFHSEK
FT                   GNDFHPVGEPWSSQAQEWNQPGQSLQNEDEEMLFRRLSVFTSFEEVLSFISALDTLPVP
FT                   LAMAALLRICEIGRRDGEQRLPEGVLENRAFQALCLRCERDPSHLTSAGLVTALQSLLT
FT                   LLPADPQSSLMLSLVAECQRRLQRGNLEVHHLCVLGESLAMLQGASCETLKLVVRQLQS
FT                   KSVETFAPEEIASVYRILQACPEEVDKHQTFLNTLNNFSISVVPYLSPKSISHVLTALV
FT                   ALDQTHALPLLIKLGKYVVRYIPRFTNEELRKVLEAFVYFGHSDRFFTEALEQHVSALC
FT                   FSLDPAVASSVMGYCSRKRILSKPIFDVVSEIVVCQWDRLSPSQIAELIEPFGKLNYVP
FT                   PNAPALFRKVENVLCARLHHFPPKMLLRLLHSCALIERHPVNFMSKLFSPFFLQRLQGK
FT                   ESYLDRLSLAQLTQLFLTSVLECPFYKGPKLLPKYQVKSFLTPCCSLETPMDLHLYKSV
FT                   VIGLIDLLGSRLYFASKVLTPYYYTIASAL"
FT   mRNA            join(<88663..89005,89942..91405,91584..94245,95633..95799,
FT                   96516..96630,98337..98743)
FT                   /gene="Fastkd3"
FT                   /locus_tag="mCG_2924"
FT                   /product="FAST kinase domains 3, transcript variant
FT                   mCT193524"
FT                   /note="gene_id=mCG2924.2 transcript_id=mCT193524.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<88987..89005,89942..91405,91584..91732)
FT                   /codon_start=1
FT                   /gene="Fastkd3"
FT                   /locus_tag="mCG_2924"
FT                   /product="FAST kinase domains 3, isoform CRA_b"
FT                   /note="gene_id=mCG2924.2 transcript_id=mCT193524.0
FT                   protein_id=mCP114495.0 isoform=CRA_b"
FT                   /protein_id="EDL37007.1"
FT                   /translation="RSLSPSLTCCEFYGMAFITLRRAFCHKSILWIPGAVVALKIHPAS
FT                   HAQKAVTDRLSVCFCSLQPELFRVRFHHAYCKNFHSEKGNDFHPVGEPWSSQAQEWNQP
FT                   GQSLQNEDEEMLFRRLSVFTSFEEVLSFISALDTLPVPLAMAALLRICEIGRRDGEQRL
FT                   PEGVLENRAFQALCLRCERDPSHLTSAGLVTALQSLLTLLPADPQSSLMLSLVAECQRR
FT                   LQRGNLEVHHLCVLGESLAMLQGASCETLKLVVRQLQSKSVETFAPEEIASVYRILQAC
FT                   PEEVDKHQTFLNTLNNFSISVVPYLSPKSISHVLTALVALDQTHALPLLIKLGKYVVRY
FT                   IPRFTNEELRKVLEAFVYFGHSDRFFTEALEQHVSALCFSLDPAVASSVMGYCSRKRIL
FT                   SKPIFDVVSEIVVCQWDRLSPSQIAELIEPFGKLNYVPPNAPALFRKVENVLCARLHHF
FT                   PPKMLLRLLHSCALIERHPVNFMSKLFSPFFLQRLQGKESYLDRLSLAQLTQLFLTSVL
FT                   ECPFYKVRTETRVAWLMSPVCSSFVH"
FT   CDS             join(89965..91405,91584..91669,94071..94245,95730..95799,
FT                   96516..96630,98337..98435)
FT                   /codon_start=1
FT                   /gene="Fastkd3"
FT                   /locus_tag="mCG_2924"
FT                   /product="FAST kinase domains 3, isoform CRA_a"
FT                   /note="gene_id=mCG2924.2 transcript_id=mCT173760.0
FT                   protein_id=mCP96679.0 isoform=CRA_a"
FT                   /protein_id="EDL37006.1"
FT                   /translation="MAFITLRRAFCHKSILWIPGAVVALKIHPASHAQKAVTDRLSVCF
FT                   CSLQPELFRVRFHHAYCKNFHSEKGNDFHPVGEPWSSQAQEWNQPGQSLQNEDEEMLFR
FT                   RLSVFTSFEEVLSFISALDTLPVPLAMAALLRICEIGRRDGEQRLPEGVLENRAFQALC
FT                   LRCERDPSHLTSAGLVTALQSLLTLLPADPQSSLMLSLVAECQRRLQRGNLEVHHLCVL
FT                   GESLAMLQGASCETLKLVVRQLQSKSVETFAPEEIASVYRILQACPEEVDKHQTFLNTL
FT                   NNFSISVVPYLSPKSISHVLTALVALDQTHALPLLIKLGKYVVRYIPRFTNEELRKVLE
FT                   AFVYFGHSDRFFTEALEQHVSALCFSLDPAVASSVMGYCSRKRILSKPIFDVVSEIVVC
FT                   QWDRLSPSQIAELIEPFGKLNYVPPNAPALFRKVENVLCARLHHFPPKMLLRLLHSCAL
FT                   IERHPVNFMSKLFSPFFLQRLQGKESYLDRLSLAQLTQLFLTSVLECPFYKGPKLLPKY
FT                   QVKSFLTPCCSLETPMDLHLYKSVVIGLIDLLGSRLYFASKVLTPYYYTIDVEVKLDED
FT                   GFVLPCTVDEDIHKRVALCIDGPQRFCLDSKHLLGKEATKQRHLRLLGYQVVQLPYHEL
FT                   ELLTSRLELVDYLQRKLFSQSSTVHW"
FT   CDS             join(94140..94245,95730..95799,96516..96630,98337..98435)
FT                   /codon_start=1
FT                   /gene="Fastkd3"
FT                   /locus_tag="mCG_2924"
FT                   /product="FAST kinase domains 3, isoform CRA_d"
FT                   /note="gene_id=mCG2924.2 transcript_id=mCT2382.2
FT                   protein_id=mCP14087.2 isoform=CRA_d"
FT                   /protein_id="EDL37009.1"
FT                   /translation="MDLHLYKSVVIGLIDLLGSRLYFASKVLTPYYYTIDVEVKLDEDG
FT                   FVLPCTVDEDIHKRVALCIDGPQRFCLDSKHLLGKEATKQRHLRLLGYQVVQLPYHELE
FT                   LLTSRLELVDYLQRKLFSQSSTVHW"
FT   gene            103873..119120
FT                   /locus_tag="mCG_2926"
FT                   /note="gene_id=mCG2926.2"
FT   mRNA            join(103873..104164,117095..117211,118661..118871,
FT                   118956..119120)
FT                   /locus_tag="mCG_2926"
FT                   /product="mCG2926, transcript variant mCT2383"
FT                   /note="gene_id=mCG2926.2 transcript_id=mCT2383.1 created on
FT                   24-SEP-2002"
FT   mRNA            join(103874..104164,117095..117211,118661..119120)
FT                   /locus_tag="mCG_2926"
FT                   /product="mCG2926, transcript variant mCT173761"
FT                   /note="gene_id=mCG2926.2 transcript_id=mCT173761.0 created
FT                   on 24-SEP-2002"
FT   CDS             join(103913..104164,117095..117211,118661..118840)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2926"
FT                   /product="mCG2926, isoform CRA_a"
FT                   /note="gene_id=mCG2926.2 transcript_id=mCT173761.0
FT                   protein_id=mCP96680.0 isoform=CRA_a"
FT                   /protein_id="EDL37010.1"
FT                   /translation="MEELAKKERRAMDPGGLKKEGKVEEEAGKEEGREEEGGEEEEVTS
FT                   ETLRGKPRPLPISALPAFSYIPPRHQGPKERSYFSREGQTGIVSLYDCVFKRRLDYNQK
FT                   LHRDDREHAKNLGLHINEEEQERTVPVLMSSVYGKRINQPIEPLNRDYGHVSHVKTDFY
FT                   RKNEIPSIKGPGFGHINPA"
FT   CDS             join(103913..104164,117095..117211,118661..118840)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2926"
FT                   /product="mCG2926, isoform CRA_a"
FT                   /note="gene_id=mCG2926.2 transcript_id=mCT2383.1
FT                   protein_id=mCP14058.1 isoform=CRA_a"
FT                   /protein_id="EDL37011.1"
FT                   /translation="MEELAKKERRAMDPGGLKKEGKVEEEAGKEEGREEEGGEEEEVTS
FT                   ETLRGKPRPLPISALPAFSYIPPRHQGPKERSYFSREGQTGIVSLYDCVFKRRLDYNQK
FT                   LHRDDREHAKNLGLHINEEEQERTVPVLMSSVYGKRINQPIEPLNRDYGHVSHVKTDFY
FT                   RKNEIPSIKGPGFGHINPA"
FT   assembly_gap    106850..106869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    114292..115192
FT                   /estimated_length=901
FT                   /gap_type="unknown"
FT   assembly_gap    121858..122145
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   gene            complement(122965..508714)
FT                   /gene="Adcy2"
FT                   /locus_tag="mCG_2923"
FT                   /note="gene_id=mCG2923.2"
FT   mRNA            complement(join(122965..123783,128728..128852,
FT                   134434..134548,144179..144286,145929..146075,
FT                   155244..155402,160759..160843,171769..171938,
FT                   175199..175318,181784..181921,192559..192643,
FT                   219906..220003,222974..223043,230443..230523,
FT                   233987..234030,237465..237641,238881..239013,
FT                   239945..240103,242217..242344,244794..244905,
FT                   248584..248732,312679..312828,411885..412046,
FT                   491680..491877,508381..508714))
FT                   /gene="Adcy2"
FT                   /locus_tag="mCG_2923"
FT                   /product="adenylate cyclase 2"
FT                   /note="gene_id=mCG2923.2 transcript_id=mCT2381.2 created on
FT                   24-SEP-2002"
FT   CDS             complement(join(123631..123783,128728..128852,
FT                   134434..134548,144179..144286,145929..146075,
FT                   155244..155402,160759..160843,171769..171938,
FT                   175199..175318,181784..181921,192559..192643,
FT                   219906..220003,222974..223043,230443..230523,
FT                   233987..234030,237465..237641,238881..239013,
FT                   239945..240103,242217..242344,244794..244905,
FT                   248584..248732,312679..312828,411885..412046,
FT                   491680..491877,508381..508587))
FT                   /codon_start=1
FT                   /gene="Adcy2"
FT                   /locus_tag="mCG_2923"
FT                   /product="adenylate cyclase 2"
FT                   /note="gene_id=mCG2923.2 transcript_id=mCT2381.2
FT                   protein_id=mCP14076.2"
FT                   /protein_id="EDL37012.1"
FT                   /translation="MRRRRYLRDRAEAAAAAAAGGGEGLQRSRDWLYESYYCMSQQHPL
FT                   IVFLLLIVMGACLALLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKL
FT                   LRVFSLVIWICLVAMGYLFMCFGGTVSAWDQVSFFLFIIFVVYTMLPFNMRDAIIASVL
FT                   TSSSHTIVLSVYLSATPGAKEHLFWQILANVIIFICGNLAGAYHKHLMELALQQTYRDT
FT                   CNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLY
FT                   VKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCY
FT                   YCVSGLPISLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQK
FT                   WQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGEIRDPYLKQHLVK
FT                   TYFVINPKGERRSPQHLFRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTT
FT                   ENGKISTTDVPMGQHNFQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQ
FT                   RISLFFYNKNIEKEYRATALPAFKYYVTCACLIFLCIFIVQILVLPKTSILGFSFGAAF
FT                   LSLIFILFVCFAGQLLQCSKKASASLLWLLKSSGIIANRPWPRISLTIVTTAIILTMAV
FT                   FNMFFLSNSEETTLPTANASNANVSVPDNQTAILHARNLFFLPYFIYSCILGLISCSVF
FT                   LRVNYELKMLIMMVALVGYNIILLHTHAHVLDAYSQVLFQRPGIWKDLKTMGSVSLSIF
FT                   FITLLVLGRQSEYYCRLDFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARS
FT                   LKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPK
FT                   FSGVEKIKTIGSTYMAATGLSAVPSQEHAQEPERQYMHIGTMVEFAYALVGKLDAINKH
FT                   SFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLI
FT                   LQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNLAS"
FT   assembly_gap    128282..128301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    131940..132011
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    146698..146717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    199673..203190
FT                   /estimated_length=3518
FT                   /gap_type="unknown"
FT   assembly_gap    204345..204464
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    210452..210471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    211529..211548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    239714..239773
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    260564..260583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    261832..261851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    266052..266071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    270384..270403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    271753..272331
FT                   /estimated_length=579
FT                   /gap_type="unknown"
FT   assembly_gap    285484..286420
FT                   /estimated_length=937
FT                   /gap_type="unknown"
FT   assembly_gap    287142..288184
FT                   /estimated_length=1043
FT                   /gap_type="unknown"
FT   assembly_gap    296002..296021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    308817..308836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            326318..327048
FT                   /pseudo
FT                   /locus_tag="mCG_48818"
FT                   /note="gene_id=mCG48818.2"
FT   mRNA            326318..327048
FT                   /pseudo
FT                   /locus_tag="mCG_48818"
FT                   /note="gene_id=mCG48818.2 transcript_id=mCT49001.2 created
FT                   on 24-SEP-2002"
FT   assembly_gap    334831..334850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    336277..336296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    338182..338201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    339734..339753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    347089..347108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    363582..363609
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            378478..379643
FT                   /pseudo
FT                   /locus_tag="mCG_2921"
FT                   /note="gene_id=mCG2921.1"
FT   mRNA            378478..379643
FT                   /pseudo
FT                   /locus_tag="mCG_2921"
FT                   /note="gene_id=mCG2921.1 transcript_id=mCT2384.2 created on
FT                   24-SEP-2002"
FT   assembly_gap    390104..390123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    396368..396387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    397726..397745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    427603..430288
FT                   /estimated_length=2686
FT                   /gap_type="unknown"
FT   assembly_gap    508715..508875
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    522149..522168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    542267..542370
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    547442..548490
FT                   /estimated_length=1049
FT                   /gap_type="unknown"
FT   gene            complement(567143..578248)
FT                   /locus_tag="mCG_1049938"
FT                   /note="gene_id=mCG1049938.0"
FT   mRNA            complement(join(567143..567566,578162..578248))
FT                   /locus_tag="mCG_1049938"
FT                   /product="mCG1049938"
FT                   /note="gene_id=mCG1049938.0 transcript_id=mCT167642.0
FT                   created on 24-SEP-2002"
FT   CDS             complement(567410..567550)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049938"
FT                   /product="mCG1049938"
FT                   /note="gene_id=mCG1049938.0 transcript_id=mCT167642.0
FT                   protein_id=mCP54798.1"
FT                   /protein_id="EDL37013.1"
FT                   /translation="MWEEQYLTSQQAMEWTLKSAGRPVKRRIHLAVQNNCSEDHYRESD
FT                   I"
FT   assembly_gap    574390..574409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    575128..575524
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    579622..580121
FT                   /estimated_length=500
FT                   /gap_type="unknown"
FT   assembly_gap    588181..589678
FT                   /estimated_length=1498
FT                   /gap_type="unknown"
FT   assembly_gap    594168..594187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    597007..597120
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    628692..629061
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    629872..629891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    631947..631966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    639097..639263
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    649577..651495
FT                   /estimated_length=1919
FT                   /gap_type="unknown"
FT   assembly_gap    652599..652618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    653870..654201
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    655873..655928
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    669263..669282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    671149..671168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    724398..728609
FT                   /estimated_length=4212
FT                   /gap_type="unknown"
FT   assembly_gap    731642..736428
FT                   /estimated_length=4787
FT                   /gap_type="unknown"
FT   assembly_gap    747466..747600
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    753996..754054
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    758661..758680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    767363..767382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    787004..787495
FT                   /estimated_length=492
FT                   /gap_type="unknown"
FT   assembly_gap    804857..805064
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    813378..813455
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   gene            834060..835037
FT                   /pseudo
FT                   /locus_tag="mCG_2922"
FT                   /note="gene_id=mCG2922.2"
FT   mRNA            834060..835037
FT                   /pseudo
FT                   /locus_tag="mCG_2922"
FT                   /note="gene_id=mCG2922.2 transcript_id=mCT2380.2 created on
FT                   24-SEP-2002"
FT   assembly_gap    837188..837207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    857269..858377
FT                   /estimated_length=1109
FT                   /gap_type="unknown"
FT   assembly_gap    858989..859324
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    863302..868449
FT                   /estimated_length=5148
FT                   /gap_type="unknown"
FT   assembly_gap    892464..892526
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    905070..905089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    906986..907005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    915689..915963
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    925674..926232
FT                   /estimated_length=559
FT                   /gap_type="unknown"
FT   assembly_gap    938515..938534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    940256..940275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    941321..941340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    946401..946689
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    957325..957344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    958724..958975
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    981656..981747
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    988936..989030
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   gene            complement(989873..1025879)
FT                   /gene="Pols"
FT                   /locus_tag="mCG_141203"
FT                   /note="gene_id=mCG141203.0"
FT   mRNA            complement(join(989873..992036,992398..992562,
FT                   994117..994275,994835..995007,995564..995664,
FT                   996537..996663,998873..999086,1001455..1001583,
FT                   1002508..1002615,1004644..1004764,1006943..1006989,
FT                   1007758..1007881,1025428..1025879))
FT                   /gene="Pols"
FT                   /locus_tag="mCG_141203"
FT                   /product="polymerase (DNA directed) sigma"
FT                   /note="gene_id=mCG141203.0 transcript_id=mCT173755.0
FT                   created on 24-SEP-2002"
FT   CDS             complement(join(991842..992036,992398..992562,
FT                   994117..994275,994835..995007,995564..995664,
FT                   996537..996663,998873..999086,1001455..1001583,
FT                   1002508..1002615,1004644..1004764,1006943..1006989,
FT                   1007758..1007847))
FT                   /codon_start=1
FT                   /gene="Pols"
FT                   /locus_tag="mCG_141203"
FT                   /product="polymerase (DNA directed) sigma"
FT                   /note="gene_id=mCG141203.0 transcript_id=mCT173755.0
FT                   protein_id=mCP96674.0"
FT                   /db_xref="GOA:Q6PB75"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="MGI:MGI:2682295"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PB75"
FT                   /protein_id="EDL37014.1"
FT                   /translation="MSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPT
FT                   SDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDIS
FT                   FNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGGISSYSLILMAISF
FT                   LQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSG
FT                   YRPSMLCIEDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRDSESTL
FT                   GRIIKVTQEVIDYRRWIKEKWGSRILPSPDLDNRIKIKERITTCNGEQMQSREPSSPYT
FT                   QRLTLSLSSPQLLSSGSSASSVSSLSGSDIDSDTPPCTTPSVYQFSLQAPTTLMASLPT
FT                   ALPMPSSKPQPAASRTLIMTTNNQTRVTIPPPTLGVAPVPCRQAGVDGTTSLKAVHSVT
FT                   SPAIPSASPNPLSSPHLYHKQHNGMKLSMKGSHNHTQGGGYSSVGSGAVRPPVGNRGHH
FT                   QYNRTGWRRKKHAHTRDSLPVSLSR"
FT   assembly_gap    1006159..1006337
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   gene            1025660..1127155
FT                   /gene="Nsun2"
FT                   /locus_tag="mCG_7697"
FT                   /note="gene_id=mCG7697.1"
FT   mRNA            join(1025660..1025850,1103654..1103811,1104290..1104394,
FT                   1106767..1106872,1108761..1108832,1109461..1109545,
FT                   1110802..1110994,1112996..1113070,1114554..1114684,
FT                   1117860..1117933,1118418..1118548,1118942..1119038,
FT                   1120917..1121098,1121384..1121476,1122010..1122145,
FT                   1122617..1122697,1122914..1123052,1124664..1124703,
FT                   1125008..1127155)
FT                   /gene="Nsun2"
FT                   /locus_tag="mCG_7697"
FT                   /product="NOL1/NOP2/Sun domain family 2, transcript variant
FT                   mCT6755"
FT                   /note="gene_id=mCG7697.1 transcript_id=mCT6755.2 created on
FT                   24-SEP-2002"
FT   assembly_gap    1025880..1026654
FT                   /estimated_length=775
FT                   /gap_type="unknown"
FT   assembly_gap    1029345..1030370
FT                   /estimated_length=1026
FT                   /gap_type="unknown"
FT   gene            complement(1034893..1035742)
FT                   /gene="A530095I07Rik"
FT                   /locus_tag="mCG_1049942"
FT                   /note="gene_id=mCG1049942.1"
FT   mRNA            complement(join(1034893..1035288,1035426..1035742))
FT                   /gene="A530095I07Rik"
FT                   /locus_tag="mCG_1049942"
FT                   /product="RIKEN cDNA A530095I07"
FT                   /note="gene_id=mCG1049942.1 transcript_id=mCT167646.1
FT                   created on 24-SEP-2002"
FT   CDS             complement(1035499..1035720)
FT                   /codon_start=1
FT                   /gene="A530095I07Rik"
FT                   /locus_tag="mCG_1049942"
FT                   /product="RIKEN cDNA A530095I07"
FT                   /note="gene_id=mCG1049942.1 transcript_id=mCT167646.1
FT                   protein_id=mCP54812.1"
FT                   /protein_id="EDL37017.1"
FT                   /translation="MEEGLEESRWPRVAATNLSPFCGEFVILDTCLDYQDLGILLQGRA
FT                   HTQRGPELLCGTDTLLKAQMPPQCQLKA"
FT   assembly_gap    1046189..1046300
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    1058549..1058839
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   gene            complement(1066150..1104346)
FT                   /gene="Srd5a1"
FT                   /locus_tag="mCG_7698"
FT                   /note="gene_id=mCG7698.2"
FT   mRNA            complement(join(1066150..1067896,1077312..1077462,
FT                   1085606..1085707,1091368..1091534,1102322..1104346))
FT                   /gene="Srd5a1"
FT                   /locus_tag="mCG_7698"
FT                   /product="steroid 5 alpha-reductase 1"
FT                   /note="gene_id=mCG7698.2 transcript_id=mCT6754.2 created on
FT                   25-SEP-2002"
FT   CDS             complement(join(1067830..1067896,1077312..1077462,
FT                   1085606..1085707,1091368..1091534,1102322..1102602))
FT                   /codon_start=1
FT                   /gene="Srd5a1"
FT                   /locus_tag="mCG_7698"
FT                   /product="steroid 5 alpha-reductase 1"
FT                   /note="gene_id=mCG7698.2 transcript_id=mCT6754.2
FT                   protein_id=mCP14074.2"
FT                   /protein_id="EDL37018.1"
FT                   /translation="MELDELCLLDALVYLEGFLAFVAFVGLQMVGSSYGRYSSQWSGRR
FT                   VPARPAWFLQELPSMAWPLYECIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRG
FT                   GKPTLLFTFVLAFLFCTLNGYLQSRYLSQFAVYAEDWITHPCFLTGFALWLVGMVINIH
FT                   SDHILRNLRKPGDTGYKIPRGGLFEYVSSANYFGELVEWCGFALASWSLQGVVFALFTL
FT                   CALFTRARQHHQWYLEKFEDYPKTRKILIPFLL"
FT   assembly_gap    1069124..1069143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1075594..1075998
FT                   /estimated_length=405
FT                   /gap_type="unknown"
FT   assembly_gap    1083384..1083403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(1103369..1103541,1103654..1103811,1104290..1104394,
FT                   1106767..1106872,1108761..1108832,1109461..1109545,
FT                   1110802..1110994,1112996..1113070,1114554..1114684,
FT                   1117860..1117933,1118418..1118548,1118942..1119038,
FT                   1120917..1121098,1121384..1121476,1122010..1122145,
FT                   1122617..1122697,1122914..1123052,1124664..1124703,
FT                   1125008..1127155)
FT                   /gene="Nsun2"
FT                   /locus_tag="mCG_7697"
FT                   /product="NOL1/NOP2/Sun domain family 2, transcript variant
FT                   mCT173763"
FT                   /note="gene_id=mCG7697.1 transcript_id=mCT173763.0 created
FT                   on 24-SEP-2002"
FT   CDS             join(1103371..1103541,1103654..1103811,1104290..1104394,
FT                   1106767..1106872,1108761..1108832,1109461..1109545,
FT                   1110802..1110994,1112996..1113070,1114554..1114684,
FT                   1117860..1117933,1118418..1118548,1118942..1119038,
FT                   1120917..1121098,1121384..1121476,1122010..1122145,
FT                   1122617..1122697,1122914..1123052,1124664..1124703,
FT                   1125008..1125287)
FT                   /codon_start=1
FT                   /gene="Nsun2"
FT                   /locus_tag="mCG_7697"
FT                   /product="NOL1/NOP2/Sun domain family 2, isoform CRA_a"
FT                   /note="gene_id=mCG7697.1 transcript_id=mCT173763.0
FT                   protein_id=mCP96682.0 isoform=CRA_a"
FT                   /protein_id="EDL37015.1"
FT                   /translation="MQPEVQRACGLVGRCVRSACAAAWAMGRRARGRRFQQPPQPEGEE
FT                   DASDGGRKRGQAGWEGGYPEIVKENKLFEHYYQELKIVPEGEWDQFMESLREPLPATLR
FT                   ITGYKSHAKEILHCLKNKYFKELEDLEVDGQKVEVPQPLSWYPEELAWHTNLSRKILRK
FT                   SPLLAKFHQFLVSETESGNISRQEAVSMIPPLLLNVEPHHKILDMCAAPGSKTTQLIEM
FT                   LHADMSVPFPEGFVIANDVDNKRCYLLVHQAKRLSSPCIMVVNHDASSIPRLTVDVDGR
FT                   KEILFYDRILCDVPCSGDGTMRKNIDVWKKWTTLNSLQLHGLQLRIATRGAEQLAEGGR
FT                   MVYSTCSLNPVEDEAVIAALLEKSEGALELADVSAELPGLKWMPGVSQWKVMTRDGQWF
FT                   ADWHEVPQGRHTQIRPTMFPPTDLEKLQAMHLERCLRILPHHQNTGGFFVAVLVKKAPM
FT                   PWNKRQPKVQNKSAEAREPRVSSHVAATEGNPSDQSELESQMITGAGDLETAHNTENTE
FT                   SNEKKDGVCGPPPSKKMKLFGFKEDPFVFIPEDDPLFPPIEKFYALDPSFPRMNLLTRT
FT                   TEGKKRQLYMVSKELRNVLLNNSEKMKVINTGIKVWCRNNSGEEFDCAFRLAQEGIYTL
FT                   YPFINSRIITVSMEDVKTLLTQENPFFRKLSSEAYSQVKDLAKGSVVLKYEPDSANPDT
FT                   LQCPIVLCGWRGKASIRTFVPKNERLHYLRMMGLEVLGEKKKEGVILTNENAASPEQPG
FT                   DEDAKQTAQDPCVPDSVPGCDAAAAEPSR"
FT   CDS             join(1103756..1103811,1104290..1104394,1106767..1106872,
FT                   1108761..1108832,1109461..1109545,1110802..1110994,
FT                   1112996..1113070,1114554..1114684,1117860..1117933,
FT                   1118418..1118548,1118942..1119038,1120917..1121098,
FT                   1121384..1121476,1122010..1122145,1122617..1122697,
FT                   1122914..1123052,1124664..1124703,1125008..1125287)
FT                   /codon_start=1
FT                   /gene="Nsun2"
FT                   /locus_tag="mCG_7697"
FT                   /product="NOL1/NOP2/Sun domain family 2, isoform CRA_b"
FT                   /note="gene_id=mCG7697.1 transcript_id=mCT6755.2
FT                   protein_id=mCP14061.2 isoform=CRA_b"
FT                   /protein_id="EDL37016.1"
FT                   /translation="MESLREPLPATLRITGYKSHAKEILHCLKNKYFKELEDLEVDGQK
FT                   VEVPQPLSWYPEELAWHTNLSRKILRKSPLLAKFHQFLVSETESGNISRQEAVSMIPPL
FT                   LLNVEPHHKILDMCAAPGSKTTQLIEMLHADMSVPFPEGFVIANDVDNKRCYLLVHQAK
FT                   RLSSPCIMVVNHDASSIPRLTVDVDGRKEILFYDRILCDVPCSGDGTMRKNIDVWKKWT
FT                   TLNSLQLHGLQLRIATRGAEQLAEGGRMVYSTCSLNPVEDEAVIAALLEKSEGALELAD
FT                   VSAELPGLKWMPGVSQWKVMTRDGQWFADWHEVPQGRHTQIRPTMFPPTDLEKLQAMHL
FT                   ERCLRILPHHQNTGGFFVAVLVKKAPMPWNKRQPKVQNKSAEAREPRVSSHVAATEGNP
FT                   SDQSELESQMITGAGDLETAHNTENTESNEKKDGVCGPPPSKKMKLFGFKEDPFVFIPE
FT                   DDPLFPPIEKFYALDPSFPRMNLLTRTTEGKKRQLYMVSKELRNVLLNNSEKMKVINTG
FT                   IKVWCRNNSGEEFDCAFRLAQEGIYTLYPFINSRIITVSMEDVKTLLTQENPFFRKLSS
FT                   EAYSQVKDLAKGSVVLKYEPDSANPDTLQCPIVLCGWRGKASIRTFVPKNERLHYLRMM
FT                   GLEVLGEKKKEGVILTNENAASPEQPGDEDAKQTAQDPCVPDSVPGCDAAAAEPSR"
FT   assembly_gap    1111165..1111184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1124370..1124476
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    1142615..1142634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1153122..1153506
FT                   /pseudo
FT                   /locus_tag="mCG_1049887"
FT                   /note="gene_id=mCG1049887.1"
FT   mRNA            1153122..1153506
FT                   /pseudo
FT                   /locus_tag="mCG_1049887"
FT                   /note="gene_id=mCG1049887.1 transcript_id=mCT167591.1
FT                   created on 25-SEP-2002"
FT   gene            complement(1155876..1156905)
FT                   /pseudo
FT                   /locus_tag="mCG_141205"
FT                   /note="gene_id=mCG141205.0"
FT   mRNA            complement(join(1155876..1156042,1156151..1156228,
FT                   1156526..1156905))
FT                   /pseudo
FT                   /locus_tag="mCG_141205"
FT                   /note="gene_id=mCG141205.0 transcript_id=mCT173762.0
FT                   created on 25-SEP-2002"
FT   gene            complement(1159186..1159798)
FT                   /pseudo
FT                   /locus_tag="mCG_1049908"
FT                   /note="gene_id=mCG1049908.1"
FT   mRNA            complement(1159186..1159798)
FT                   /pseudo
FT                   /locus_tag="mCG_1049908"
FT                   /note="gene_id=mCG1049908.1 transcript_id=mCT167612.1
FT                   created on 25-SEP-2002"
FT   assembly_gap    1161393..1161486
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    1183294..1183563
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   gene            complement(1193887..1231232)
FT                   /locus_tag="mCG_7700"
FT                   /note="gene_id=mCG7700.2"
FT   mRNA            complement(join(1193887..1195226,1229611..1229974,
FT                   1230694..1231232))
FT                   /locus_tag="mCG_7700"
FT                   /product="mCG7700, transcript variant mCT6750"
FT                   /note="gene_id=mCG7700.2 transcript_id=mCT6750.2 created on
FT                   25-SEP-2002"
FT   mRNA            complement(join(1193887..1195226,1229611..1230021))
FT                   /locus_tag="mCG_7700"
FT                   /product="mCG7700, transcript variant mCT173764"
FT                   /note="gene_id=mCG7700.2 transcript_id=mCT173764.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(1195095..1195226,1229611..1229964))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7700"
FT                   /product="mCG7700, isoform CRA_a"
FT                   /note="gene_id=mCG7700.2 transcript_id=mCT173764.0
FT                   protein_id=mCP96683.0 isoform=CRA_a"
FT                   /protein_id="EDL37019.1"
FT                   /translation="MKELQDIARLSDRFISVELVNENLFDWNVKLHQVDKDSVLWQDMK
FT                   ETNTEFILLNLTFPDNFPFSPPFMRVLSPRLENGYVLDGGAICMELLTPRGWSSAYTVE
FT                   AVMRQFAASLVKGQGRICRKAGKSKKSFSRKEAEATFKSLVKTHEKYGWVTPPVSDG"
FT   CDS             complement(join(1195095..1195226,1229611..1229964))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7700"
FT                   /product="mCG7700, isoform CRA_a"
FT                   /note="gene_id=mCG7700.2 transcript_id=mCT6750.2
FT                   protein_id=mCP14081.2 isoform=CRA_a"
FT                   /protein_id="EDL37020.1"
FT                   /translation="MKELQDIARLSDRFISVELVNENLFDWNVKLHQVDKDSVLWQDMK
FT                   ETNTEFILLNLTFPDNFPFSPPFMRVLSPRLENGYVLDGGAICMELLTPRGWSSAYTVE
FT                   AVMRQFAASLVKGQGRICRKAGKSKKSFSRKEAEATFKSLVKTHEKYGWVTPPVSDG"
FT   assembly_gap    1206764..1206783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1213562..1213690
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    1230095..1230197
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    1251172..1251191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1256307..1256527
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   gene            complement(1261949..>1263102)
FT                   /locus_tag="mCG_1049943"
FT                   /note="gene_id=mCG1049943.0"
FT   mRNA            complement(join(1261949..1262641,1262871..>1263102))
FT                   /locus_tag="mCG_1049943"
FT                   /product="mCG1049943"
FT                   /note="gene_id=mCG1049943.0 transcript_id=mCT167647.0
FT                   created on 25-SEP-2002"
FT   CDS             complement(join(1262625..1262641,1262871..1263102))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049943"
FT                   /product="mCG1049943"
FT                   /note="gene_id=mCG1049943.0 transcript_id=mCT167647.0
FT                   protein_id=mCP54814.0"
FT                   /protein_id="EDL37021.1"
FT                   /translation="MTGRSVVHSEAGGRLRMCCLLHDLQVKLWAYKASVTPTKGLAMMR
FT                   LDPGQTEQMLGPVDVTWNGCHLQSSAASKVLQYSWSQ"
FT   assembly_gap    1262734..1262773
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    1263348..1264394
FT                   /estimated_length=1047
FT                   /gap_type="unknown"
FT   assembly_gap    1292310..1292361
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   gene            <1292953..1300166
FT                   /locus_tag="mCG_1049944"
FT                   /note="gene_id=mCG1049944.0"
FT   mRNA            join(<1292953..1293200,1300019..1300166)
FT                   /locus_tag="mCG_1049944"
FT                   /product="mCG1049944"
FT                   /note="gene_id=mCG1049944.0 transcript_id=mCT167648.0
FT                   created on 25-SEP-2002"
FT   CDS             <1292954..1293088
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049944"
FT                   /product="mCG1049944"
FT                   /note="gene_id=mCG1049944.0 transcript_id=mCT167648.0
FT                   protein_id=mCP54816.1"
FT                   /protein_id="EDL37022.1"
FT                   /translation="ASTGCSGTEWSGIQNHEVRVTQIQQGYLLQGSYSLQSKVHLGVY"
FT   assembly_gap    1297634..1297653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1301177..1307336
FT                   /gene="D13Wsu50e"
FT                   /locus_tag="mCG_7699"
FT                   /note="gene_id=mCG7699.1"
FT   mRNA            join(<1301177..1301275,1302849..1302932,1304937..1305039,
FT                   1306824..1307336)
FT                   /gene="D13Wsu50e"
FT                   /locus_tag="mCG_7699"
FT                   /product="DNA segment, Chr 13, Wayne State University 50,
FT                   expressed"
FT                   /note="gene_id=mCG7699.1 transcript_id=mCT6756.1 created on
FT                   24-JUL-2002"
FT   assembly_gap    1301276..1301295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<1302850..1302932,1304937..1305039,1306824..1306922)
FT                   /codon_start=1
FT                   /gene="D13Wsu50e"
FT                   /locus_tag="mCG_7699"
FT                   /product="DNA segment, Chr 13, Wayne State University 50,
FT                   expressed"
FT                   /note="gene_id=mCG7699.1 transcript_id=mCT6756.1
FT                   protein_id=mCP14080.2"
FT                   /protein_id="EDL37023.1"
FT                   /translation="NFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLE
FT                   RALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS"
FT   assembly_gap    1319763..1320031
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    1323380..1323973
FT                   /estimated_length=594
FT                   /gap_type="unknown"
FT   assembly_gap    1327053..1327222
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    1328420..1328439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1329785..1329804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1331442..1331461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1336475..1336494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1347318..1362510
FT                   /estimated_length=15193
FT                   /gap_type="unknown"
FT   assembly_gap    1366105..1370359
FT                   /estimated_length=4255
FT                   /gap_type="unknown"
FT   assembly_gap    1371923..1372044
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    1396524..1396835
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    1407356..1407375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1409013..1409032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1410739..1410758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1431606..1431888
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   gene            1443157..1446782
FT                   /locus_tag="mCG_1049945"
FT                   /note="gene_id=mCG1049945.1"
FT   mRNA            join(1443157..1443499,1444988..1446782)
FT                   /locus_tag="mCG_1049945"
FT                   /product="mCG1049945"
FT                   /note="gene_id=mCG1049945.1 transcript_id=mCT167649.1
FT                   created on 25-SEP-2002"
FT   CDS             1445017..1445259
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049945"
FT                   /product="mCG1049945"
FT                   /note="gene_id=mCG1049945.1 transcript_id=mCT167649.1
FT                   protein_id=mCP54642.1"
FT                   /protein_id="EDL37024.1"
FT                   /translation="MSQPMFEEEREAKPTLQMMCVSEGHPPVTQQHKVDDSTFPCDVFQ
FT                   HEFGSPLGWKRAGQTICRDPSQAGSGDANMSSSVR"
FT   assembly_gap    1482228..1482247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1489282..1493198
FT                   /estimated_length=3917
FT                   /gap_type="unknown"
FT   assembly_gap    1499988..1500007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1501072..1503754
FT                   /estimated_length=2683
FT                   /gap_type="unknown"
FT   assembly_gap    1505476..1505640
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    1506825..1506844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1508261..1508280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1509673..1509692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1511712..1513565
FT                   /estimated_length=1854
FT                   /gap_type="unknown"
FT   assembly_gap    1522543..1522769
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    1542439..1542458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1545376..1545684
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    1557341..1557384
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    1576157..1576339
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    1606237..1606256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1611314..1611333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1612366..1612385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1618404..1621669
FT                   /estimated_length=3266
FT                   /gap_type="unknown"
FT   assembly_gap    1623378..1623397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1628730..1628749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1676479..1676736
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    1682161..1682180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1722534..1737841
FT                   /locus_tag="mCG_62818"
FT                   /note="gene_id=mCG62818.1"
FT   mRNA            join(1722534..1722635,1723145..1723292,1734392..1734459,
FT                   1737653..1737841)
FT                   /locus_tag="mCG_62818"
FT                   /product="mCG62818"
FT                   /note="gene_id=mCG62818.1 transcript_id=mCT63001.1 created
FT                   on 25-SEP-2002"
FT   CDS             join(1723195..1723292,1734392..1734459,1737653..1737699)
FT                   /codon_start=1
FT                   /locus_tag="mCG_62818"
FT                   /product="mCG62818"
FT                   /note="gene_id=mCG62818.1 transcript_id=mCT63001.1
FT                   protein_id=mCP35226.2"
FT                   /protein_id="EDL37025.1"
FT                   /translation="MSMTGTADACWILQSKDILLKRSQLTTHRATLSHRRDSSVLGTRK
FT                   KVKESEENTQDERRRCLWKRTSSIL"
FT   assembly_gap    1734506..1734525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1790924..1791202
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    1795392..1795551
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    1818568..1818587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1832840..1833164
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    1840148..1840315
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    1852282..1852301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1858272..1858291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1876109..1877918
FT                   /estimated_length=1810
FT                   /gap_type="unknown"
FT   assembly_gap    1881060..1883765
FT                   /estimated_length=2706
FT                   /gap_type="unknown"
FT   assembly_gap    1917522..1917654
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    1936843..1936866
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    1949744..1949763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1972067..1972086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1975774..1975793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1994658..1995231
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   assembly_gap    2010188..2010734
FT                   /estimated_length=547
FT                   /gap_type="unknown"
FT   assembly_gap    2014067..2014086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2035044..2035063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2062576..2065462
FT                   /locus_tag="mCG_1049954"
FT                   /note="gene_id=mCG1049954.0"
FT   mRNA            join(2062576..2062708,2064126..2064289,2065077..2065462)
FT                   /locus_tag="mCG_1049954"
FT                   /product="mCG1049954"
FT                   /note="gene_id=mCG1049954.0 transcript_id=mCT167658.1
FT                   created on 25-SEP-2002"
FT   assembly_gap    2064722..2064741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             2065236..2065373
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049954"
FT                   /product="mCG1049954"
FT                   /note="gene_id=mCG1049954.0 transcript_id=mCT167658.1
FT                   protein_id=mCP54663.1"
FT                   /protein_id="EDL37026.1"
FT                   /translation="MEWISLTTLKSPTIFHRGNNEHTHHEELRSEESNTLTLRSLDSEI
FT                   "
FT   assembly_gap    2068911..2068973
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   gene            complement(2078123..>2094865)
FT                   /locus_tag="mCG_2901"
FT                   /note="gene_id=mCG2901.2"
FT   mRNA            complement(join(2078123..2079245,2082024..2082122,
FT                   2084276..2084382,2085606..2085796,2088554..2088714,
FT                   2090572..2090740,2091683..>2094865))
FT                   /locus_tag="mCG_2901"
FT                   /product="mCG2901, transcript variant mCT2462"
FT                   /note="gene_id=mCG2901.2 transcript_id=mCT2462.2 created on
FT                   14-FEB-2003"
FT   mRNA            complement(join(2078129..2079245,2082024..2082122,
FT                   2084276..2084382,2085606..2085796,2088554..2088714,
FT                   2090572..2090703,2091683..>2094865))
FT                   /locus_tag="mCG_2901"
FT                   /product="mCG2901, transcript variant mCT180442"
FT                   /note="gene_id=mCG2901.2 transcript_id=mCT180442.0 created
FT                   on 14-FEB-2003"
FT   CDS             complement(join(2079034..2079245,2082024..2082122,
FT                   2084276..2084382,2085606..2085796,2088554..2088714,
FT                   2090572..2090740,2091683..2094865))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2901"
FT                   /product="mCG2901, isoform CRA_b"
FT                   /note="gene_id=mCG2901.2 transcript_id=mCT2462.2
FT                   protein_id=mCP14066.2 isoform=CRA_b"
FT                   /protein_id="EDL37028.1"
FT                   /translation="MPSVSACVGDGDPIAQVPEQIADKETPSPEVSVSWRNPICDSPSD
FT                   SLLAENFSCSTDRKLPFSSEDNIFQCAMNEHLQQKPTKSPQTTQSGASRLEAGELLPSG
FT                   VTSGVFPAEQVPHGPHHQADTEAPVVARESHSAPQNASAPPVVPSRGPLRARVPTVPVC
FT                   PSSLSRAEEETQGTSQSSLPGASYCYTGIRERGEEDTEVEDEAVSCSEGEHEAEAVMGR
FT                   RQQEQAEDSHRPLGDPEAGVGEAGHPSDVGDLTSALEECNLSTLLYIDKLSTSEVVMVL
FT                   ESCQLGDYSSRVSASECASKGSLSEEMNTELRQSEISRKKCGKRLWEEKLLRASEEWAE
FT                   SEGDDSCGRTSCQHAQCPLEVPSDVLTKTGEELDTNPVDCGGTDTEHALLESTHHSQAA
FT                   EDLTEDALPEETSSPMPHTAELPDPSAVDGGGSSPLSSRSDPEHIQSSYEDEPNSGECL
FT                   SIGEEGLAEPGELLTLSSDSSTPPRLEQSSDCVAETAFRYQISAVTSEVISVLINKDQD
FT                   LVIEKGDNWTIISGVAISPGMEQVVLCDTLGDAASSQDQGGLDDGSMEKSPEASPSGPL
FT                   PQEPPCGGDLSGAQEDISSNGQSANFDKSRLRNRPVKPSIWIRSQIYDQTLETEKVASD
FT                   HTYYNWKLEPLGKNKPRSKISNKDQASKLAKTLVLNRGEVHLNEVPQPASGEGTNIKLP
FT                   RSQAQPIMAGTDRSTPTNCSPDTLSKIRQEVGPPLPPLLPPLIATPPRSSQTLSPLVPN
FT                   SGPSSRSSPAGHVSPLCEVPGPPVLSPWPEELQQASPLDPSPSPSTAAASGRIVSSPLQ
FT                   FCAATPKHALPVPGRLPSCAPGHAAVSGPQQENSVKILDTMYPELSARARTLSLLKGNM
FT                   QLSRGSTVDGKVLPGRVSALLGLKAITSTSTAFVLTGGSSGADGSQGKSQDSGVQQDAG
FT                   GKRTLAVSMLRSAKRLRLDNKSPEPDTREVTGEGVPEDPQGGSPLAEVVPAEEEQADVP
FT                   VCSAASLLRVNPREMAESYNIAITRALRKIAESSFDLLPVIRSHVYVGNISKKPVMRDQ
FT                   EKEVVYEFSTTNKHLGEYLLRSILSELKIQKTSLDHSYIHALCRVYVGICRQLGDLERA
FT                   RLFCYSLLKEDFPESEKLTLFIANMWREVFLSQSAISEAMQLVARQRARGEVLNCLRAF
FT                   LSWEKNAPIDVGIVVSKLLLTIQLCPKTEFQSSEEFGEDLSANIWEYIFAIDLLCCHQR
FT                   WIWTHDNIISKELWPVMDKWIKYRKGHSNIAYTPDVIVASVLRLIGRLGQLGLKEGFPT
FT                   AVKNISSVIGMFIQHAQDEDIPWGVQLAAVYALCDLSPSNPAEISKILEAWRTQTSNAI
FT                   PSAIVHCLEEVGSLSADGSAGCTSKGDSAP"
FT   assembly_gap    2087085..2087151
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   CDS             complement(join(2090698..2090703,2091683..2094865))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2901"
FT                   /product="mCG2901, isoform CRA_a"
FT                   /note="gene_id=mCG2901.2 transcript_id=mCT180442.0
FT                   protein_id=mCP103364.0 isoform=CRA_a"
FT                   /protein_id="EDL37027.1"
FT                   /translation="MPSVSACVGDGDPIAQVPEQIADKETPSPEVSVSWRNPICDSPSD
FT                   SLLAENFSCSTDRKLPFSSEDNIFQCAMNEHLQQKPTKSPQTTQSGASRLEAGELLPSG
FT                   VTSGVFPAEQVPHGPHHQADTEAPVVARESHSAPQNASAPPVVPSRGPLRARVPTVPVC
FT                   PSSLSRAEEETQGTSQSSLPGASYCYTGIRERGEEDTEVEDEAVSCSEGEHEAEAVMGR
FT                   RQQEQAEDSHRPLGDPEAGVGEAGHPSDVGDLTSALEECNLSTLLYIDKLSTSEVVMVL
FT                   ESCQLGDYSSRVSASECASKGSLSEEMNTELRQSEISRKKCGKRLWEEKLLRASEEWAE
FT                   SEGDDSCGRTSCQHAQCPLEVPSDVLTKTGEELDTNPVDCGGTDTEHALLESTHHSQAA
FT                   EDLTEDALPEETSSPMPHTAELPDPSAVDGGGSSPLSSRSDPEHIQSSYEDEPNSGECL
FT                   SIGEEGLAEPGELLTLSSDSSTPPRLEQSSDCVAETAFRYQISAVTSEVISVLINKDQD
FT                   LVIEKGDNWTIISGVAISPGMEQVVLCDTLGDAASSQDQGGLDDGSMEKSPEASPSGPL
FT                   PQEPPCGGDLSGAQEDISSNGQSANFDKSRLRNRPVKPSIWIRSQIYDQTLETEKVASD
FT                   HTYYNWKLEPLGKNKPRSKISNKDQASKLAKTLVLNRGEVHLNEVPQPASGEGTNIKLP
FT                   RSQAQPIMAGTDRSTPTNCSPDTLSKIRQEVGPPLPPLLPPLIATPPRSSQTLSPLVPN
FT                   SGPSSRSSPAGHVSPLCEVPGPPVLSPWPEELQQASPLDPSPSPSTAAASGRIVSSPLQ
FT                   FCAATPKHALPVPGRLPSCAPGHAAVSGPQQENSVKILDTMYPELSARARTLSLLKGNM
FT                   QLSRGSTVDGKVLPGRVSALLGLKAITSTSTAFVLTGGSSGADGSQGKSQDSGVQQDAG
FT                   GKRTLAVSMLRSAKRLRLDNKSPEPDTREVTGEGVPEDPQGGSPLAEVVPAEEEQADVP
FT                   VCSAASLLRVNPREMAESYNIAITRALRKIAESSFDLLPVIRSHVYVGNISKKPVMRDQ
FT                   EKEVVYEFSTTNKS"
FT   gene            complement(<2096260..2098323)
FT                   /locus_tag="mCG_1049955"
FT                   /note="gene_id=mCG1049955.1"
FT   mRNA            complement(join(<2096260..2096380,2097814..2098056,
FT                   2098280..2098323))
FT                   /locus_tag="mCG_1049955"
FT                   /product="mCG1049955"
FT                   /note="gene_id=mCG1049955.1 transcript_id=mCT167659.1
FT                   created on 26-SEP-2002"
FT   CDS             complement(join(<2096260..2096380,2097814..2097938))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049955"
FT                   /product="mCG1049955"
FT                   /note="gene_id=mCG1049955.1 transcript_id=mCT167659.1
FT                   protein_id=mCP54667.1"
FT                   /protein_id="EDL37029.1"
FT                   /translation="MSNIADPPPRSISALGISSNVYMLFVPLRRLGLHFYSRHLVRNPS
FT                   LESSRIPAIVTLSHRETLWNQLWKITQQSHGLILTCL"
FT   assembly_gap    2108306..2108350
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    2114339..2114536
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   gene            complement(2140955..2145597)
FT                   /locus_tag="mCG_61372"
FT                   /note="gene_id=mCG61372.2"
FT   mRNA            complement(join(2140955..2141193,2144649..2144695,
FT                   2145267..2145597))
FT                   /locus_tag="mCG_61372"
FT                   /product="mCG61372"
FT                   /note="gene_id=mCG61372.2 transcript_id=mCT61555.2 created
FT                   on 26-SEP-2002"
FT   CDS             complement(join(2141129..2141193,2144649..2144695,
FT                   2145267..2145556))
FT                   /codon_start=1
FT                   /locus_tag="mCG_61372"
FT                   /product="mCG61372"
FT                   /note="gene_id=mCG61372.2 transcript_id=mCT61555.2
FT                   protein_id=mCP35221.2"
FT                   /protein_id="EDL37030.1"
FT                   /translation="MDWILFALVKSKICELNLLRGEHDPVLVTLQSPRGKQAPQCFALR
FT                   DSRAVSQHTYPLVWGKTSETQVETKRFYATQDMRGYRMLQRKEFHTILEGCAGRKSWAA
FT                   SPEVKVSLEPKTTSPGMTPPTIMDGALPS"
FT   assembly_gap    2147130..2147149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2149081..2149118
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    2152717..2152866
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    2158358..2158377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2161206..2161225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2162566..2162585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2165082..2165101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2166809..2170888)
FT                   /locus_tag="mCG_1049958"
FT                   /note="gene_id=mCG1049958.0"
FT   mRNA            complement(join(2166809..2167195,2169379..2169460,
FT                   2170731..2170888))
FT                   /locus_tag="mCG_1049958"
FT                   /product="mCG1049958"
FT                   /note="gene_id=mCG1049958.0 transcript_id=mCT167662.0
FT                   created on 26-SEP-2002"
FT   CDS             complement(2166943..2167137)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049958"
FT                   /product="mCG1049958"
FT                   /note="gene_id=mCG1049958.0 transcript_id=mCT167662.0
FT                   protein_id=mCP54800.1"
FT                   /protein_id="EDL37031.1"
FT                   /translation="MWRKPRGPGKMCMLSRRWEPIPNHPGSLRTSVISNMFSRANERNS
FT                   QDSLFNLTQFVSKFAGAFP"
FT   assembly_gap    2174058..2174077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2181015..2181034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2190036..2190055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2194077..2194096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2198296..2225275
FT                   /locus_tag="mCG_1049959"
FT                   /note="gene_id=mCG1049959.1"
FT   mRNA            join(2198296..2198478,2198608..2198767,2199914..2200081,
FT                   2203701..2203875,2224873..2225275)
FT                   /locus_tag="mCG_1049959"
FT                   /product="mCG1049959"
FT                   /note="gene_id=mCG1049959.1 transcript_id=mCT167663.1
FT                   created on 26-SEP-2002"
FT   CDS             join(2203749..2203875,2224873..2224958)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049959"
FT                   /product="mCG1049959"
FT                   /note="gene_id=mCG1049959.1 transcript_id=mCT167663.1
FT                   protein_id=mCP54801.1"
FT                   /protein_id="EDL37032.1"
FT                   /translation="METITETHTVQRTYDSALSHHNGYISVTDYESSHTSAGILGAGWA
FT                   LRIQHSLMDTETQPLASGFLVKPLI"
FT   assembly_gap    2204924..2205025
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   gene            complement(2219878..2334176)
FT                   /gene="Adamts16"
FT                   /locus_tag="mCG_145699"
FT                   /note="gene_id=mCG145699.0"
FT   mRNA            complement(join(2219878..2221035,2222160..2222307,
FT                   2227718..2227942,2230558..2230752,2230847..2231048,
FT                   2245504..2245630,2255735..2255873,2260114..2260358,
FT                   2260916..2261039,2262469..2262599,2264299..2264471,
FT                   2265197..2265345,2269705..2269800,2271836..2271989,
FT                   2279342..2279479,2284111..2284216,2285381..2285540,
FT                   2287765..2287848,2290351..2290550,2293297..2293558,
FT                   2328417..2328748,2333634..2333736,2333855..2334176))
FT                   /gene="Adamts16"
FT                   /locus_tag="mCG_145699"
FT                   /product="a disintegrin-like and metallopetidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 16,
FT                   transcript variant mCT185240"
FT                   /note="gene_id=mCG145699.0 transcript_id=mCT185240.0
FT                   created on 13-JUN-2003"
FT   mRNA            complement(join(2219878..2221035,2222160..2222307,
FT                   2227718..2227942,2230558..2230752,2230847..2231048,
FT                   2245504..2245630,2255735..2255873,2260114..2260358,
FT                   2260916..2261039,2262295..2262594,2264299..2264471,
FT                   2265197..2265345,2269705..2269800,2271836..2271989,
FT                   2279342..2279479,2284111..2284216,2285381..2285536,
FT                   2287765..2287848,2290351..2290550,2293297..2293558,
FT                   2328417..2328748,2333634..2333736,2333855..>2334141))
FT                   /gene="Adamts16"
FT                   /locus_tag="mCG_145699"
FT                   /product="a disintegrin-like and metallopetidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 16,
FT                   transcript variant mCT193526"
FT                   /note="gene_id=mCG145699.0 transcript_id=mCT193526.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(2220920..2221035,2222160..2222307,
FT                   2227718..2227942,2230558..2230752,2230847..2231048,
FT                   2245504..2245630,2255735..2255873,2260114..2260358,
FT                   2260916..2261039,2262469..2262599,2264299..2264471,
FT                   2265197..2265345,2269705..2269800,2271836..2271989,
FT                   2279342..2279479,2284111..2284216,2285381..2285540,
FT                   2287765..2287848,2290351..2290550,2293297..2293558,
FT                   2328417..2328748,2333634..2333736,2333855..2333914))
FT                   /codon_start=1
FT                   /gene="Adamts16"
FT                   /locus_tag="mCG_145699"
FT                   /product="a disintegrin-like and metallopetidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 16,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG145699.0 transcript_id=mCT185240.0
FT                   protein_id=mCP106498.0 isoform=CRA_a"
FT                   /protein_id="EDL37033.1"
FT                   /translation="MESRGCAALWVLLLAQVSEQQTPACALGLAAAASGSPEDPQPPPF
FT                   SGSSWLETGEYDLVSAYEVDHRGDYVSHDIMHYQRRRRRRAVTQPGGDALHLRLKGPRH
FT                   DLHLDLKAASNLMAPGFMVQTLGKGGTKSVQMFPPEENCFYQGSLRSQGNSSVALSTCQ
FT                   GLLGMIRTKDTDYFLKPLPPHLTSKLNRSAQGDSPSHVLYKRSTERQAPRENEVLMITR
FT                   KRDLARPHLHHDNFHLGPSQKQHFCGRRKKYMPQPPNDDLYILPDEYKPSSRHKRSLLK
FT                   SHRNEELNVETLVVVDRKMMQSHGHENITTYVLTILNMVSALFKDGTIGGNINIVIVGL
FT                   ILLEDEQPGLAISHHADHTLTSFCQWQSGLMGKDGTRHDHAILLTGLDICSWKNEPCDT
FT                   LGFAPISGMCSKYRSCTVNEDSGLGLAFTIAHESGHNFGMVHDGEGNMCKKSEGNIMSP
FT                   TLAGRNGVFSWSSCSRQYLHKFLSTAQAICLADQPKPVKEYKYPEKLPGQLYDANTQCK
FT                   WQFGEKAKLCMLDFRKDICKALWCHRIGRKCETKFMPAAEGTLCGQDMWCRGGQCVKYG
FT                   DEGPKPTHGHWSDWSPWSPCSRTCGGGISHRDRLCTNPRPSHGGKFCQGSTRTLKLCNS
FT                   QRCPLDSVDFRAAQCAEYNSKRFRGWLYKWKPYTQLEDQDLCKLYCIAEGFDFFFSLSN
FT                   KVKDGTPCSEDSRNVCIDGMCERVGCDNVLGSDATEDSCGVCKGNNSDCVTHRGLYSKH
FT                   HSTNQYYHMVTIPSGARSIHIYETNISTSYISVRNSLKRYYLNGHWSVDWPGRYKFSGA
FT                   TFNYKRSYKEPENLTSPGPTNETLIVELLFQGRNPGVAWEFSLPRSGAKKTPAAQPSYS
FT                   WAIVRSECSVSCGGGKMNSKAGCYRDLKVPVNASFCNPKTRPVTGLVPCKVSPCPSSWS
FT                   VGNWSVCSRTCGGGTQSRPVRCTRRAHYRDESIPASLCPQPEPPIHQACNSQSCPPAWS
FT                   TGPWAECSRTCGKGWRKRTVACKSTNPSARAQLLHDTACTSEPKPRTHEICLLKRCHKH
FT                   KKLQWLVSAWSQCSVTCQGGTQQRVLRCAEKYISGKYRELASKKCLHLPKPDLELERAC
FT                   GLIPCPKHPPFDASGSPRGSWFASPWSQCTASCGGGVQRRTVQCLLRGQPASDCFLHEK
FT                   PETSSACNTHFCPIAEKRGTFCKDLFHWCYLVPQHGMCGHRFYSKQCCNTCSKSNL"
FT   CDS             complement(join(2220920..2221035,2222160..2222307,
FT                   2227718..2227942,2230558..2230752,2230847..2231048,
FT                   2245504..2245630,2255735..2255873,2260114..2260358,
FT                   2260916..2261039,2262295..>2262315))
FT                   /codon_start=1
FT                   /gene="Adamts16"
FT                   /locus_tag="mCG_145699"
FT                   /product="a disintegrin-like and metallopetidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 16,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG145699.0 transcript_id=mCT193526.0
FT                   protein_id=mCP114490.0 isoform=CRA_b"
FT                   /protein_id="EDL37034.1"
FT                   /translation="WHCFVMERVGCDNVLGSDATEDSCGVCKGNNSDCVTHRGLYSKHH
FT                   STNQYYHMVTIPSGARSIHIYETNISTSYISVRNSLKRYYLNGHWSVDWPGRYKFSGAT
FT                   FNYKRSYKEPENLTSPGPTNETLIVELLFQGRNPGVAWEFSLPRSGAKKTPAAQPSYSW
FT                   AIVRSECSVSCGGGKMNSKAGCYRDLKVPVNASFCNPKTRPVTGLVPCKVSPCPSSWSV
FT                   GNWSVCSRTCGGGTQSRPVRCTRRAHYRDESIPASLCPQPEPPIHQACNSQSCPPAWST
FT                   GPWAECSRTCGKGWRKRTVACKSTNPSARAQLLHDTACTSEPKPRTHEICLLKRCHKHK
FT                   KLQWLVSAWSQCSVTCQGGTQQRVLRCAEKYISGKYRELASKKCLHLPKPDLELERACG
FT                   LIPCPKHPPFDASGSPRGSWFASPWSQCTASCGGGVQRRTVQCLLRGQPASDCFLHEKP
FT                   ETSSACNTHFCPIAEKRGTFCKDLFHWCYLVPQHGMCGHRFYSKQCCNTCSKSNL"
FT   assembly_gap    2238978..2239563
FT                   /estimated_length=586
FT                   /gap_type="unknown"
FT   mRNA            complement(join(2253640..2254096,2255735..2255873,
FT                   2260114..2260358,2260916..2261039,2262469..2262599,
FT                   2264299..2264471,2265197..2265345,2269705..2269800,
FT                   2271836..2271989,2279342..2279479,2284111..2284216,
FT                   2285381..2285540,2287765..2287848,2290351..2290550,
FT                   2293297..2293558,2328417..2328748,2333634..2333736,
FT                   2333855..2334176))
FT                   /gene="Adamts16"
FT                   /locus_tag="mCG_145699"
FT                   /product="a disintegrin-like and metallopetidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 16,
FT                   transcript variant mCT185241"
FT                   /note="gene_id=mCG145699.0 transcript_id=mCT185241.0
FT                   created on 13-JUN-2003"
FT   CDS             complement(join(2254050..2254096,2255735..2255873,
FT                   2260114..2260358,2260916..2261039,2262469..2262599,
FT                   2264299..2264471,2265197..2265345,2269705..2269800,
FT                   2271836..2271989,2279342..2279479,2284111..2284216,
FT                   2285381..2285540,2287765..2287848,2290351..2290550,
FT                   2293297..2293558,2328417..2328748,2333634..2333736,
FT                   2333855..2333914))
FT                   /codon_start=1
FT                   /gene="Adamts16"
FT                   /locus_tag="mCG_145699"
FT                   /product="a disintegrin-like and metallopetidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 16,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG145699.0 transcript_id=mCT185241.0
FT                   protein_id=mCP106499.0 isoform=CRA_c"
FT                   /protein_id="EDL37035.1"
FT                   /translation="MESRGCAALWVLLLAQVSEQQTPACALGLAAAASGSPEDPQPPPF
FT                   SGSSWLETGEYDLVSAYEVDHRGDYVSHDIMHYQRRRRRRAVTQPGGDALHLRLKGPRH
FT                   DLHLDLKAASNLMAPGFMVQTLGKGGTKSVQMFPPEENCFYQGSLRSQGNSSVALSTCQ
FT                   GLLGMIRTKDTDYFLKPLPPHLTSKLNRSAQGDSPSHVLYKRSTERQAPRENEVLMITR
FT                   KRDLARPHLHHDNFHLGPSQKQHFCGRRKKYMPQPPNDDLYILPDEYKPSSRHKRSLLK
FT                   SHRNEELNVETLVVVDRKMMQSHGHENITTYVLTILNMVSALFKDGTIGGNINIVIVGL
FT                   ILLEDEQPGLAISHHADHTLTSFCQWQSGLMGKDGTRHDHAILLTGLDICSWKNEPCDT
FT                   LGFAPISGMCSKYRSCTVNEDSGLGLAFTIAHESGHNFGMVHDGEGNMCKKSEGNIMSP
FT                   TLAGRNGVFSWSSCSRQYLHKFLSTAQAICLADQPKPVKEYKYPEKLPGQLYDANTQCK
FT                   WQFGEKAKLCMLDFRKDICKALWCHRIGRKCETKFMPAAEGTLCGQDMWCRGGQCVKYG
FT                   DEGPKPTHGHWSDWSPWSPCSRTCGGGISHRDRLCTNPRPSHGGKFCQGSTRTLKLCNS
FT                   QRCPLDSVDFRAAQCAEYNSKRFRGWLYKWKPYTQLEDQDLCKLYCIAEGFDFFFSLSN
FT                   KVKDGTPCSEDSRNVCIDGMCERVGCDNVLGSDATEDSCGVCKGNNSDCVTHRGLYSKH
FT                   HSTNQYYHMVTIPSGARSIHIYETNISTSYISVRNSLKRYYLNGHWSVDWPGRYKFSGA
FT                   TFNYKRSYKEPENLTSPGPTNETLIVELLFQGRNPGVAWEFSLPRSGAKKTPAAQPSYS
FT                   WAIVRSECSVSCGGDRQCQTGRGHLEISS"
FT   assembly_gap    2288069..2288197
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    2289676..2289982
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    2324466..2324505
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   gene            <2332815..2352153
FT                   /locus_tag="mCG_144963"
FT                   /note="gene_id=mCG144963.0"
FT   mRNA            join(<2332815..2332985,2337460..2337628,2348836..2348963,
FT                   2351092..2352153)
FT                   /locus_tag="mCG_144963"
FT                   /product="mCG144963"
FT                   /note="gene_id=mCG144963.0 transcript_id=mCT184387.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    2334270..2334296
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    2335968..2336109
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   CDS             join(<2337624..2337628,2348836..2348963,2351092..2351216)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144963"
FT                   /product="mCG144963"
FT                   /note="gene_id=mCG144963.0 transcript_id=mCT184387.0
FT                   protein_id=mCP105539.0"
FT                   /protein_id="EDL37036.1"
FT                   /translation="NGKQGNSVSYDSSWSCITASGEDKCRMRRKNIRRTQDPESQIGGY
FT                   GHMISTFSFIMAHLFADSEGSLHSSDEASMIAMHDLFNVL"
FT   assembly_gap    2345713..2346200
FT                   /estimated_length=488
FT                   /gap_type="unknown"
FT   assembly_gap    2355251..2355270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2375530..2377087
FT                   /locus_tag="mCG_54345"
FT                   /note="gene_id=mCG54345.1"
FT   mRNA            join(2375530..2375630,2375983..2376111,2376447..2377087)
FT                   /locus_tag="mCG_54345"
FT                   /product="mCG54345"
FT                   /note="gene_id=mCG54345.1 transcript_id=mCT54528.1 created
FT                   on 26-SEP-2002"
FT   CDS             join(2376060..2376111,2376447..2376823)
FT                   /codon_start=1
FT                   /locus_tag="mCG_54345"
FT                   /product="mCG54345"
FT                   /note="gene_id=mCG54345.1 transcript_id=mCT54528.1
FT                   protein_id=mCP35222.2"
FT                   /db_xref="GOA:Q9CX45"
FT                   /db_xref="MGI:MGI:1924416"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CX45"
FT                   /protein_id="EDL37037.1"
FT                   /translation="MLAPKHTARPLRQPQYRDFLSDFRLHHEQHCGPSPCWRSSGVWES
FT                   HAPACVVPEEEDFYDGQHLSLAAVSPAMRETHTQADELSRDNESMRREQMPWEGSSCRS
FT                   FSLADSQLQRRSRYSVLTQSCRRLPSESHCIFSRFQNR"
FT   assembly_gap    2384721..2384740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2387819..2387838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2395726..2395962
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    2399224..2399243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2404090..2404109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2419770..2420140
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    2421722..2421741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2444917..2445042
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    2454851..2454870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2457002..2458466
FT                   /estimated_length=1465
FT                   /gap_type="unknown"
FT   assembly_gap    2466987..2467202
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    2485655..2485674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2491789..2491962
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    2501586..2501605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2507292..2507916
FT                   /estimated_length=625
FT                   /gap_type="unknown"
FT   assembly_gap    2515031..2516969
FT                   /estimated_length=1939
FT                   /gap_type="unknown"
FT   assembly_gap    2559249..2559268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2564569..2564588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2584553..2584572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2590844..2591411
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   assembly_gap    2613999..2614018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2620091..2620169
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    2647342..2647373
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    2687340..2687359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2694220..2694239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2709995..2710014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2731252..2731271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2747067..2747086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2792801..2792820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2799955..2802581
FT                   /estimated_length=2627
FT                   /gap_type="unknown"
FT   assembly_gap    2804026..2806380
FT                   /estimated_length=2355
FT                   /gap_type="unknown"
FT   assembly_gap    2829061..2829080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2837868..2837887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2862829..2863847
FT                   /estimated_length=1019
FT                   /gap_type="unknown"
FT   assembly_gap    2872167..2872259
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    2876393..2876642
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    2887614..2887685
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    2888702..2888737
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    2905223..2906491
FT                   /estimated_length=1269
FT                   /gap_type="unknown"
FT   assembly_gap    2911839..2911875
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    2938689..2938708
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2956224..2993764)
FT                   /locus_tag="mCG_1049910"
FT                   /note="gene_id=mCG1049910.0"
FT   mRNA            complement(join(<2956224..2956830,2959056..2959128,
FT                   2960930..2961055,2993710..2993764))
FT                   /locus_tag="mCG_1049910"
FT                   /product="mCG1049910"
FT                   /note="gene_id=mCG1049910.0 transcript_id=mCT167614.0
FT                   created on 26-SEP-2002"
FT   CDS             complement(2956224..2956592)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049910"
FT                   /product="mCG1049910"
FT                   /note="gene_id=mCG1049910.0 transcript_id=mCT167614.0
FT                   protein_id=mCP54580.1"
FT                   /protein_id="EDL37038.1"
FT                   /translation="MAETSRKPLHQLEPMLKKSFSDSMYAPCHALICSLHEPCHGYTCP
FT                   LFEPCYAHACPLHVSCHGYKSSDFYVCTMSYTHMSSLCAMSCTHMPSACTMSHTHMSSA
FT                   CAMSCIHVLLCSHSFVLY"
FT   gene            2966665..3085210
FT                   /locus_tag="mCG_148281"
FT                   /note="gene_id=mCG148281.0"
FT   mRNA            join(2966665..2966778,3084976..3085210)
FT                   /locus_tag="mCG_148281"
FT                   /product="mCG148281"
FT                   /note="gene_id=mCG148281.0 transcript_id=mCT188544.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    2996232..2996251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3042467..3042486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3071336..3071626
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   CDS             3085093..3085200
FT                   /codon_start=1
FT                   /locus_tag="mCG_148281"
FT                   /product="mCG148281"
FT                   /note="gene_id=mCG148281.0 transcript_id=mCT188544.0
FT                   protein_id=mCP108257.0"
FT                   /protein_id="EDL37039.1"
FT                   /translation="MRPELVSCDNHQLSEAYSCVCAEWPLLDSVFNKQQ"
FT   assembly_gap    3096490..3096767
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   gene            complement(3097122..3097487)
FT                   /pseudo
FT                   /locus_tag="mCG_1049875"
FT                   /note="gene_id=mCG1049875.1"
FT   mRNA            complement(3097122..3097487)
FT                   /pseudo
FT                   /locus_tag="mCG_1049875"
FT                   /note="gene_id=mCG1049875.1 transcript_id=mCT167579.1
FT                   created on 26-SEP-2002"
FT   assembly_gap    3176160..3176179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3179446..3179630
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   gene            complement(3181500..>3429995)
FT                   /locus_tag="mCG_144965"
FT                   /note="gene_id=mCG144965.0"
FT   mRNA            complement(join(3181500..3183567,3186664..3186813,
FT                   3198073..3198118,3202220..3202295,3215408..3215648,
FT                   3257791..3257928,3284099..3284317,3429531..>3429995))
FT                   /locus_tag="mCG_144965"
FT                   /product="mCG144965"
FT                   /note="gene_id=mCG144965.0 transcript_id=mCT184389.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(3182534..>3182791)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144965"
FT                   /product="mCG144965"
FT                   /note="gene_id=mCG144965.0 transcript_id=mCT184389.0
FT                   protein_id=mCP105541.0"
FT                   /protein_id="EDL37040.1"
FT                   /translation="VWLITQINVSINVLKFLYVSICMCYFKLHIKSYFKMTFTFLWHIN
FT                   ICRYMCVFPQLISTSNTYVTRSFSRFKILQLNLCVLPLLG"
FT   assembly_gap    3202048..3202078
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    3211748..3211838
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    3285069..3285088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3304502..3304533
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    3307075..3307107
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    3334887..3335529
FT                   /estimated_length=643
FT                   /gap_type="unknown"
FT   assembly_gap    3354399..3356519
FT                   /estimated_length=2121
FT                   /gap_type="unknown"
FT   assembly_gap    3359477..3359771
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    3418389..3418408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3431395..3437534)
FT                   /gene="Irx1"
FT                   /locus_tag="mCG_2906"
FT                   /note="gene_id=mCG2906.2"
FT   mRNA            complement(join(3431395..3432010,3432344..3432443,
FT                   3432671..3432743,3433020..3434055,3436983..3437438,
FT                   3437478..3437534))
FT                   /gene="Irx1"
FT                   /locus_tag="mCG_2906"
FT                   /product="Iroquois related homeobox 1 (Drosophila)"
FT                   /note="gene_id=mCG2906.2 transcript_id=mCT2452.2 created on
FT                   26-SEP-2002"
FT   assembly_gap    3432269..3432288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(3432386..3432443,3432671..3432743,
FT                   3433020..3434055,3436983..3437258))
FT                   /codon_start=1
FT                   /gene="Irx1"
FT                   /locus_tag="mCG_2906"
FT                   /product="Iroquois related homeobox 1 (Drosophila)"
FT                   /note="gene_id=mCG2906.2 transcript_id=mCT2452.2
FT                   protein_id=mCP14084.1"
FT                   /db_xref="GOA:P81068"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR003893"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:1197515"
FT                   /db_xref="UniProtKB/Swiss-Prot:P81068"
FT                   /protein_id="EDL37041.1"
FT                   /translation="MSFPQLGYPQYLSAAGPGAYGGERPGVLAAAAAAAAAASSGRPGT
FT                   AELGAGAGAAAVTSVLGMYAAAGPYAGAPNYSAFLPYAADLSLFSQMGSQYELKDNPGV
FT                   HPATFAAHTTPAYYPYGQFQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIML
FT                   AIITKMTLTQVSTWFANARRRLKKENKVTWGARSKDQEDGALFGSDTEGDPEKAEDDEE
FT                   IDLESIDIDQIDERDGDQSNEDEEDKAEAPRARVAPPASARDQSSPLSAAETLKSQDSP
FT                   LGLVKEVSEPGSTRLLSPGAAAVGLQGAPHSKPKIWSLAETATSPDGAPKASPPPPSSH
FT                   ASAHGPPSGSPLQHPAFLPSHGLYTCHIGKFSNWTNGAFLAQGSLLNMRSFLGVSAPHA
FT                   APHGPHLTAPPPPQPPVQVATGVLHGEKASARSSPALPERDLVTRPDSPPQQLKSPFQP
FT                   VRDNSLAPQEGTPRILAALPSA"
FT   assembly_gap    3437452..3437471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3481968..3483181
FT                   /estimated_length=1214
FT                   /gap_type="unknown"
FT   assembly_gap    3508587..3508764
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    3513204..3515224
FT                   /estimated_length=2021
FT                   /gap_type="unknown"
FT   assembly_gap    3520897..3521166
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    3553247..3553266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3561126..3561145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3569496..3569606
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    3593097..3593136
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    3593649..3593673
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    3602691..3602710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3606308..3606327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3662939..3663162
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    3672839..3672858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3678645..3678664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3700773..3700966
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    3730317..3730336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3772525..3772559
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    3798351..3799171
FT                   /estimated_length=821
FT                   /gap_type="unknown"
FT   gene            3822482..3822932
FT                   /pseudo
FT                   /locus_tag="mCG_51760"
FT                   /note="gene_id=mCG51760.2"
FT   mRNA            3822482..3822932
FT                   /pseudo
FT                   /locus_tag="mCG_51760"
FT                   /note="gene_id=mCG51760.2 transcript_id=mCT51943.2 created
FT                   on 27-SEP-2002"
FT   assembly_gap    3823657..3823923
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    3829005..3829064
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    3860183..3863613
FT                   /estimated_length=3431
FT                   /gap_type="unknown"
FT   assembly_gap    3870899..3871134
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    3909218..3909498
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    3921160..3921387
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    3926262..3926469
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   gene            complement(3927523..3928001)
FT                   /pseudo
FT                   /locus_tag="mCG_115491"
FT                   /note="gene_id=mCG115491.1"
FT   mRNA            complement(3927523..3928001)
FT                   /pseudo
FT                   /locus_tag="mCG_115491"
FT                   /note="gene_id=mCG115491.1 transcript_id=mCT116597.1
FT                   created on 27-SEP-2002"
FT   assembly_gap    3928002..3928413
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    4001685..4003298
FT                   /estimated_length=1614
FT                   /gap_type="unknown"
FT   assembly_gap    4062149..4062168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4085261..4086390
FT                   /estimated_length=1130
FT                   /gap_type="unknown"
FT   assembly_gap    4094334..4103489
FT                   /estimated_length=9156
FT                   /gap_type="unknown"
FT   gene            <4104592..4108214
FT                   /gene="Irx2"
FT                   /locus_tag="mCG_10027"
FT                   /note="gene_id=mCG10027.2"
FT   mRNA            join(<4104592..4104997,4105278..4105991,4106607..4106682,
FT                   4107285..4108214)
FT                   /gene="Irx2"
FT                   /locus_tag="mCG_10027"
FT                   /product="Iroquois related homeobox 2 (Drosophila)"
FT                   /note="gene_id=mCG10027.2 transcript_id=mCT10055.2 created
FT                   on 27-SEP-2002"
FT   CDS             join(<4104592..4104997,4105278..4105991,4106607..4106659)
FT                   /codon_start=1
FT                   /gene="Irx2"
FT                   /locus_tag="mCG_10027"
FT                   /product="Iroquois related homeobox 2 (Drosophila)"
FT                   /note="gene_id=mCG10027.2 transcript_id=mCT10055.2
FT                   protein_id=mCP14085.1"
FT                   /protein_id="EDL37042.1"
FT                   /translation="GSPYDTHTTGMTGAISYHPYGSAAYPYQLNDPAYRKNATRDATAT
FT                   LKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKSE
FT                   DEDEDEGDASRSKEESSDKAQDGTETSAEDEGISLHVDSLTDHSCSAESDGEKLPCRAG
FT                   DALCESGSECKDKFEDLEDEEDEEDECERDLAPPKPVTSSPLTGVEAPLLSPAPEAAPR
FT                   GGSGGKTPLGSRTSPGAPPPASKPKLWSLAEIATSDLKQPSLGPGCGPPGLPAAAAPAS
FT                   TGAPPGGSPYSASPLLGRHLYYTSPFYGNYTNYGNLNAALQGQGLLRYNTAASSPGETL
FT                   HAMPKAASDTGKAGSHSLESHYRPPGGGYEPKKDTSEGCAVVGAGVQTYL"
FT   assembly_gap    4136340..4136359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4153695..4154876
FT                   /estimated_length=1182
FT                   /gap_type="unknown"
FT   assembly_gap    4156133..4158074
FT                   /estimated_length=1942
FT                   /gap_type="unknown"
FT   assembly_gap    4190158..4190177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4194055..4194074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4226434..4227501
FT                   /estimated_length=1068
FT                   /gap_type="unknown"
FT   assembly_gap    4234279..4234978
FT                   /estimated_length=700
FT                   /gap_type="unknown"
FT   assembly_gap    4244849..4245128
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    4278351..4278705
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   gene            complement(4284230..>4291535)
FT                   /locus_tag="mCG_144964"
FT                   /note="gene_id=mCG144964.0"
FT   mRNA            complement(join(4284230..4284452,4285468..4285564,
FT                   4289449..4289553,4291375..>4291535))
FT                   /locus_tag="mCG_144964"
FT                   /product="mCG144964"
FT                   /note="gene_id=mCG144964.0 transcript_id=mCT184388.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    4284861..4284994
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   CDS             complement(join(4285477..4285564,4289449..>4289549))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144964"
FT                   /product="mCG144964"
FT                   /note="gene_id=mCG144964.0 transcript_id=mCT184388.0
FT                   protein_id=mCP105540.0"
FT                   /protein_id="EDL37043.1"
FT                   /translation="PGVVPERQTVGKLRQAVSGTRAGSGEARAGAPRRPECLSYTGQSW
FT                   ASREQRIQKVRLDHSLR"
FT   assembly_gap    4290250..4290302
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    4296162..4296302
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    4319430..4319531
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    4330741..4330760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4337859..4337945
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    4390576..4390635
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    4391635..4391710
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    4401342..4401361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4444283..4444302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4446431..4446519
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    4459039..4459269
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    4460031..4460050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4480972..4480991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4558882..4558915
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    4562281..4562688
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    4598776..4603064
FT                   /estimated_length=4289
FT                   /gap_type="unknown"
FT   assembly_gap    4614281..4614376
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    4627590..4627628
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   gene            complement(4680555..>4703400)
FT                   /locus_tag="mCG_58131"
FT                   /note="gene_id=mCG58131.1"
FT   mRNA            complement(join(4680555..4680742,4685026..4685173,
FT                   4703193..>4703400))
FT                   /locus_tag="mCG_58131"
FT                   /product="mCG58131"
FT                   /note="gene_id=mCG58131.1 transcript_id=mCT58314.1 created
FT                   on 29-JUL-2003"
FT   CDS             complement(join(4685144..4685173,4703193..>4703399))
FT                   /codon_start=1
FT                   /locus_tag="mCG_58131"
FT                   /product="mCG58131"
FT                   /note="gene_id=mCG58131.1 transcript_id=mCT58314.1
FT                   protein_id=mCP35259.1"
FT                   /protein_id="EDL37044.1"
FT                   /translation="KSSNSVNKQASKMNRQLSKDETNGQRHMKNVQSLVLKDVQIKSHT
FT                   EIPSYPSQNDSHTKEHMLLSVWAKASPSWESSR"
FT   gene            4707695..4708037
FT                   /pseudo
FT                   /locus_tag="mCG_1049889"
FT                   /note="gene_id=mCG1049889.1"
FT   mRNA            4707695..4708037
FT                   /pseudo
FT                   /locus_tag="mCG_1049889"
FT                   /note="gene_id=mCG1049889.1 transcript_id=mCT167593.1
FT                   created on 22-JUL-2003"
FT   gene            4734807..4743999
FT                   /gene="Irx4"
FT                   /locus_tag="mCG_10022"
FT                   /note="gene_id=mCG10022.3"
FT   mRNA            join(4734807..4735182,4739154..4739285,4739764..4740015,
FT                   4741002..4741114,4741910..4742238,4742632..4743999)
FT                   /gene="Irx4"
FT                   /locus_tag="mCG_10022"
FT                   /product="Iroquois related homeobox 4 (Drosophila)"
FT                   /note="gene_id=mCG10022.3 transcript_id=mCT10049.3 created
FT                   on 22-JUL-2003"
FT   CDS             join(4739241..4739285,4739764..4740015,4741002..4741114,
FT                   4741910..4742238,4742632..4743440)
FT                   /codon_start=1
FT                   /gene="Irx4"
FT                   /locus_tag="mCG_10022"
FT                   /product="Iroquois related homeobox 4 (Drosophila)"
FT                   /note="gene_id=mCG10022.3 transcript_id=mCT10049.3
FT                   protein_id=mCP14097.2"
FT                   /db_xref="GOA:Q9QY61"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR003893"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:1355275"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QY61"
FT                   /protein_id="EDL37045.1"
FT                   /translation="MSYPQFGYPYSSAPQFLMTTNSLSTCCESGGRTLADSGPAASAQA
FT                   PVYCPVYESRLLATARHELNSAAALGVYGSPYGSSQGYGNYVTYGSEASAFYSLNSFES
FT                   KDGTGSSHAGLPPTAAAAYYPYEPALSQYPYDRYGTVDSGTRRKNATRETTSTLKAWLQ
FT                   EHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWPPRNKCADEKRPY
FT                   GEGEEEEAGEEESREEPLKSAKSEGHAGKDDKELELSDLEDFDPLDAETSECELKTPFQ
FT                   SLDSGPERIPASSDGPGTGKEASTTLRMPLGTAGGAVMDGDLERARNCLRSTVVVPDSG
FT                   AEGGPPACEAKLTFAQAGAPPNLETKPRIWSLAHTATAAAATALSQTEFPSCMLKRQGP
FT                   TGVSATTPASSPAVTAPSGALDRHQDSPVTSLRNWVDGVFHDPILRHSTLNQAWATAKG
FT                   ALLDPGPLGRNLGAGTNVLTTPLACSFPPTVPQDVPPAGASRELLATPKAGGKPFCT"
FT   assembly_gap    4740357..4740578
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    4752864..4753115
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    4771654..4771713
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   gene            4792285..4792598
FT                   /pseudo
FT                   /locus_tag="mCG_146413"
FT                   /note="gene_id=mCG146413.0"
FT   mRNA            4792285..4792598
FT                   /pseudo
FT                   /locus_tag="mCG_146413"
FT                   /note="gene_id=mCG146413.0 transcript_id=mCT186647.0
FT                   created on 23-JUL-2003"
FT   gene            complement(4794327..4802937)
FT                   /locus_tag="mCG_10028"
FT                   /note="gene_id=mCG10028.3"
FT   mRNA            complement(join(4794327..4794515,4794749..4794871,
FT                   4801871..4801924,4802794..4802937))
FT                   /locus_tag="mCG_10028"
FT                   /product="mCG10028, transcript variant mCT10052"
FT                   /note="gene_id=mCG10028.3 transcript_id=mCT10052.3 created
FT                   on 29-JUL-2003"
FT   mRNA            complement(join(4794327..4794515,4794749..4794871,
FT                   4801871..4801924,4802733..4802908))
FT                   /locus_tag="mCG_10028"
FT                   /product="mCG10028, transcript variant mCT174018"
FT                   /note="gene_id=mCG10028.3 transcript_id=mCT174018.1 created
FT                   on 29-JUL-2003"
FT   CDS             complement(join(4794450..4794515,4794749..4794871,
FT                   4801871..4801924,4802794..4802901))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10028"
FT                   /product="mCG10028, isoform CRA_a"
FT                   /note="gene_id=mCG10028.3 transcript_id=mCT10052.3
FT                   protein_id=mCP14093.2 isoform=CRA_a"
FT                   /protein_id="EDL37046.1"
FT                   /translation="MAAALTFRRLLTLPRAARGFGVQVSPSGEKITHTGQVYDEKDYRR
FT                   VRFVDRQKEVNENFAIDLIAQQPVNEVEHRIIACDGGGGALGHPKVYINLDKETKTGTC
FT                   GYCGLQFKQHHH"
FT   CDS             complement(4802755..4802901)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10028"
FT                   /product="mCG10028, isoform CRA_b"
FT                   /note="gene_id=mCG10028.3 transcript_id=mCT174018.1
FT                   protein_id=mCP96937.0 isoform=CRA_b"
FT                   /protein_id="EDL37047.1"
FT                   /translation="MAAALTFRRLLTLPRAARGFGVQVSPSGEKITHTGQVTAAPAMPG
FT                   TQD"
FT   gene            4805442..4806675
FT                   /gene="Mrpl36"
FT                   /locus_tag="mCG_10025"
FT                   /note="gene_id=mCG10025.4"
FT   mRNA            join(4805442..4805545,4805814..4806292,4806337..4806675)
FT                   /gene="Mrpl36"
FT                   /locus_tag="mCG_10025"
FT                   /product="mitochondrial ribosomal protein L36"
FT                   /note="gene_id=mCG10025.4 transcript_id=mCT10051.4 created
FT                   on 29-JUL-2003"
FT   CDS             4805827..4806135
FT                   /codon_start=1
FT                   /gene="Mrpl36"
FT                   /locus_tag="mCG_10025"
FT                   /product="mitochondrial ribosomal protein L36"
FT                   /note="gene_id=mCG10025.4 transcript_id=mCT10051.4
FT                   protein_id=mCP14075.2"
FT                   /protein_id="EDL37048.1"
FT                   /translation="MAALLVRSVVASVVDPFLHLSRLAVKPRVFSSFLLGTLPRAKPCA
FT                   EVRSVLCGRPLPTLLPSLGFKTKGVIKKRCKDCYKVKRRGRWFILCKTNPKHKQRQM"
FT   assembly_gap    4806293..4806312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4819160..>4821861)
FT                   /locus_tag="mCG_1049986"
FT                   /note="gene_id=mCG1049986.2"
FT   mRNA            complement(join(4819160..4819736,4820994..4821559,
FT                   4821717..>4821861))
FT                   /locus_tag="mCG_1049986"
FT                   /product="mCG1049986"
FT                   /note="gene_id=mCG1049986.2 transcript_id=mCT167690.2
FT                   created on 28-JUL-2003"
FT   CDS             complement(4821024..>4821263)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049986"
FT                   /product="mCG1049986"
FT                   /note="gene_id=mCG1049986.2 transcript_id=mCT167690.2
FT                   protein_id=mCP54706.1"
FT                   /protein_id="EDL37049.1"
FT                   /translation="KSHLIMLIEDFKKDINNSLKEVQENTSKQIEALKRKQKSLKEFQE
FT                   NTTEQMKELNKTIQDLKMEVETKRNHKGRHLPGF"
FT   assembly_gap    4840820..4840902
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    4872102..4872121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4919765..4919784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4922425..4922444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4937334..4937392
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   gene            4942032..4991219
FT                   /gene="Aytl2"
FT                   /locus_tag="mCG_10024"
FT                   /note="gene_id=mCG10024.3"
FT   mRNA            join(4942032..4942324,4959068..4959210,4963695..4963909,
FT                   4969610..4969722,4970988..4971048,4974107..4974165,
FT                   4976164..4976198,4977849..4977903,4980310..4980392,
FT                   4984804..4984929,4985656..4985809,4986108..4986206,
FT                   4988628..4988769,4989162..4991219)
FT                   /gene="Aytl2"
FT                   /locus_tag="mCG_10024"
FT                   /product="acyltransferase like 2, transcript variant
FT                   mCT10053"
FT                   /note="gene_id=mCG10024.3 transcript_id=mCT10053.3 created
FT                   on 23-JUL-2003"
FT   mRNA            join(4942032..4942324,4969610..4969722,4970988..4971048,
FT                   4974107..4974165,4976164..4976198,4977849..4977903,
FT                   4980310..4980392,4984804..4984929,4985656..4985809,
FT                   4986108..4986206,4988628..4988769,4989162..4991219)
FT                   /gene="Aytl2"
FT                   /locus_tag="mCG_10024"
FT                   /product="acyltransferase like 2, transcript variant
FT                   mCT174017"
FT                   /note="gene_id=mCG10024.3 transcript_id=mCT174017.1 created
FT                   on 23-JUL-2003"
FT   CDS             join(4942190..4942324,4959068..4959210,4963695..4963909,
FT                   4969610..4969722,4970988..4971048,4974107..4974165,
FT                   4976164..4976198,4977849..4977903,4980310..4980392,
FT                   4984804..4984929,4985656..4985809,4986108..4986206,
FT                   4988628..4988769,4989162..4989346)
FT                   /codon_start=1
FT                   /gene="Aytl2"
FT                   /locus_tag="mCG_10024"
FT                   /product="acyltransferase like 2, isoform CRA_a"
FT                   /note="gene_id=mCG10024.3 transcript_id=mCT10053.3
FT                   protein_id=mCP14065.1 isoform=CRA_a"
FT                   /protein_id="EDL37050.1"
FT                   /translation="MRLRGRGPRAAPSSSSGAGDARRLAPPGRNPFVHELRLSALQKAQ
FT                   VAFMTLTLFPIRLLFAAFMMLLAWPFALLASLGPPDKEPEQPLALWRKVVDFLLKAIMR
FT                   TMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIW
FT                   GTLIRYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKP
FT                   GAFIPGVPVQPVVLRYPNKLDTITWTWQGPGALKILWLTLCQFQNQVEIEFLPVYCPSE
FT                   EEKRNPALYASNVRRVMAKALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRG
FT                   LGLKPENLEKDLDKYSESARMKRGEKIRLPEFAAYLEVPVSDALEDMFSLFDESGGGEI
FT                   DLREYVVALSVVCRPSQTLATIQLAFKMYGSPEDGSIDEANLSCILKTALGVSELTVTD
FT                   LFQAIDQEDKGRITFDDFCGFAEMYPDYAEDYLYPDQTHFDSCAQTPPAPTPNGFCIDF
FT                   SPENSDFGRKNSCKKAD"
FT   CDS             join(4942190..4942324,4969610..4969615)
FT                   /codon_start=1
FT                   /gene="Aytl2"
FT                   /locus_tag="mCG_10024"
FT                   /product="acyltransferase like 2, isoform CRA_b"
FT                   /note="gene_id=mCG10024.3 transcript_id=mCT174017.1
FT                   protein_id=mCP96936.0 isoform=CRA_b"
FT                   /db_xref="GOA:D6RFA8"
FT                   /db_xref="MGI:MGI:2384812"
FT                   /db_xref="UniProtKB/TrEMBL:D6RFA8"
FT                   /protein_id="EDL37051.1"
FT                   /translation="MRLRGRGPRAAPSSSSGAGDARRLAPPGRNPFVHELRLSALQKAQ
FT                   L"
FT   mRNA            join(4946558..4946641,4959068..4959210,4963695..4963909,
FT                   4969610..4969722,4970988..4971048,4974107..4974165,
FT                   4976164..4976198,4977849..4977903,4980310..4980392,
FT                   4984804..4984929,4985656..4985809,4986108..4986206,
FT                   4988628..4988769,4989162..4991219)
FT                   /gene="Aytl2"
FT                   /locus_tag="mCG_10024"
FT                   /product="acyltransferase like 2, transcript variant
FT                   mCT186642"
FT                   /note="gene_id=mCG10024.3 transcript_id=mCT186642.0 created
FT                   on 23-JUL-2003"
FT   CDS             join(4959077..4959210,4963695..4963909,4969610..4969722,
FT                   4970988..4971048,4974107..4974165,4976164..4976198,
FT                   4977849..4977903,4980310..4980392,4984804..4984929,
FT                   4985656..4985809,4986108..4986206,4988628..4988769,
FT                   4989162..4989346)
FT                   /codon_start=1
FT                   /gene="Aytl2"
FT                   /locus_tag="mCG_10024"
FT                   /product="acyltransferase like 2, isoform CRA_c"
FT                   /note="gene_id=mCG10024.3 transcript_id=mCT186642.0
FT                   protein_id=mCP107881.0 isoform=CRA_c"
FT                   /protein_id="EDL37052.1"
FT                   /translation="MTLTLFPIRLLFAAFMMLLAWPFALLASLGPPDKEPEQPLALWRK
FT                   VVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVTMTMSSIV
FT                   MKAESRDIPIWGTLIRYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTC
FT                   TNRTCLITFKPGAFIPGVPVQPVVLRYPNKLDTITWTWQGPGALKILWLTLCQFQNQVE
FT                   IEFLPVYCPSEEEKRNPALYASNVRRVMAKALGVSVTDYTFEDCQLALAEGQLRLPADT
FT                   CLLEFARLVRGLGLKPENLEKDLDKYSESARMKRGEKIRLPEFAAYLEVPVSDALEDMF
FT                   SLFDESGGGEIDLREYVVALSVVCRPSQTLATIQLAFKMYGSPEDGSIDEANLSCILKT
FT                   ALGVSELTVTDLFQAIDQEDKGRITFDDFCGFAEMYPDYAEDYLYPDQTHFDSCAQTPP
FT                   APTPNGFCIDFSPENSDFGRKNSCKKAD"
FT   assembly_gap    4995258..4996432
FT                   /estimated_length=1175
FT                   /gap_type="unknown"
FT   gene            5012159..5054078
FT                   /gene="Slc6a3"
FT                   /locus_tag="mCG_10026"
FT                   /note="gene_id=mCG10026.3"
FT   mRNA            join(5012159..5012276,5013889..5014217,5016253..5016384,
FT                   5020089..5020320,5032450..5032588,5033558..5033692,
FT                   5036291..5036394,5037709..5037833,5041677..5041789,
FT                   5042920..5043048,5043591..5043690,5045274..5045374,
FT                   5046856..5047023,5048208..5048279,5052618..5054078)
FT                   /gene="Slc6a3"
FT                   /locus_tag="mCG_10026"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, dopamine), member 3"
FT                   /note="gene_id=mCG10026.3 transcript_id=mCT10054.3 created
FT                   on 23-JUL-2003"
FT   CDS             join(5013932..5014217,5016253..5016384,5020089..5020320,
FT                   5032450..5032588,5033558..5033692,5036291..5036394,
FT                   5037709..5037833,5041677..5041789,5042920..5043048,
FT                   5043591..5043690,5045274..5045374,5046856..5047023,
FT                   5048208..5048279,5052618..5052641)
FT                   /codon_start=1
FT                   /gene="Slc6a3"
FT                   /locus_tag="mCG_10026"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, dopamine), member 3"
FT                   /note="gene_id=mCG10026.3 transcript_id=mCT10054.3
FT                   protein_id=mCP14079.1"
FT                   /protein_id="EDL37053.1"
FT                   /translation="MSKSKCSVGPMSSVVAPAKEPNAVGPREVELILVKEQNGVQLTNS
FT                   TLINPPQTPVEVQERETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLL
FT                   FMVIAGMPLFYMELALGQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWA
FT                   LHYFFSSFTMDLPWIHCNNTWNSPNCSDAHSSNSSDGLGLNDTFGTTPAAEYFERGVLH
FT                   LHQSRGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLL
FT                   RGVTLPGAMDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNN
FT                   CYRDAIITTSINSLTSFSSGFVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIAT
FT                   LPLSSAWAAVFFLMLLTLGIDSAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLL
FT                   SLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNL
FT                   YWRLCWKLVSPCFLLYVVVVSIVTFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYAT
FT                   YKFCSLPGSFREKLAYAITPEKDRQLVDRGEVRQFTLRHWLLV"
FT   assembly_gap    5065555..5065985
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   gene            5079532..5096132
FT                   /gene="C130052I12Rik"
FT                   /locus_tag="mCG_10023"
FT                   /note="gene_id=mCG10023.3"
FT   mRNA            join(5079532..5079892,5080423..5080523,5081715..5081904,
FT                   5083213..5083361,5084397..5084475,5086637..5086754,
FT                   5087115..5087209,5087887..5087971,5089151..5089254,
FT                   5090100..5090165,5090666..5090716,5091456..5091538,
FT                   5092308..5092342,5093071..5093126,5093212..5093256,
FT                   5093895..5094010,5095526..5096132)
FT                   /gene="C130052I12Rik"
FT                   /locus_tag="mCG_10023"
FT                   /product="RIKEN cDNA C130052I12"
FT                   /note="gene_id=mCG10023.3 transcript_id=mCT10050.3 created
FT                   on 23-JUL-2003"
FT   CDS             join(5079731..5079892,5080423..5080523,5081715..5081904,
FT                   5083213..5083361,5084397..5084475,5086637..5086754,
FT                   5087115..5087209,5087887..5087971,5089151..5089254,
FT                   5090100..5090165,5090666..5090716,5091456..5091538,
FT                   5092308..5092342,5093071..5093126,5093212..5093256,
FT                   5093895..5094010,5095526..5095610)
FT                   /codon_start=1
FT                   /gene="C130052I12Rik"
FT                   /locus_tag="mCG_10023"
FT                   /product="RIKEN cDNA C130052I12"
FT                   /note="gene_id=mCG10023.3 transcript_id=mCT10050.3
FT                   protein_id=mCP14052.2"
FT                   /protein_id="EDL37054.1"
FT                   /translation="MWSGRSSFTSLVVGVFLVYVVHTCWVMYGIVYTRPCSGDSNCIQP
FT                   YLALRPKLQLSVYTTTRSSLGAENNVDLILNVEDFDVDSKFERTVNVSVPKKTRNNGTL
FT                   YAYIFLHHAGILPWQDGKQVHVVSTLTTYMIPKPEEINLLTGESATQQQIEAEKKPSNA
FT                   LDEPVSHWRPRLTLNVMVDDFVFDGSSLPADVHRYMKMIQLGKTVHYLPILFIDQLSNR
FT                   VKDLMVINRSTTELPLTVSYDKISLGRLRFWIHMQDAVYSLQQFGFSEKDADELKGIFV
FT                   DTNLYLLALTFFVAAFHLLFDFLAFKSDISFWKKKKSMIGMSTKAVLWRCFSTVVIFLF
FT                   LLDEQTSLLVLIPAGVGAAIELWKVKKALKITVAWRGLRPVFQFGTHSESERKTEKYDA
FT                   QAMKYLSYLLYPLCVGGAVYSLLNIKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYK
FT                   MKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD
FT                   KSRVNEFGESYEEQPKRKPHPD"
FT   gene            5102409..5124721
FT                   /gene="Tert"
FT                   /locus_tag="mCG_20941"
FT                   /note="gene_id=mCG20941.2"
FT   mRNA            join(5102409..5102741,5102844..5104167,5109645..5109840,
FT                   5110913..5111093,5111850..5112029,5112701..5112859,
FT                   5114651..5114752,5115481..5115566,5117472..5117585,
FT                   5117861..5117932,5119743..5119931,5121675..5121801,
FT                   5122271..5122332,5123441..5123565,5123782..5123910,
FT                   5124404..5124721)
FT                   /gene="Tert"
FT                   /locus_tag="mCG_20941"
FT                   /product="telomerase reverse transcriptase"
FT                   /note="gene_id=mCG20941.2 transcript_id=mCT22719.1 created
FT                   on 24-JUL-2003"
FT   CDS             join(5102523..5102741,5102844..5104167,5109645..5109840,
FT                   5110913..5111093,5111850..5112029,5112701..5112859,
FT                   5114651..5114752,5115481..5115566,5117472..5117585,
FT                   5117861..5117932,5119743..5119931,5121675..5121801,
FT                   5122271..5122332,5123441..5123565,5123782..5123910,
FT                   5124404..5124507)
FT                   /codon_start=1
FT                   /gene="Tert"
FT                   /locus_tag="mCG_20941"
FT                   /product="telomerase reverse transcriptase"
FT                   /note="gene_id=mCG20941.2 transcript_id=mCT22719.1
FT                   protein_id=mCP14082.1"
FT                   /protein_id="EDL37055.1"
FT                   /translation="MTRAPRCPAVRSLLRSRYREVWPLATFVRRLGPEGRRLVQPGDPK
FT                   IYRTLVAQCLVCMHWGSQPPPADLSFHQVSSLKELVARVVQRLCERNERNVLAFGFELL
FT                   NEARGGPPMAFTSSVRSYLPNTVIETLRVSGAWMLLLSRVGDDLLVYLLAHCALYLLVP
FT                   PSCAYQVCGSPLYQICATTDIWPSVSASYRPTRPVGRNFTNLRFLQQIKSSSRQEAPKP
FT                   LALPSRGTKRHLSLTSTSVPSAKKARCYPVPRVEEGPHRQVLPTPSGKSWVPSPARSPE
FT                   VPTAEKDLSSKGKVSDLSLSGSVCCKHKPSSTSLLSPPRQNAFQLRPFIETRHFLYSRG
FT                   DGQERLNPSFLLSNLQPNLTGARRLVEIIFLGSRPRTSGPLCRTHRLSRRYWQMRPLFQ
FT                   QLLVNHAECQYVRLLRSHCRFRTANQQVTDALNTSPPHLMDLLRLHSSPWQVYGFLRAC
FT                   LCKVVSASLWGTRHNERRFFKNLKKFISLGKYGKLSLQELMWKMKVEDCHWLRSSPGKD
FT                   RVPAAEHRLRERILATFLFWLMDTYVVQLLRSFFYITESTFQKNRLFFYRKSVWSKLQS
FT                   IGVRQHLERVRLRELSQEEVRHHQDTWLAMPICRLRFIPKPNGLRPIVNMSYSMGTRAL
FT                   GRRKQAQHFTQRLKTLFSMLNYERTKHPHLMGSSVLGMNDIYRTWRAFVLRVRALDQTP
FT                   RMYFVKADVTGAYDAIPQGKLVEVVANMIRHSESTYCIRQYAVVRRDSQGQVHKSFRRQ
FT                   VTTLSDLQPYMGQFLKHLQDSDASALRNSVVIEQSISMNESSSSLFDFFLHFLRHSVVK
FT                   IGDRCYTQCQGIPQGSSLSTLLCSLCFGDMENKLFAEVQRDGLLLRFVDDFLLVTPHLD
FT                   QAKTFLSTLVHGVPEYGCMINLQKTVVNFPVEPGTLGGAAPYQLPAHCLFPWCGLLLDT
FT                   QTLEVFCDYSGYAQTSIKTSLTFQSVFKAGKTMRNKLLSVLRLKCHGLFLDLQVNSLQT
FT                   VCINIYKIFLLQAYRFHACVIQLPFDQRVRKNLTFFLGIISSQASCCYAILKVKNPGMT
FT                   LKASGSFPPEAAHWLCYQAFLLKLAAHSVIYKCLLGPLRTAQKLLCRKLPEATMTILKA
FT                   AADPALSTDFQTILD"
FT   assembly_gap    5135256..5135464
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   gene            complement(5137504..5153593)
FT                   /locus_tag="mCG_20942"
FT                   /note="gene_id=mCG20942.3"
FT   mRNA            complement(join(5137504..5139922,5141883..5142042,
FT                   5142265..5142355,5143703..5143859,5145498..5145626,
FT                   5147180..5147292,5148307..5148417,5150008..5150189,
FT                   5150941..5151078,5151294..5151434,5153345..5153593))
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, transcript variant mCT171170"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT171170.1 created
FT                   on 25-JUL-2003"
FT   mRNA            complement(join(5137504..5139922,5141109..5141271,
FT                   5141883..5142042,5142265..5142355,5143703..5143859,
FT                   5145498..5145626,5147180..5147292,5148307..5148417,
FT                   5150008..5150189,5150941..5151078,5151294..5151434,
FT                   5153345..5153593))
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, transcript variant mCT186641"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT186641.0 created
FT                   on 28-JUL-2003"
FT   mRNA            complement(join(5137504..5139922,5141109..5141271,
FT                   5141883..5142042,5142427..5142570,5143703..5143859,
FT                   5145498..5145626,5147180..5147292,5148307..5148417,
FT                   5150008..5150189,5150941..5151078,5151294..5151434,
FT                   5153345..5153593))
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, transcript variant mCT22720"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT22720.2 created
FT                   on 25-JUL-2003"
FT   mRNA            complement(join(5137504..5139922,5141883..5142012,
FT                   5142427..5142631,5143703..5143859,5145498..5145626,
FT                   5147180..5147292,5148307..5148417,5150008..5150189,
FT                   5150941..5151078,5151294..5151434,5153345..5153593))
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, transcript variant mCT186645"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT186645.0 created
FT                   on 28-JUL-2003"
FT   mRNA            complement(join(5137504..5139922,5141109..5141271,
FT                   5141883..5142012,5142427..5142631,5143703..5143859,
FT                   5145498..5145626,5147180..5147292,5148307..5148417,
FT                   5150008..5150189,5150941..5151078,5151294..5151434,
FT                   5153345..5153593))
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, transcript variant mCT171172"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT171172.1 created
FT                   on 25-JUL-2003"
FT   mRNA            complement(join(5137504..5139922,5141883..5142042,
FT                   5142427..5142631,5143703..5143859,5145498..5145626,
FT                   5147180..5147292,5148307..5148417,5150008..5150189,
FT                   5150941..5151078,5151294..5151434,5153345..5153593))
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, transcript variant mCT171171"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT171171.1 created
FT                   on 25-JUL-2003"
FT   mRNA            complement(join(5137504..5139922,5141109..5141271,
FT                   5141883..5142042,5142427..5142631,5143703..5143859,
FT                   5145498..5145626,5147180..5147292,5148307..5148417,
FT                   5150008..5150189,5150941..5151078,5151294..5151434,
FT                   5153345..5153593))
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, transcript variant mCT186643"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT186643.0 created
FT                   on 28-JUL-2003"
FT   CDS             complement(join(5139731..5139922,5141109..5141271,
FT                   5141883..5142042,5142265..5142355,5143703..5143859,
FT                   5145498..5145626,5147180..5147292,5148307..5148417,
FT                   5150008..5150189,5150941..5151078,5151294..5151434,
FT                   5153345..5153501))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, isoform CRA_c"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT186641.0
FT                   protein_id=mCP107877.0 isoform=CRA_c"
FT                   /protein_id="EDL37058.1"
FT                   /translation="MAQASGMDPLVDIEDERPKWDNKLQYLLSCIGFAVGLGNIWRFPY
FT                   LCQTHGGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLGGVGLGCF
FT                   SVSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYR
FT                   QTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIF
FT                   LIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPR
FT                   NNCEKDAVIIALVNSMTSLYASIAIFSVMGFKASNDYGRCLDRNILSLINEFDLPELSI
FT                   SRDEYPSVLMYLNATQTARVAQLPLKTCHLEDFLDKPTWKQISGARVLGEGCARLTSRV
FT                   CEASVLPGVICFACFLSAICFTLQSGGYWLEIFDSFAASLNLIIFAFMEVVGVIHIYGM
FT                   KRFCDDIEWMTGRRPGLYWQVTWRVVSPMLLFGIFLSYIVLLIQTPPSYKAWNPQYEHF
FT                   PSREEKFYPGWVQVTCVLLSFLPSLWVPGVALAQLLSQYKQRWKATHLESGLKLQESRG
FT                   C"
FT   CDS             complement(join(5139731..5139922,5141109..5141271,
FT                   5141883..5142012,5142427..5142631,5143703..5143859,
FT                   5145498..5145626,5147180..5147292,5148307..5148417,
FT                   5150008..5150189,5150941..5151078,5151294..5151434,
FT                   5153345..5153501))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, isoform CRA_b"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT171172.1
FT                   protein_id=mCP94088.0 isoform=CRA_b"
FT                   /protein_id="EDL37057.1"
FT                   /translation="MAQASGMDPLVDIEDERPKWDNKLQYLLSCIGFAVGLGNIWRFPY
FT                   LCQTHGGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLGGVGLGCF
FT                   SVSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYR
FT                   QTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIF
FT                   LIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPR
FT                   NNCEKDAVIIALVNSMTSLYASIAIFSVMGFKASNDYGRCLDRNILSLINEFDLPELSI
FT                   SRDEYPSVLMYLNATQTARVAQLPLKTCHLEDFLDKSASGPGLAFIVFTEAVLHMPGAS
FT                   VWSVLFFGMLFTLGLSSMFGNMEGVITPLLDMGILPKGIPKEVMTAICFTLQSGGYWLE
FT                   IFDSFAASLNLIIFAFMEVVGVIHIYGMKRFCDDIEWMTGRRPGLYWQVTWRVVSPMLL
FT                   FGIFLSYIVLLIQTPPSYKAWNPQYEHFPSREEKFYPGWVQVTCVLLSFLPSLWVPGVA
FT                   LAQLLSQYKQRWKATHLESGLKLQESRGC"
FT   CDS             complement(join(5139731..5139922,5141109..5141271,
FT                   5141883..5142042,5142427..5142631,5143703..5143859,
FT                   5145498..5145626,5147180..5147292,5148307..5148417,
FT                   5150008..5150189,5150941..5151078,5151294..5151434,
FT                   5153345..5153501))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, isoform CRA_d"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT186643.0
FT                   protein_id=mCP107878.0 isoform=CRA_d"
FT                   /protein_id="EDL37059.1"
FT                   /translation="MAQASGMDPLVDIEDERPKWDNKLQYLLSCIGFAVGLGNIWRFPY
FT                   LCQTHGGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLGGVGLGCF
FT                   SVSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYR
FT                   QTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIF
FT                   LIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPR
FT                   NNCEKDAVIIALVNSMTSLYASIAIFSVMGFKASNDYGRCLDRNILSLINEFDLPELSI
FT                   SRDEYPSVLMYLNATQTARVAQLPLKTCHLEDFLDKSASGPGLAFIVFTEAVLHMPGAS
FT                   VWSVLFFGMLFTLGLSSMFGNMEGVITPLLDMGILPKGIPKEVMTGVICFACFLSAICF
FT                   TLQSGGYWLEIFDSFAASLNLIIFAFMEVVGVIHIYGMKRFCDDIEWMTGRRPGLYWQV
FT                   TWRVVSPMLLFGIFLSYIVLLIQTPPSYKAWNPQYEHFPSREEKFYPGWVQVTCVLLSF
FT                   LPSLWVPGVALAQLLSQYKQRWKATHLESGLKLQESRGC"
FT   CDS             complement(join(5139757..5139922,5141883..5142042,
FT                   5142265..5142355,5143703..5143859,5145498..5145626,
FT                   5147180..5147292,5148307..5148417,5150008..5150189,
FT                   5150941..5151078,5151294..5151434,5153345..5153501))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, isoform CRA_a"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT171170.1
FT                   protein_id=mCP94090.0 isoform=CRA_a"
FT                   /protein_id="EDL37056.1"
FT                   /translation="MAQASGMDPLVDIEDERPKWDNKLQYLLSCIGFAVGLGNIWRFPY
FT                   LCQTHGGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLGGVGLGCF
FT                   SVSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYR
FT                   QTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIF
FT                   LIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPR
FT                   NNCEKDAVIIALVNSMTSLYASIAIFSVMGFKASNDYGRCLDRNILSLINEFDLPELSI
FT                   SRDEYPSVLMYLNATQTARVAQLPLKTCHLEDFLDKPTWKQISGARVLGEGCARLTSRV
FT                   CEASVLPGVICFACFLSAICFTLQSGGYWLEIFDSFAASLNLIIFAFMEVVGVIHIYGM
FT                   KRNIFPQERRSSTQAGCRSPVCSCPSCPHCGSLELLWLSYCPSTNRGGRLRIWKVV"
FT   CDS             complement(join(5139757..5139922,5141883..5142012,
FT                   5142427..5142631,5143703..5143859,5145498..5145626,
FT                   5147180..5147292,5148307..5148417,5150008..5150189,
FT                   5150941..5151078,5151294..5151434,5153345..5153501))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, isoform CRA_g"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT186645.0
FT                   protein_id=mCP107876.0 isoform=CRA_g"
FT                   /protein_id="EDL37062.1"
FT                   /translation="MAQASGMDPLVDIEDERPKWDNKLQYLLSCIGFAVGLGNIWRFPY
FT                   LCQTHGGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLGGVGLGCF
FT                   SVSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYR
FT                   QTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIF
FT                   LIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPR
FT                   NNCEKDAVIIALVNSMTSLYASIAIFSVMGFKASNDYGRCLDRNILSLINEFDLPELSI
FT                   SRDEYPSVLMYLNATQTARVAQLPLKTCHLEDFLDKSASGPGLAFIVFTEAVLHMPGAS
FT                   VWSVLFFGMLFTLGLSSMFGNMEGVITPLLDMGILPKGIPKEVMTAICFTLQSGGYWLE
FT                   IFDSFAASLNLIIFAFMEVVGVIHIYGMKRNIFPQERRSSTQAGCRSPVCSCPSCPHCG
FT                   SLELLWLSYCPSTNRGGRLRIWKVV"
FT   CDS             complement(join(5139757..5139922,5141883..5142042,
FT                   5142427..5142631,5143703..5143859,5145498..5145626,
FT                   5147180..5147292,5148307..5148417,5150008..5150189,
FT                   5150941..5151078,5151294..5151434,5153345..5153501))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, isoform CRA_f"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT171171.1
FT                   protein_id=mCP94089.0 isoform=CRA_f"
FT                   /protein_id="EDL37061.1"
FT                   /translation="MAQASGMDPLVDIEDERPKWDNKLQYLLSCIGFAVGLGNIWRFPY
FT                   LCQTHGGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLGGVGLGCF
FT                   SVSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYR
FT                   QTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIF
FT                   LIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPR
FT                   NNCEKDAVIIALVNSMTSLYASIAIFSVMGFKASNDYGRCLDRNILSLINEFDLPELSI
FT                   SRDEYPSVLMYLNATQTARVAQLPLKTCHLEDFLDKSASGPGLAFIVFTEAVLHMPGAS
FT                   VWSVLFFGMLFTLGLSSMFGNMEGVITPLLDMGILPKGIPKEVMTGVICFACFLSAICF
FT                   TLQSGGYWLEIFDSFAASLNLIIFAFMEVVGVIHIYGMKRNIFPQERRSSTQAGCRSPV
FT                   CSCPSCPHCGSLELLWLSYCPSTNRGGRLRIWKVV"
FT   assembly_gap    5140219..5140238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(5142430..5142570,5143703..5143859,
FT                   5145498..5145626,5147180..5147292,5148307..5148417,
FT                   5150008..5150189,5150941..5151078,5151294..5151434,
FT                   5153345..5153501))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20942"
FT                   /product="mCG20942, isoform CRA_e"
FT                   /note="gene_id=mCG20942.3 transcript_id=mCT22720.2
FT                   protein_id=mCP14098.1 isoform=CRA_e"
FT                   /protein_id="EDL37060.1"
FT                   /translation="MAQASGMDPLVDIEDERPKWDNKLQYLLSCIGFAVGLGNIWRFPY
FT                   LCQTHGGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLGGVGLGCF
FT                   SVSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYR
FT                   QTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIF
FT                   LIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPR
FT                   NNCEKDAVIIALVNSMTSLYASIAIFSVMGFKASNDYGRCLDRNILSLINEFDLPELSI
FT                   SRDEYPSVLMYLNATQTARVAQLPLKTCHLEDFLDKVLLCGLCSSLGCCLPWVCPPCLG
FT                   TWRVSLHHYWTWGSYPKVYPRRS"
FT   gene            complement(5155319..>5176458)
FT                   /gene="Slc6a19"
FT                   /locus_tag="mCG_20945"
FT                   /note="gene_id=mCG20945.3"
FT   mRNA            complement(join(5155319..5157404,5157567..5157729,
FT                   5159490..5159649,5159767..5159971,5161337..5161493,
FT                   5161638..5161766,5164617..5164729,5165073..5165183,
FT                   5165288..5165469,5167253..5167390,5168519..5168659,
FT                   5176110..5176458))
FT                   /gene="Slc6a19"
FT                   /locus_tag="mCG_20945"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 19, transcript variant mCT22723"
FT                   /note="gene_id=mCG20945.3 transcript_id=mCT22723.3 created
FT                   on 25-JUL-2003"
FT   mRNA            complement(join(5155319..5157404,5157567..5157729,
FT                   5159490..5159649,5159767..5159971,5161337..5161493,
FT                   5161638..5161766,5164617..5164729,5165073..5165183,
FT                   5165288..5165469,5167253..5167390,5168061..>5168212))
FT                   /gene="Slc6a19"
FT                   /locus_tag="mCG_20945"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 19, transcript variant mCT185785"
FT                   /note="gene_id=mCG20945.3 transcript_id=mCT185785.0 created
FT                   on 25-JUL-2003"
FT   mRNA            complement(join(5155319..5157404,5157567..5157729,
FT                   5159490..5159649,5159767..5159971,5161337..5161493,
FT                   5161638..5161766,5164617..5164729,5165073..5165183,
FT                   5165288..5165469,5167253..5167390,5167569..5167951))
FT                   /gene="Slc6a19"
FT                   /locus_tag="mCG_20945"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 19, transcript variant mCT185784"
FT                   /note="gene_id=mCG20945.3 transcript_id=mCT185784.0 created
FT                   on 25-JUL-2003"
FT   mRNA            complement(join(5155319..5157404,5157567..5157729,
FT                   5159490..5159649,5159767..5159971,5161337..5161493,
FT                   5161638..5161766,5164617..5164729,5165073..5165183,
FT                   5165288..5165469,5167253..5167390,5167727..>5167827))
FT                   /gene="Slc6a19"
FT                   /locus_tag="mCG_20945"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 19, transcript variant mCT185786"
FT                   /note="gene_id=mCG20945.3 transcript_id=mCT185786.0 created
FT                   on 25-JUL-2003"
FT   mRNA            complement(join(5156565..5157404,5157567..5157729,
FT                   5159490..5159649,5159767..5159971,5161337..5161493,
FT                   5161638..5161766,5164617..5165183,5165288..5165469,
FT                   5167253..5167390,5168519..5168659,5176110..>5176375))
FT                   /gene="Slc6a19"
FT                   /locus_tag="mCG_20945"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 19, transcript variant mCT193522"
FT                   /note="gene_id=mCG20945.3 transcript_id=mCT193522.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(5156728..5157404,5157567..5157729,
FT                   5159490..5159649,5159767..5159971,5161337..5161372,
FT                   5165111..5165183,5165288..5165469,5167253..5167390,
FT                   5168519..5168659,5176110..>5176458))
FT                   /gene="Slc6a19"
FT                   /locus_tag="mCG_20945"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 19, transcript variant mCT193521"
FT                   /note="gene_id=mCG20945.3 transcript_id=mCT193521.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5157201..5157404,5157567..5157729,
FT                   5159490..5159649,5159767..5159971,5161337..5161493,
FT                   5161638..5161766,5164617..5164729,5165073..5165183,
FT                   5165288..5165469,5167253..5167390,5168519..5168659,
FT                   5176110..5176311))
FT                   /codon_start=1
FT                   /gene="Slc6a19"
FT                   /locus_tag="mCG_20945"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 19, isoform CRA_f"
FT                   /note="gene_id=mCG20945.3 transcript_id=mCT22723.3
FT                   protein_id=mCP14078.3 isoform=CRA_f"
FT                   /db_xref="GOA:Q3KN89"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR002438"
FT                   /db_xref="MGI:MGI:1921588"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KN89"
FT                   /protein_id="EDL37068.1"
FT                   /translation="MVRLVLPNPGLEERIPSLDELEVIEKEEAGSRPKWDNKAQYMLTC
FT                   VGFCVGLGNVWRFPYLCQSHGGGAFMIPFLILLVFEGIPLLYLEFAIGQRLRKGSMGVW
FT                   SSIHPALKGIGIASMFVSFMVGLYYNTIIAWVMWYFFNSFQEPLPWSECPLNQNQTGYV
FT                   EECAKSSSVDYFWYRETLNISTSISDSGSIQWWILLCLTCAWSVLYVCIIRGIETTGKA
FT                   VYITSTLPYVVLTIFLIRGLTLKGATNGIVFLFTPNITELSNPNTWLDAGAQVFYSFSL
FT                   AFGGLISFSSYNSVHNNCEMDSVIVSVINGFTSVYAATVVYSIIGFRATERFDDCVNTN
FT                   ILTLINGFDLPEGNVTSENFEAYQQWCNATNPQAYAQLKFQTCDINSFLSEGVEGTGLA
FT                   FIVFTEAITKMPVSPLWSVLFFIMLFCLGLSSMFGNMEGVVVPLQDLNITPKKWPKELL
FT                   TGLICLGTYLIAFIFTLNSGQYWLSLLDSFAGSIPLLIIAFCEMFAVVYVYGVDRFNKD
FT                   IEFMIGHKPNIFWQVTWRVVSPLIMLVIFLFFFVIEVNKTLMYSIWDPNYEEFPKSQKI
FT                   PYPNWVYAVVVTVAGVPCLSIPCFAIYKFIRNCCQKSDDHHGLVNTLSTASVNGDLKN"
FT   CDS             complement(join(5157201..5157404,5157567..5157729,
FT                   5159490..5159649,5159767..5159971,5161337..5161493,
FT                   5161638..5161766,5164617..5164729,5165073..5165183,
FT                   5165288..5165469,5167253..5167390,5168061..>5168211))
FT                   /codon_start=1
FT                   /gene="Slc6a19"
FT                   /locus_tag="mCG_20945"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 19, isoform CRA_b"
FT                   /note="gene_id=mCG20945.3 transcript_id=mCT185785.0
FT                   protein_id=mCP107042.1 isoform=CRA_b"
FT                   /protein_id="EDL37064.1"
FT                   /translation="AYSDHSYTLSKDAQRCHQPRCGHSFTNSGLEMVQPPASRRGHGSL
FT                   RAQNASIASMFVSFMVGLYYNTIIAWVMWYFFNSFQEPLPWSECPLNQNQTGYVEECAK
FT                   SSSVDYFWYRETLNISTSISDSGSIQWWILLCLTCAWSVLYVCIIRGIETTGKAVYITS
FT                   TLPYVVLTIFLIRGLTLKGATNGIVFLFTPNITELSNPNTWLDAGAQVFYSFSLAFGGL
FT                   ISFSSYNSVHNNCEMDSVIVSVINGFTSVYAATVVYSIIGFRATERFDDCVNTNILTLI
FT                   NGFDLPEGNVTSENFEAYQQWCNATNPQAYAQLKFQTCDINSFLSEGVEGTGLAFIVFT
FT                   EAITKMPVSPLWSVLFFIMLFCLGLSSMFGNMEGVVVPLQDLNITPKKWPKELLTGLIC
FT                   LGTYLIAFIFTLNSGQYWLSLLDSFAGSIPLLIIAFCEMFAVVYVYGVDRFNKDIEFMI
FT                   GHKPNIFWQVTWRVVSPLIMLVIFLFFFVIEVNKTLMYSIWDPNYEEFPKSQKIPYPNW
FT                   VYAVVVTVAGVPCLSIPCFAIYKFIRNCCQKSDDHHGLVNTLSTASVNGDLKN"
FT   CDS             complement(join(5157201..5157404,5157567..5157729,
FT                   5159490..5159649,5159767..5159971,5161337..5161493,
FT                   5161638..5161766,5164617..5164729,5165073..5165183,
FT                   5165288..5165469,5167253..5167390,5167727..>5167826))
FT                   /codon_start=1
FT                   /gene="Slc6a19"
FT                   /locus_tag="mCG_20945"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 19, isoform CRA_c"
FT                   /note="gene_id=mCG20945.3 transcript_id=mCT185786.0
FT                   protein_id=mCP107044.1 isoform=CRA_c"
FT                   /protein_id="EDL37065.1"
FT                   /translation="IARYDLCSSLSLLLHRDFFFPESIHLSLAWELPSIASMFVSFMVG
FT                   LYYNTIIAWVMWYFFNSFQEPLPWSECPLNQNQTGYVEECAKSSSVDYFWYRETLNIST
FT                   SISDSGSIQWWILLCLTCAWSVLYVCIIRGIETTGKAVYITSTLPYVVLTIFLIRGLTL
FT                   KGATNGIVFLFTPNITELSNPNTWLDAGAQVFYSFSLAFGGLISFSSYNSVHNNCEMDS
FT                   VIVSVINGFTSVYAATVVYSIIGFRATERFDDCVNTNILTLINGFDLPEGNVTSENFEA
FT                   YQQWCNATNPQAYAQLKFQTCDINSFLSEGVEGTGLAFIVFTEAITKMPVSPLWSVLFF
FT                   IMLFCLGLSSMFGNMEGVVVPLQDLNITPKKWPKELLTGLICLGTYLIAFIFTLNSGQY
FT                   WLSLLDSFAGSIPLLIIAFCEMFAVVYVYGVDRFNKDIEFMIGHKPNIFWQVTWRVVSP
FT                   LIMLVIFLFFFVIEVNKTLMYSIWDPNYEEFPKSQKIPYPNWVYAVVVTVAGVPCLSIP
FT                   CFAIYKFIRNCCQKSDDHHGLVNTLSTASVNGDLKN"
FT   CDS             complement(join(5157201..5157404,5157567..5157729,
FT                   5159490..5159649,5159767..5159971,5161337..5161493,
FT                   5161638..5161766,5164617..5164729,5165073..5165183,
FT                   5165288..5165469,5167253..5167379))
FT                   /codon_start=1
FT                   /gene="Slc6a19"
FT                   /locus_tag="mCG_20945"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 19, isoform CRA_a"
FT                   /note="gene_id=mCG20945.3 transcript_id=mCT185784.0
FT                   protein_id=mCP107043.0 isoform=CRA_a"
FT                   /protein_id="EDL37063.1"
FT                   /translation="MFVSFMVGLYYNTIIAWVMWYFFNSFQEPLPWSECPLNQNQTGYV
FT                   EECAKSSSVDYFWYRETLNISTSISDSGSIQWWILLCLTCAWSVLYVCIIRGIETTGKA
FT                   VYITSTLPYVVLTIFLIRGLTLKGATNGIVFLFTPNITELSNPNTWLDAGAQVFYSFSL
FT                   AFGGLISFSSYNSVHNNCEMDSVIVSVINGFTSVYAATVVYSIIGFRATERFDDCVNTN
FT                   ILTLINGFDLPEGNVTSENFEAYQQWCNATNPQAYAQLKFQTCDINSFLSEGVEGTGLA
FT                   FIVFTEAITKMPVSPLWSVLFFIMLFCLGLSSMFGNMEGVVVPLQDLNITPKKWPKELL
FT                   TGLICLGTYLIAFIFTLNSGQYWLSLLDSFAGSIPLLIIAFCEMFAVVYVYGVDRFNKD
FT                   IEFMIGHKPNIFWQVTWRVVSPLIMLVIFLFFFVIEVNKTLMYSIWDPNYEEFPKSQKI
FT                   PYPNWVYAVVVTVAGVPCLSIPCFAIYKFIRNCCQKSDDHHGLVNTLSTASVNGDLKN"
FT   CDS             complement(join(5157201..5157404,5157567..5157729,
FT                   5159490..5159649,5159767..5159971,5161337..5161493,
FT                   5161638..5161766,5164617..>5164732))
FT                   /codon_start=1
FT                   /gene="Slc6a19"
FT                   /locus_tag="mCG_20945"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 19, isoform CRA_e"
FT                   /note="gene_id=mCG20945.3 transcript_id=mCT193522.0
FT                   protein_id=mCP114493.0 isoform=CRA_e"
FT                   /protein_id="EDL37067.1"
FT                   /translation="QITELSNPNTWLDAGAQVFYSFSLAFGGLISFSSYNSVHNNCEMD
FT                   SVIVSVINGFTSVYAATVVYSIIGFRATERFDDCVNTNILTLINGFDLPEGNVTSENFE
FT                   AYQQWCNATNPQAYAQLKFQTCDINSFLSEGVEGTGLAFIVFTEAITKMPVSPLWSVLF
FT                   FIMLFCLGLSSMFGNMEGVVVPLQDLNITPKKWPKELLTGLICLGTYLIAFIFTLNSGQ
FT                   YWLSLLDSFAGSIPLLIIAFCEMFAVVYVYGVDRFNKDIEFMIGHKPNIFWQVTWRVVS
FT                   PLIMLVIFLFFFVIEVNKTLMYSIWDPNYEEFPKSQKIPYPNWVYAVVVTVAGVPCLSI
FT                   PCFAIYKFIRNCCQKSDDHHGLVNTLSTASVNGDLKN"
FT   CDS             complement(join(5161359..5161372,5165111..5165183,
FT                   5165288..5165469,5167253..5167390,5168519..5168659,
FT                   5176110..>5176398))
FT                   /codon_start=1
FT                   /gene="Slc6a19"
FT                   /locus_tag="mCG_20945"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 19, isoform CRA_d"
FT                   /note="gene_id=mCG20945.3 transcript_id=mCT193521.0
FT                   protein_id=mCP114492.0 isoform=CRA_d"
FT                   /protein_id="EDL37066.1"
FT                   /translation="RAGAPGHNHLPFGCRAARVCQARPSPATTMVRLVLPNPGLEERIP
FT                   SLDELEVIEKEEAGSRPKWDNKAQYMLTCVGFCVGLGNVWRFPYLCQSHGGGAFMIPFL
FT                   ILLVFEGIPLLYLEFAIGQRLRKGSMGVWSSIHPALKGIGIASMFVSFMVGLYYNTIIA
FT                   WVMWYFFNSFQEPLPWSECPLNQNQTGYVEECAKSSSVDYFWYRETLNISTSISDSGSI
FT                   QWWILLCLTCAWSVLYVCIIRGIETTGKAVYITSTLPYVVLTIFLIRGLTLKVSDL"
FT   assembly_gap    5169961..5170124
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    5173663..5174056
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   gene            5175503..5185647
FT                   /locus_tag="mCG_20944"
FT                   /note="gene_id=mCG20944.3"
FT   mRNA            join(5175503..5175801,5184417..5185647)
FT                   /locus_tag="mCG_20944"
FT                   /product="mCG20944, transcript variant mCT22722"
FT                   /note="gene_id=mCG20944.3 transcript_id=mCT22722.2 created
FT                   on 23-JUL-2003"
FT   CDS             join(5175714..5175801,5184417..5184757)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20944"
FT                   /product="mCG20944, isoform CRA_b"
FT                   /note="gene_id=mCG20944.3 transcript_id=mCT22722.2
FT                   protein_id=mCP14077.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D3K5"
FT                   /db_xref="MGI:MGI:1918640"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D3K5"
FT                   /protein_id="EDL37070.1"
FT                   /translation="MPCPLRITLENQLSLFQQDHAVPTFKVGLGQSHPAFRNFFLSILT
FT                   EQEAFCVQKMMPFQTACPPGPGQDPEVCNICLVTITEEVVSHMASVSPMSSASASPGPR
FT                   AGPQVVNIVNIPGPQRYLCGTLVPIRLLGSRRTIGKDA"
FT   assembly_gap    5177232..5177321
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   mRNA            join(<5179513..5179639,5184417..5185647)
FT                   /locus_tag="mCG_20944"
FT                   /product="mCG20944, transcript variant mCT174027"
FT                   /note="gene_id=mCG20944.3 transcript_id=mCT174027.1 created
FT                   on 23-JUL-2003"
FT   CDS             join(<5179513..5179639,5184417..5184757)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20944"
FT                   /product="mCG20944, isoform CRA_a"
FT                   /note="gene_id=mCG20944.3 transcript_id=mCT174027.1
FT                   protein_id=mCP96946.1 isoform=CRA_a"
FT                   /protein_id="EDL37069.1"
FT                   /translation="SSSVVEQPRTAFSCPDIVQILQDPASSSECSDVTIGRDHQPPGQS
FT                   HPAFRNFFLSILTEQEAFCVQKMMPFQTACPPGPGQDPEVCNICLVTITEEVVSHMASV
FT                   SPMSSASASPGPRAGPQVVNIVNIPGPQRYLCGTLVPIRLLGSRRTIGKDA"
FT   assembly_gap    5182126..5182145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5189481..5189626
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    5208441..5208650
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   gene            5208917..5292680
FT                   /gene="Slc12a7"
FT                   /locus_tag="mCG_20943"
FT                   /note="gene_id=mCG20943.2"
FT   mRNA            join(5208917..5209162,5260466..5260560,5260991..5261113,
FT                   5264512..5264658,5265888..5265942,5266597..5266727,
FT                   5268497..5268738,5269871..5270082,5271045..5271212,
FT                   5271432..5271649,5272714..5272891)
FT                   /gene="Slc12a7"
FT                   /locus_tag="mCG_20943"
FT                   /product="solute carrier family 12, member 7, transcript
FT                   variant mCT186644"
FT                   /note="gene_id=mCG20943.2 transcript_id=mCT186644.0 created
FT                   on 24-JUL-2003"
FT   CDS             join(5208952..5209162,5260466..5260560,5260991..5261113,
FT                   5264512..5264658,5265888..5265942,5266597..5266727,
FT                   5268497..5268738,5269871..5270082,5271045..5271212,
FT                   5271432..5271634)
FT                   /codon_start=1
FT                   /gene="Slc12a7"
FT                   /locus_tag="mCG_20943"
FT                   /product="solute carrier family 12, member 7, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG20943.2 transcript_id=mCT186644.0
FT                   protein_id=mCP107880.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8C6Y2"
FT                   /db_xref="InterPro:IPR000076"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR030354"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C6Y2"
FT                   /protein_id="EDL37071.1"
FT                   /translation="MSQRFVVTPAQSGTGDAGTRAEGGNQRLCSDSDPDPDLDPNPDPS
FT                   LAAALKIQEVDALPILRYCREPSRYGDGNPRENSPFINNVEVERESYFEGKNMALFEEE
FT                   MDSNPMVSSLLNKLANYTNLSQGVVEHEEDEDSRRREVKAPRMGTFIGVYLPCLQNILG
FT                   VILFLRLTWIVGAAGVMESFLIVAMCCTCTMLTAISMSAIATNGVVPAGGSYYMISRSL
FT                   GPEFGGAVGLCFYLGTTFAGAMYILGTIEIFLTYISPSAAIFQAETADGEAAALLNNMR
FT                   VYGSCALALMAVVVFVGVKYVNKLALVFLACVVLSILAIYAGVIKTAFAPPDIPVCLLG
FT                   NRTLANRNFDTCAKMQVVSNGTVTTALWRLFCNGSSLGATCDEYFAQNNVTEIQGIPGV
FT                   ASGVFLDNLWSTYSDKGAFVEKKGVSSVPVSEESRPGGLPYVLTDIMTYFTMLVGIYFP
FT                   SVTVIRDHLSSKQWSYWPIFSDESFYRQHPLGFLSLSSVSTLQGSWQDPTAPGTSKTPR
FT                   SLFQQGPFWPS"
FT   assembly_gap    5221732..5221833
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    5223677..5223899
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   mRNA            join(5239608..5239836,5260466..5260560,5260991..5261113,
FT                   5264512..5264658,5265888..5265942,5266597..5266727,
FT                   5268497..5268738,5269871..5270082,5271045..5271212,
FT                   5271551..5271649,5272714..5272771,5273474..5273648,
FT                   5274366..5274484,5274890..5274988,5275560..5275679,
FT                   5276332..5276436,5276875..5277043,5281361..5281556,
FT                   5281976..5282145,5282253..5282384,5284932..5285039,
FT                   5285853..5286031,5289486..5289619,5290790..5292680)
FT                   /gene="Slc12a7"
FT                   /locus_tag="mCG_20943"
FT                   /product="solute carrier family 12, member 7, transcript
FT                   variant mCT22721"
FT                   /note="gene_id=mCG20943.2 transcript_id=mCT22721.2 created
FT                   on 24-JUL-2003"
FT   CDS             join(5239713..5239836,5260466..5260560,5260991..5261113,
FT                   5264512..5264658,5265888..5265942,5266597..5266727,
FT                   5268497..5268738,5269871..5270082,5271045..5271212,
FT                   5271551..5271649,5272714..5272771,5273474..5273648,
FT                   5274366..5274484,5274890..5274988,5275560..5275679,
FT                   5276332..5276436,5276875..5277043,5281361..5281556,
FT                   5281976..5282145,5282253..5282384,5284932..5285039,
FT                   5285853..5286031,5289486..5289619,5290790..5290881)
FT                   /codon_start=1
FT                   /gene="Slc12a7"
FT                   /locus_tag="mCG_20943"
FT                   /product="solute carrier family 12, member 7, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG20943.2 transcript_id=mCT22721.2
FT                   protein_id=mCP14056.1 isoform=CRA_b"
FT                   /db_xref="GOA:B9EIV8"
FT                   /db_xref="InterPro:IPR000076"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR004842"
FT                   /db_xref="InterPro:IPR018491"
FT                   /db_xref="InterPro:IPR030354"
FT                   /db_xref="MGI:MGI:1342283"
FT                   /db_xref="UniProtKB/TrEMBL:B9EIV8"
FT                   /protein_id="EDL37072.1"
FT                   /translation="MPTNFTVVPVEARADGAGDEAAERTEEPESPESVDQTSPTPGDGN
FT                   PRENSPFINNVEVERESYFEGKNMALFEEEMDSNPMVSSLLNKLANYTNLSQGVVEHEE
FT                   DEDSRRREVKAPRMGTFIGVYLPCLQNILGVILFLRLTWIVGAAGVMESFLIVAMCCTC
FT                   TMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIE
FT                   IFLTYISPSAAIFQAETADGEAAALLNNMRVYGSCALALMAVVVFVGVKYVNKLALVFL
FT                   ACVVLSILAIYAGVIKTAFAPPDIPVCLLGNRTLANRNFDTCAKMQVVSNGTVTTALWR
FT                   LFCNGSSLGATCDEYFAQNNVTEIQGIPGVASGVFLDNLWSTYSDKGAFVEKKGVSSVP
FT                   VSEESRPGGLPYVLTDIMTYFTMLVGIYFPSVTGIMAGSNRSGDLKDAQKSIPTGTILA
FT                   IVTTSFIYLSCIVLFGACIEGVVLRDKFGEALQGNLVIGMLAWPSPWVIVIGSFFSTCG
FT                   AGLQSLTGAPRLLQAIARDGIIPFLQVFGHGKANGEPTWALLLTALICETGILIASLDS
FT                   VAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFKFYHWTLSFLGMSLCLALMFICSW
FT                   YYALFAMLIAGCIYKYIEYRGAEKEWGDGIRGLSLNAARYALLRVEHGPPHTKNWRPQV
FT                   LVMLNLDSEQCVKHPRLLSFTSQLKAGKGLTIVGSVLEGTYLDKHVEAQRAEENIRSLM
FT                   SAEKTKGFCQLVVSSNLRDGASHLIQSAGLGGMKHNTVLMAWPEAWKEADNPFSWKNFV
FT                   DTVRDTTAAHQALLVAKNIDLFPQNQERFSDGNIDVWWIVHDGGMLMLLPFLLRQHKVW
FT                   RKCRMRIFTVAQVDDNSIQMKKDLQMFLYHLRISAEVEVVEMVENDISAFTYEKTLMME
FT                   QRSQMLKQMQLSKNEREREAQLIHDRNTASHTTATARTQAPPTPDKVQMTWTKEKLIAE
FT                   KHRNKDTGPSGFKDLFSLKPDQSNVRRMHTAVKLNGVVLNKSQDAQLVLLNMPGPPKSR
FT                   QGDENYMEFLEVLTEGLNRVLLVRGGGREVITIYS"
FT   gene            complement(5295641..5323895)
FT                   /gene="Nkd2"
FT                   /locus_tag="mCG_20951"
FT                   /note="gene_id=mCG20951.3"
FT   mRNA            complement(join(5295641..5297484,5298637..5298764,
FT                   5299219..5299303,5300196..5300340,5301013..5301108,
FT                   5301631..5301758,5302824..5302884,5323116..5323219,
FT                   5323607..5323726,5323785..5323895))
FT                   /gene="Nkd2"
FT                   /locus_tag="mCG_20951"
FT                   /product="naked cuticle 2 homolog (Drosophila), transcript
FT                   variant mCT186646"
FT                   /note="gene_id=mCG20951.3 transcript_id=mCT186646.0 created
FT                   on 25-JUL-2003"
FT   mRNA            complement(join(5295641..5297484,5298637..5298764,
FT                   5299219..5299303,5300196..5300340,5301013..5301108,
FT                   5301631..5301758,5302824..5302884,5323116..5323219,
FT                   5323473..5323508,5323607..5323726,5323785..5323895))
FT                   /gene="Nkd2"
FT                   /locus_tag="mCG_20951"
FT                   /product="naked cuticle 2 homolog (Drosophila), transcript
FT                   variant mCT23811"
FT                   /note="gene_id=mCG20951.3 transcript_id=mCT23811.3 created
FT                   on 25-JUL-2003"
FT   CDS             complement(join(5296907..5297484,5298637..5298764,
FT                   5299219..5299303,5300196..5300340,5301013..5301108,
FT                   5301631..5301758,5302824..5302884,5323116..5323219,
FT                   5323607..5323631))
FT                   /codon_start=1
FT                   /gene="Nkd2"
FT                   /locus_tag="mCG_20951"
FT                   /product="naked cuticle 2 homolog (Drosophila), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG20951.3 transcript_id=mCT186646.0
FT                   protein_id=mCP107879.0 isoform=CRA_a"
FT                   /protein_id="EDL37073.1"
FT                   /translation="MGKFQSKHGDSFVVPAYGSGRRGAEETDRRAGSGVEHRSRDKQEL
FT                   LNGDPKEGPFWDDKGSLEVVLPPEKSEGHEGQGQLFSTDDGEKAASREGPLRLSKKHLN
FT                   IDALQCDVSVEEDNRQEWTFTLYDFDNSGKVTREDMSSLMHTIYEVVDASVNHSSGSSK
FT                   TLRVKLTVSPEPSSKKECPLTGQDREPTRGRTEIELTDEPRVADRRLSAYSRKPNADPQ
FT                   PCSVRVPYCVDENTERRNHYLDLAGIENYTSKFGPGSPPEQARQEHHGRATHIPSRSRS
FT                   QESDAHAIHHRRSQVLAEHVIPANEPATRALAAQPRIKGQEKQFLRSPKGPGKPLGTPG
FT                   SGKPGKALSYCLQAVPLPQSAQDGHHLPQPPPQPPPQPYGHKRYRQKAREGHSPLKGHG
FT                   QPTMVEHEVVRDLPPMLGPEGYVMPVVQRHEHHHHHEHHHHHHHHHFHPS"
FT   CDS             complement(join(5296907..5297484,5298637..5298764,
FT                   5299219..5299303,5300196..5300340,5301013..5301108,
FT                   5301631..5301758,5302824..5302884,5323116..5323219,
FT                   5323473..5323508,5323607..5323631))
FT                   /codon_start=1
FT                   /gene="Nkd2"
FT                   /locus_tag="mCG_20951"
FT                   /product="naked cuticle 2 homolog (Drosophila), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG20951.3 transcript_id=mCT23811.3
FT                   protein_id=mCP14088.2 isoform=CRA_b"
FT                   /protein_id="EDL37074.1"
FT                   /translation="MGKFQSKHAAAACKRRESPEGDSFVVPAYGSGRRGAEETDRRAGS
FT                   GVEHRSRDKQELLNGDPKEGPFWDDKGSLEVVLPPEKSEGHEGQGQLFSTDDGEKAASR
FT                   EGPLRLSKKHLNIDALQCDVSVEEDNRQEWTFTLYDFDNSGKVTREDMSSLMHTIYEVV
FT                   DASVNHSSGSSKTLRVKLTVSPEPSSKKECPLTGQDREPTRGRTEIELTDEPRVADRRL
FT                   SAYSRKPNADPQPCSVRVPYCVDENTERRNHYLDLAGIENYTSKFGPGSPPEQARQEHH
FT                   GRATHIPSRSRSQESDAHAIHHRRSQVLAEHVIPANEPATRALAAQPRIKGQEKQFLRS
FT                   PKGPGKPLGTPGSGKPGKALSYCLQAVPLPQSAQDGHHLPQPPPQPPPQPYGHKRYRQK
FT                   AREGHSPLKGHGQPTMVEHEVVRDLPPMLGPEGYVMPVVQRHEHHHHHEHHHHHHHHHF
FT                   HPS"
FT   gene            5305828..5306463
FT                   /pseudo
FT                   /locus_tag="mCG_1049876"
FT                   /note="gene_id=mCG1049876.2"
FT   mRNA            5305828..5306463
FT                   /pseudo
FT                   /locus_tag="mCG_1049876"
FT                   /note="gene_id=mCG1049876.2 transcript_id=mCT167580.2
FT                   created on 24-JUL-2003"
FT   assembly_gap    5315264..5315529
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    5317484..5317597
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    5323731..5323784
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    5341793..5341914
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   gene            5353147..5355428
FT                   /locus_tag="mCG_1049990"
FT                   /note="gene_id=mCG1049990.1"
FT   mRNA            join(5353147..5353434,5354138..5355428)
FT                   /locus_tag="mCG_1049990"
FT                   /product="mCG1049990"
FT                   /note="gene_id=mCG1049990.1 transcript_id=mCT167694.1
FT                   created on 30-SEP-2002"
FT   CDS             5354990..5355187
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049990"
FT                   /product="mCG1049990"
FT                   /note="gene_id=mCG1049990.1 transcript_id=mCT167694.1
FT                   protein_id=mCP54841.1"
FT                   /protein_id="EDL37075.1"
FT                   /translation="MLTSILSEVLPKLLGLQVSLTMNLPCRQPLTAESSELGGGVGSPY
FT                   GPPIVAPTLNQQERRDHQSF"
FT   assembly_gap    5371806..5371825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5388638..5413988)
FT                   /locus_tag="mCG_20952"
FT                   /note="gene_id=mCG20952.2"
FT   mRNA            complement(join(5388638..5389536,5390685..5390754,
FT                   5391655..5391767,5394609..5394762,5396193..5396299,
FT                   5396546..5396632,5397371..5397434,5404109..5404181,
FT                   5405857..5405947,5406358..5406413,5409056..5409185,
FT                   5412305..5412470,5413689..5413988))
FT                   /locus_tag="mCG_20952"
FT                   /product="mCG20952"
FT                   /note="gene_id=mCG20952.2 transcript_id=mCT23812.2 created
FT                   on 30-SEP-2002"
FT   CDS             complement(join(5389441..5389536,5390685..5390754,
FT                   5391655..5391767,5394609..5394762,5396193..5396299,
FT                   5396546..5396632,5397371..5397434,5404109..5404181,
FT                   5405857..5405947,5406358..5406413,5409056..5409185,
FT                   5412305..5412470,5413689..5413780))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20952"
FT                   /product="mCG20952"
FT                   /note="gene_id=mCG20952.2 transcript_id=mCT23812.2
FT                   protein_id=mCP14096.2"
FT                   /db_xref="GOA:Q3UA06"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1916966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3UA06"
FT                   /protein_id="EDL37076.1"
FT                   /translation="MDEAVGDLKQALPCVAESPAVHVEVLQRSGSTAKKEDIKSSVYRL
FT                   LNRHNIVFGDYVWTEFDDPFLSRNVQSVSIVDTELKAKDPQPIDLSACTIALHIFQLNE
FT                   EGPSSENLDEETENIIAASHWVLPAAEFHGLWDSLVYDVEVKSHLLDYVMTTVLFSDKN
FT                   VDSNLITWNRVVLLHGPPGTGKTSLCKALAQKLTIRLSSRYRYGQLIEINSHSLFSKWF
FT                   SESGKLVTKMFQKIQDLIDDKEALVFVLIDEVESLTAARNACRAGAEPSDAIRVVNAVL
FT                   TQIDQIKRHSNVVILTTSNITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMK
FT                   CQIIYPRQQLLTLRELEMIGFIENNVSKLSLLLSEISRKSEGLSGRVLRKLPFLAHALY
FT                   IQAPSVTIEGFLQALSLAVDKQFEEKKKLSAYV"
FT   gene            5414009..5437093
FT                   /locus_tag="mCG_124248"
FT                   /note="gene_id=mCG124248.2"
FT   mRNA            join(5414009..5414144,5414633..5414847,5415064..5415196,
FT                   5416436..5416496,5416845..5416989,5418143..5418253,
FT                   5418830..5419005,5420925..5421057,5422283..5422358,
FT                   5423876..5423971,5426274..5426406,5427733..5427844,
FT                   5430744..5430782,5431621..5431723,5433912..5434079,
FT                   5436437..5437093)
FT                   /locus_tag="mCG_124248"
FT                   /product="mCG124248, transcript variant mCT125487"
FT                   /note="gene_id=mCG124248.2 transcript_id=mCT125487.2
FT                   created on 14-FEB-2003"
FT   mRNA            join(5414009..5414144,5414633..5414847,5415064..5415196,
FT                   5416436..5416496,5416845..5416989,5418143..5418253,
FT                   5418890..5419005,5420925..5421057,5422283..5422358,
FT                   5423876..5423971,5426274..5426406,5427733..5427844,
FT                   5430744..5430782,5431621..5431723,5433912..5434079,
FT                   5436437..5437093)
FT                   /locus_tag="mCG_124248"
FT                   /product="mCG124248, transcript variant mCT180418"
FT                   /note="gene_id=mCG124248.2 transcript_id=mCT180418.0
FT                   created on 14-FEB-2003"
FT   mRNA            join(<5414056..5414144,5414633..5414847,5415064..5416989,
FT                   5418143..5418253,5418890..5419005,5420925..5421057,
FT                   5422283..5422358,5423876..5423971,5426274..5426406,
FT                   5427733..5427844,5430744..5430782,5431621..5431723,
FT                   5433912..5434079,5436437..5437010)
FT                   /locus_tag="mCG_124248"
FT                   /product="mCG124248, transcript variant mCT193517"
FT                   /note="gene_id=mCG124248.2 transcript_id=mCT193517.0
FT                   created on 09-MAR-2004"
FT   CDS             join(5414093..5414144,5414633..5414847,5415064..5415196,
FT                   5416436..5416496,5416845..5416989,5418143..5418253,
FT                   5418830..5419005,5420925..5421057,5422283..5422358,
FT                   5423876..5423971,5426274..5426406,5427733..5427844,
FT                   5430744..5430782,5431621..5431723,5433912..5434079,
FT                   5436437..5436537)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124248"
FT                   /product="mCG124248, isoform CRA_a"
FT                   /note="gene_id=mCG124248.2 transcript_id=mCT125487.2
FT                   protein_id=mCP54858.2 isoform=CRA_a"
FT                   /protein_id="EDL37077.1"
FT                   /translation="MGKKHKKHKAEWRSSYEDYTDTPLEKPLKLVLKVGGSEVTELSGS
FT                   GHDSSYYDDRSDHERERHREKKKKKKKKSEKEKHLDEEERRKRKEEKKRKREKEHCDSE
FT                   GEADAFDPGKKVEVEPPPDRPVRACRTQPAENESTPIQRLLEHFLRQLQRKDPHGFFAF
FT                   PVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVY
FT                   YKLAKKILHAGFKMMSKERLLALKRSMSFMQDMDFSQQAALLGSEDPAAEEPVPEVVPV
FT                   QVETTKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVLALVEHAADEARDRINRFLPG
FT                   GKMGYLKKLGDGSLLYSVVNAPEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDERRNK
FT                   VTFLSSASTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQCALSLQEFVKDAGSYSKK
FT                   MVDDLLDQITGGDHSRMIFQLKQRRSIPMRPADEMKVGDPLGESGGPVLDFMSMKQYPD
FT                   VSLDVSMLSSLGKVKKELDHEDSHLNLDETARLLQDLHEAQAERGGSRPSSNLSSLSTA
FT                   SEREHPPPGSPSRLSVGEQPDVAHDPYEFLQSPEPAAPAKN"
FT   CDS             join(5414093..5414144,5414633..5414847,5415064..5415196,
FT                   5416436..5416496,5416845..5416989,5418143..5418253,
FT                   5418890..5419005,5420925..5421057,5422283..5422358,
FT                   5423876..5423971,5426274..5426406,5427733..5427844,
FT                   5430744..5430782,5431621..5431723,5433912..5434079,
FT                   5436437..5436537)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124248"
FT                   /product="mCG124248, isoform CRA_b"
FT                   /note="gene_id=mCG124248.2 transcript_id=mCT180418.0
FT                   protein_id=mCP103340.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0R4J175"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR021900"
FT                   /db_xref="MGI:MGI:2145317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J175"
FT                   /protein_id="EDL37078.1"
FT                   /translation="MGKKHKKHKAEWRSSYEDYTDTPLEKPLKLVLKVGGSEVTELSGS
FT                   GHDSSYYDDRSDHERERHREKKKKKKKKSEKEKHLDEEERRKRKEEKKRKREKEHCDSE
FT                   GEADAFDPGKKVEVEPPPDRPVRACRTQPAENESTPIQRLLEHFLRQLQRKDPHGFFAF
FT                   PVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVY
FT                   YKLAKKILHAGFKMMSKQAALLGSEDPAAEEPVPEVVPVQVETTKKSKKPSREVISCMF
FT                   EPEGNACSLTDSTAEEHVLALVEHAADEARDRINRFLPGGKMGYLKKLGDGSLLYSVVN
FT                   APEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDERRNKVTFLSSASTALSMQNNSVFG
FT                   DLKSDEMELLYSAYGDETGVQCALSLQEFVKDAGSYSKKMVDDLLDQITGGDHSRMIFQ
FT                   LKQRRSIPMRPADEMKVGDPLGESGGPVLDFMSMKQYPDVSLDVSMLSSLGKVKKELDH
FT                   EDSHLNLDETARLLQDLHEAQAERGGSRPSSNLSSLSTASEREHPPPGSPSRLSVGEQP
FT                   DVAHDPYEFLQSPEPAAPAKN"
FT   CDS             join(<5416804..5416989,5418143..5418253,5418890..5419005,
FT                   5420925..5421057,5422283..5422358,5423876..5423971,
FT                   5426274..5426406,5427733..5427844,5430744..5430782,
FT                   5431621..5431723,5433912..5434079,5436437..5436537)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124248"
FT                   /product="mCG124248, isoform CRA_c"
FT                   /note="gene_id=mCG124248.2 transcript_id=mCT193517.0
FT                   protein_id=mCP114489.0 isoform=CRA_c"
FT                   /protein_id="EDL37079.1"
FT                   /translation="TLEFFHFKAIFAFRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGT
FT                   MKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALL
FT                   GSEDPAAEEPVPEVVPVQVETTKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVLALV
FT                   EHAADEARDRINRFLPGGKMGYLKKLGDGSLLYSVVNAPEPDADEEETHPVDLSSLSSK
FT                   LLPGFTTLGFKDERRNKVTFLSSASTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQC
FT                   ALSLQEFVKDAGSYSKKMVDDLLDQITGGDHSRMIFQLKQRRSIPMRPADEMKVGDPLG
FT                   ESGGPVLDFMSMKQYPDVSLDVSMLSSLGKVKKELDHEDSHLNLDETARLLQDLHEAQA
FT                   ERGGSRPSSNLSSLSTASEREHPPPGSPSRLSVGEQPDVAHDPYEFLQSPEPAAPAKN"
FT   gene            5440048..5469390
FT                   /locus_tag="mCG_20948"
FT                   /note="gene_id=mCG20948.1"
FT   mRNA            join(5440048..5440128,5441549..5441770,5450030..5450208,
FT                   5450985..5451086,5453583..5453707,5455571..5455726,
FT                   5459025..5459192,5461718..5461758,5468440..5468531,
FT                   5469039..5469390)
FT                   /locus_tag="mCG_20948"
FT                   /product="mCG20948"
FT                   /note="gene_id=mCG20948.1 transcript_id=mCT23808.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(5440120..5440128,5441549..5441770,5450030..5450208,
FT                   5450985..5451086,5453583..5453707,5455571..5455726,
FT                   5459025..5459192,5461718..5461728)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20948"
FT                   /product="mCG20948"
FT                   /note="gene_id=mCG20948.1 transcript_id=mCT23808.2
FT                   protein_id=mCP14069.2"
FT                   /db_xref="GOA:A0A1Y7VLH9"
FT                   /db_xref="MGI:MGI:1918414"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Y7VLH9"
FT                   /protein_id="EDL37080.1"
FT                   /translation="MKEMNICGINKNWVLPEAQENNVKKFLPRPLSRVNGWSPPLHSFQ
FT                   AISWITYLAMSIVTFGIFIPFLPYSWKYAANIVMGGVFIFHLIVHLIAITIDPADTNVR
FT                   LKKDYTQPVPAFDRSKHTHVIQNQYCHLCEVTASKKAKHCSACNKCVSGFDHHCKWLNN
FT                   CVGRRNYWFFFWSVASAAVGILGVMIILCYICIQYFVNPDELRTDPLYKEIISENTWLL
FT                   FLSLWPVPVKTPIVLSIAVMALLLAIASFVMLGHLLIFHLYLITKNMSTFDYLMKTRFK
FT                   KNLHPAEEKELPLQKKGDLPQVCLSLRAMLMEGLRPMCGGKE"
FT   assembly_gap    5443416..5443736
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    5459817..5459949
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   gene            complement(5465258..5465573)
FT                   /pseudo
FT                   /locus_tag="mCG_20949"
FT                   /note="gene_id=mCG20949.1"
FT   mRNA            complement(5465258..5465573)
FT                   /pseudo
FT                   /locus_tag="mCG_20949"
FT                   /note="gene_id=mCG20949.1 transcript_id=mCT23809.1 created
FT                   on 01-OCT-2002"
FT   gene            5485837..5510004
FT                   /gene="2900041A09Rik"
FT                   /locus_tag="mCG_124244"
FT                   /note="gene_id=mCG124244.1"
FT   mRNA            join(5485837..5485912,5497544..5497653,5497701..5497855,
FT                   5507155..5507308,5507626..5507722,5509867..5510004)
FT                   /gene="2900041A09Rik"
FT                   /locus_tag="mCG_124244"
FT                   /product="RIKEN cDNA 2900041A09, transcript variant
FT                   mCT174024"
FT                   /note="gene_id=mCG124244.1 transcript_id=mCT174024.0
FT                   created on 01-OCT-2002"
FT   mRNA            join(5485837..5485912,5497544..5497855,5507155..5507308,
FT                   5507626..5508103)
FT                   /gene="2900041A09Rik"
FT                   /locus_tag="mCG_124244"
FT                   /product="RIKEN cDNA 2900041A09, transcript variant
FT                   mCT125483"
FT                   /note="gene_id=mCG124244.1 transcript_id=mCT125483.1
FT                   created on 01-OCT-2002"
FT   gene            complement(5494939..5496587)
FT                   /pseudo
FT                   /locus_tag="mCG_20950"
FT                   /note="gene_id=mCG20950.1"
FT   mRNA            complement(5494939..5496587)
FT                   /pseudo
FT                   /locus_tag="mCG_20950"
FT                   /note="gene_id=mCG20950.1 transcript_id=mCT23810.1 created
FT                   on 01-OCT-2002"
FT   CDS             join(5497548..5497855,5507155..5507308,5507626..5507820)
FT                   /codon_start=1
FT                   /gene="2900041A09Rik"
FT                   /locus_tag="mCG_124244"
FT                   /product="RIKEN cDNA 2900041A09, isoform CRA_a"
FT                   /note="gene_id=mCG124244.1 transcript_id=mCT125483.1
FT                   protein_id=mCP54840.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3URG1"
FT                   /db_xref="InterPro:IPR008907"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR030792"
FT                   /db_xref="MGI:MGI:1920198"
FT                   /db_xref="UniProtKB/TrEMBL:Q3URG1"
FT                   /protein_id="EDL37081.1"
FT                   /translation="MADSKAKPAKAANKTPPKSPGDPARAAKRLSLESEGANEGATAAP
FT                   ELSALEEAFRRFAVHGDTRATGKEMHGKNWSKLCKDCHVIDGKNVTVTDVDIVFSKIKG
FT                   KSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGRAPVISGVTKAVSSPTVS
FT                   RLTDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGYKHAGTYDQKVQGGK"
FT   CDS             join(5497755..5497855,5507155..5507308,5507626..5507722,
FT                   5509867..5509937)
FT                   /codon_start=1
FT                   /gene="2900041A09Rik"
FT                   /locus_tag="mCG_124244"
FT                   /product="RIKEN cDNA 2900041A09, isoform CRA_b"
FT                   /note="gene_id=mCG124244.1 transcript_id=mCT174024.0
FT                   protein_id=mCP96943.0 isoform=CRA_b"
FT                   /protein_id="EDL37082.1"
FT                   /translation="MHGKNWSKLCKDCHVIDGKNVTVTDVDIVFSKIKGKSCRTITFEQ
FT                   FQEALEELAKKRFKDKSSEEAVREVHRLIEGRAPVISGVTKAVSSPTVSRLTDTSKFTG
FT                   SHKERFDQSGKGKGKHSRKATEKAFLMALTQLGLCK"
FT   gene            5510034..5512156
FT                   /locus_tag="mCG_1049991"
FT                   /note="gene_id=mCG1049991.1"
FT   mRNA            5510034..5512156
FT                   /locus_tag="mCG_1049991"
FT                   /product="mCG1049991"
FT                   /note="gene_id=mCG1049991.1 transcript_id=mCT167695.1
FT                   created on 01-OCT-2002"
FT   CDS             5511158..5511382
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049991"
FT                   /product="mCG1049991"
FT                   /note="gene_id=mCG1049991.1 transcript_id=mCT167695.1
FT                   protein_id=mCP54845.1"
FT                   /protein_id="EDL37083.1"
FT                   /translation="MEIVLNWAAQQFCHLPVVCPRELTGACPEPRPTRRGPGLPQLPVL
FT                   MNSFTGTQLYPCVYILFCSCFGIRTSWED"
FT   gene            complement(5513719..>5538613)
FT                   /gene="4933440J22Rik"
FT                   /locus_tag="mCG_20957"
FT                   /note="gene_id=mCG20957.1"
FT   mRNA            complement(join(5513719..5514733,5516456..5516567,
FT                   5519911..5520037,5523442..5523638,5525302..5525440,
FT                   5526466..5526770,5527821..5528027,5529287..5529465,
FT                   5531289..5531397,5535746..5535873,5538488..>5538613))
FT                   /gene="4933440J22Rik"
FT                   /locus_tag="mCG_20957"
FT                   /product="RIKEN cDNA 4933440J22"
FT                   /note="gene_id=mCG20957.1 transcript_id=mCT23817.2 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(5514568..5514733,5516456..5516567,
FT                   5519911..5520037,5523442..5523638,5525302..5525440,
FT                   5526466..5526770,5527821..5528027,5529287..5529465,
FT                   5531289..>5531380))
FT                   /codon_start=1
FT                   /gene="4933440J22Rik"
FT                   /locus_tag="mCG_20957"
FT                   /product="RIKEN cDNA 4933440J22"
FT                   /note="gene_id=mCG20957.1 transcript_id=mCT23817.2
FT                   protein_id=mCP14090.2"
FT                   /protein_id="EDL37084.1"
FT                   /translation="ESERKASQLHFAPEDSLNSKENFSTTLTVGRPHHLRNRCTETSAK
FT                   KCLVMDADDEAVLNLIAECEWDLSNPPGNMSSSQKEHEADLHYAQESRHLLSPLSIQHQ
FT                   CGDSARRGHEKKKVTSRGCPGHSPQDQLCGELPLQHGLPEACHMHVQHARITSQPDSVD
FT                   VEDCASSAQKSSLSSQKTVNPLPVPEKYRKRRMPGGRFQVPSDRECLSFLERADGPSSL
FT                   EDSLSRQDGLEGQSQVALSHSEALEAEERTSHGTSDPRVLSPKLCSAAVPERRSTLEVA
FT                   LLEALLDLIDRCSSGSGSLHGNEAFLAQAKHVLSSLQEFTATRDSSALEKEGIGYLSLE
FT                   NKTLQSRLAEQQQQYTATVTKMTAELNNTKRELDTLRQHLDKSLEENSHLKSLLYNVKK
FT                   EVKTADTSTALTLQITGLQASMKQLSGEVVELKQHVEHYDKIQELTQMLQESHSSLVST
FT                   NEHLLQELSRTRAQHRAEVEQMRWSFQEFKKTTALIPHRSSRRGGRQSC"
FT   assembly_gap    5534370..5534389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5538907..5539127
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    5570162..5570181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5597032..>5642270
FT                   /locus_tag="mCG_20958"
FT                   /note="gene_id=mCG20958.2"
FT   mRNA            join(5597032..5597915,5626866..5627168,5631295..5631455,
FT                   5633191..5633269,5633811..5633988,5634881..5635101,
FT                   5635435..5635637,5636427..5636516,5636633..5636703,
FT                   5637903..5638032,5639226..5639341,5639889..5640018,
FT                   5640370..5640546,5640730..5640802,5641504..5641611,
FT                   5642017..>5642270)
FT                   /locus_tag="mCG_20958"
FT                   /product="mCG20958"
FT                   /note="gene_id=mCG20958.2 transcript_id=mCT23818.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(5597720..5597915,5626866..5627168,5631295..5631455,
FT                   5633191..5633269,5633811..5633988,5634881..5635101,
FT                   5635435..5635637,5636427..5636516,5636633..5636703,
FT                   5637903..5638032,5639226..5639341,5639889..5640018,
FT                   5640370..5640546,5640730..5640802,5641504..5641611,
FT                   5642017..5642270)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20958"
FT                   /product="mCG20958"
FT                   /note="gene_id=mCG20958.2 transcript_id=mCT23818.2
FT                   protein_id=mCP14055.2"
FT                   /db_xref="GOA:G3X939"
FT                   /db_xref="InterPro:IPR004709"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018410"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="MGI:MGI:105064"
FT                   /db_xref="UniProtKB/Swiss-Prot:G3X939"
FT                   /protein_id="EDL37085.1"
FT                   /translation="MWHRALGPGWKLLLALALTSLQGARGAEEEPSSDGSFQVVTFKWH
FT                   HVQDPYIIALWILVASLAKIVFHLSHKVTSIVPESALLIVLGLVLGGIVWAADHIASFT
FT                   LTPTLFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVIGTIWNAATTGLSLYGVFLS
FT                   GLMGELKIGLLDFLLFGSLIAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVL
FT                   YNVFESFVTLGGDAVTGVDCVKGIVSFFVVSLGGTLVGVIFAFLLSLVTRFTKHVRIIE
FT                   PGFVFVISYLSYLTSEMLSLSSILAITFCGICCQKYVKANISEQSATTVRYTMKMLASG
FT                   AETIIFMFLGISAVNPDIWTWNTAFVLLTLVFISVYRAIGVVLQTWILNRYRMVQLETI
FT                   DQVVMSYGGLRGAVAYALVVLLDEKKVKEKNLFVSTTLIVVFFTVIFQGLTIKPLVQWL
FT                   KVKRSEHREPKLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSNFDRKFLSKVLMRR
FT                   SAQKSRDRILNVFHELNLKDAISYVAEGERRGSLAFIRSPSTDNMVNVDFNTPRPSTVE
FT                   ASVSYFLRENVSAVCLDMQSLEQRRRSIRDTEDMVTHHTLQQYLYKPRQEYKHLYSRHE
FT                   LTPNEDEKQDKEIFHRTMRKRLESFKSAKLGINQNKKAAKLYKRERAQKRRNSSIPNGK
FT                   LPMENLAHNYTIKEKDLELSEHEEATNYEEISGGIEFLASVTQDVASDSGAGIDNPVFS
FT                   PDEDLDPSILSRVPPWLSPGETVVPSQRARVQIPNSPSNFRRLTPFRLSNKSVDSFLQA
FT                   DGHEEQLQPAAPESTHM"
FT   gene            5645695..5646793
FT                   /locus_tag="mCG_1049992"
FT                   /note="gene_id=mCG1049992.1"
FT   mRNA            5645695..5646793
FT                   /locus_tag="mCG_1049992"
FT                   /product="mCG1049992"
FT                   /note="gene_id=mCG1049992.1 transcript_id=mCT167696.1
FT                   created on 01-OCT-2002"
FT   gene            complement(5645779..5684883)
FT                   /gene="Exoc3"
FT                   /locus_tag="mCG_20955"
FT                   /note="gene_id=mCG20955.2"
FT   mRNA            complement(join(5645779..5648450,5649502..5649629,
FT                   5650193..5650354,5656625..5656747,5658234..5658384,
FT                   5658467..5658577,5660863..5660963,5665354..5665479,
FT                   5666263..5666380,5668801..5669482,5675649..5675868,
FT                   5683100..5683290,5684851..5684883))
FT                   /gene="Exoc3"
FT                   /locus_tag="mCG_20955"
FT                   /product="exocyst complex component 3"
FT                   /note="gene_id=mCG20955.2 transcript_id=mCT23815.2 created
FT                   on 01-OCT-2002"
FT   CDS             5645790..5645891
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049992"
FT                   /product="mCG1049992"
FT                   /note="gene_id=mCG1049992.1 transcript_id=mCT167696.1
FT                   protein_id=mCP54853.1"
FT                   /protein_id="EDL37086.1"
FT                   /translation="MESPSLASLSYKTDQILRVAERAVGGSNSSHHG"
FT   CDS             complement(join(5648279..5648450,5649502..5649629,
FT                   5650193..5650354,5656625..5656747,5658234..5658384,
FT                   5658467..5658577,5660863..5660963,5665354..5665479,
FT                   5666263..5666380,5668801..5669482,5675649..5675868,
FT                   5683100..5683273))
FT                   /codon_start=1
FT                   /gene="Exoc3"
FT                   /locus_tag="mCG_20955"
FT                   /product="exocyst complex component 3"
FT                   /note="gene_id=mCG20955.2 transcript_id=mCT23815.2
FT                   protein_id=mCP14068.2"
FT                   /db_xref="GOA:Q8K0E2"
FT                   /db_xref="InterPro:IPR010326"
FT                   /db_xref="MGI:MGI:2443972"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K0E2"
FT                   /protein_id="EDL37087.1"
FT                   /translation="MCKDSACFLTMKETDLEAVATAVQRVAGMLQRPDQLDKVEQYRRR
FT                   EARKKASVEARLKAAIQSQLDGVRTGLSQLHNALNDVKDIQQSLADVSKDWRQSINTIE
FT                   SLKDVKDAVVQHSQLAAAVENLKNIFSVPEIVRETQDLIEQGALLQAHRKLMDLECSRD
FT                   GLMCEQYRMDSGNKRDMTLIHGYFGSTQGLSDELAKQLWMVLQRSLVTVRRDPTLLVSV
FT                   VRIIEREEKIDRRILDRKKQTGFVPPGRPKNWKEKMFAILDRTVTTRIEGTQADTRESD
FT                   KMWLVRHLEIIRKYVLDDLIVAKNLMVQCFPPHYEIFKNLLSMYHQALSTRMQDLASED
FT                   LEANEIVSLLTWVLNTYTSAEMMGNVELAPEVDVSALEPLLSPNIVSELLDTYMSTLTS
FT                   NIIAWLRKALETDKKDWSKETEPEADQDGYYQTTLPAIVFQMFEQNLQVAAQISEDLKT
FT                   KVLVLCLQQMNSFLSRYKDEAQLYKEEHLRNRQHPHCYVQYMIAIINNCQTFKESIISL
FT                   KRKYLKTEAEEGLCLSQPSMDGILDAIAKEGCSSLLEEVFLDLEQHLNELMTKKWLLGS
FT                   NAVDIICVTVEDYFNDFAKIKKPYKKRMTAEAHRRVVVEYLRAVMQKRISFRSAEERKE
FT                   GAEKMVREAEQLRFLFRKLASGFGEDADGHCDTIVAVAEVIKLTDPSLLYLEVSTLVSK
FT                   YPDIRDDHIGALLALRGDASRDMKQTIMETLEQGPMQASPNYVPIFKEIVVPSLNVAKL
FT                   LK"
FT   assembly_gap    5655298..5655317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5687311..5768372)
FT                   /gene="Ahrr"
FT                   /locus_tag="mCG_20962"
FT                   /note="gene_id=mCG20962.1"
FT   mRNA            complement(join(5687311..5690858,5691565..5691703,
FT                   5691936..5691997,5696734..5696930,5699094..5699227,
FT                   5700958..5701087,5706072..5706161,5733657..5733754,
FT                   5753808..5753989,5759218..5759290,5768294..5768372))
FT                   /gene="Ahrr"
FT                   /locus_tag="mCG_20962"
FT                   /product="aryl-hydrocarbon receptor repressor"
FT                   /note="gene_id=mCG20962.1 transcript_id=mCT23789.1 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(5689850..5690858,5691565..5691703,
FT                   5691936..5691997,5696734..5696930,5699094..5699227,
FT                   5700958..5701087,5706072..5706161,5733657..5733754,
FT                   5753808..5753989,5759218..5759282))
FT                   /codon_start=1
FT                   /gene="Ahrr"
FT                   /locus_tag="mCG_20962"
FT                   /product="aryl-hydrocarbon receptor repressor"
FT                   /note="gene_id=mCG20962.1 transcript_id=mCT23789.1
FT                   protein_id=mCP14072.2"
FT                   /db_xref="GOA:A0A0R4J020"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="MGI:MGI:1333776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J020"
FT                   /protein_id="EDL37088.1"
FT                   /translation="MMIPSGECTYAGRKRRKPIQKRRLTMGAEKSNPSKRHRDRLNTEL
FT                   DHLASLLPFSPDIISKLDKLSVLRLSVSYLRVKSFFQALQETCVWSAPALSPEEHSYRG
FT                   FPVQEGRLLLESLNGFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQ
FT                   DFCRQLHWAMDPPQVVFGQSPHADTDNTVLGKLLRAQEGGKGLPSEYSAFLTRCFICRV
FT                   RCLLDSTSGFLTMQFQGKLKFLFGQKKKTPSGTALPPRLSLFCIVAPVLPSVTEMKMKS
FT                   TFLKAKHRADIVVTMDSRAKAVTSLCESELHPKLNYLAGKSNGENGISLFRGQTDRSHW
FT                   ARALARSSCLCLRGGPDLLDPKGTSGDREEEDQKHILRRSPGAWGQREMHKYSYGLETP
FT                   VHLRHLNWSTEQRSQESTTKLTRQPSKNEPSTCLVPHGSCVPYPGSQGMLSASNMASFR
FT                   DSLDHPTGAYCSQMNRPLSDIHQGQVDPSTCHISQGSLGSRIPLTGMQRFTARGFSTED
FT                   AKLPSLPVTIGTPCNPVLSLDVPIKMENESGSQDIVEASTTSCLWLGTSDMARGHLVGF
FT                   PARMHLKTEPDYRQQACTPHLGHGMLGTNPYSRDTVGSCREHAPLYSAHCTCLDPEPPH
FT                   HFFMCSHSESQHPSLDQDCRAPIVKREPLDSPSWAAPGQVTVPRMFPKSASKTVIPSKG
FT                   SDGIFLP"
FT   assembly_gap    5702280..5702299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5779191..5793409)
FT                   /gene="Pdcd6"
FT                   /locus_tag="mCG_20964"
FT                   /note="gene_id=mCG20964.3"
FT   mRNA            complement(join(5779191..5780111,5781604..5781713,
FT                   5785753..5785905,5787732..5787776,5792410..5792471,
FT                   5793187..5793409))
FT                   /gene="Pdcd6"
FT                   /locus_tag="mCG_20964"
FT                   /product="programmed cell death 6, transcript variant
FT                   mCT180440"
FT                   /note="gene_id=mCG20964.3 transcript_id=mCT180440.0 created
FT                   on 14-FEB-2003"
FT   mRNA            complement(join(5779191..5780111,5781604..5781713,
FT                   5785747..5785905,5787732..5787776,5792410..5792471,
FT                   5793187..5793409))
FT                   /gene="Pdcd6"
FT                   /locus_tag="mCG_20964"
FT                   /product="programmed cell death 6, transcript variant
FT                   mCT23793"
FT                   /note="gene_id=mCG20964.3 transcript_id=mCT23793.2 created
FT                   on 14-FEB-2003"
FT   CDS             complement(join(5780013..5780111,5781604..5781713,
FT                   5785753..5785905,5787732..5787776,5792410..5792471,
FT                   5793187..5793287))
FT                   /codon_start=1
FT                   /gene="Pdcd6"
FT                   /locus_tag="mCG_20964"
FT                   /product="programmed cell death 6, isoform CRA_b"
FT                   /note="gene_id=mCG20964.3 transcript_id=mCT180440.0
FT                   protein_id=mCP103362.0 isoform=CRA_b"
FT                   /protein_id="EDL37090.1"
FT                   /translation="MAAYSYRPGPGGGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISD
FT                   NELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDR
FT                   DNSGMIDKNELKQALSGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIF
FT                   RRYDTDQDGWIQVSYEQYLSMVFSIV"
FT   CDS             complement(join(5780013..5780111,5781604..5781713,
FT                   5785747..5785905,5787732..5787776,5792410..5792471,
FT                   5793187..5793287))
FT                   /codon_start=1
FT                   /gene="Pdcd6"
FT                   /locus_tag="mCG_20964"
FT                   /product="programmed cell death 6, isoform CRA_c"
FT                   /note="gene_id=mCG20964.3 transcript_id=mCT23793.2
FT                   protein_id=mCP14091.1 isoform=CRA_c"
FT                   /protein_id="EDL37091.1"
FT                   /translation="MAAYSYRPGPGGGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISD
FT                   NELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDR
FT                   DNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTD
FT                   IFRRYDTDQDGWIQVSYEQYLSMVFSIV"
FT   mRNA            complement(join(5785465..5785905,5787732..5787776,
FT                   5792410..5792471,5793187..5793409))
FT                   /gene="Pdcd6"
FT                   /locus_tag="mCG_20964"
FT                   /product="programmed cell death 6, transcript variant
FT                   mCT171173"
FT                   /note="gene_id=mCG20964.3 transcript_id=mCT171173.1 created
FT                   on 14-FEB-2003"
FT   CDS             complement(join(5785721..5785905,5787732..5787776,
FT                   5792410..5792471,5793187..5793287))
FT                   /codon_start=1
FT                   /gene="Pdcd6"
FT                   /locus_tag="mCG_20964"
FT                   /product="programmed cell death 6, isoform CRA_a"
FT                   /note="gene_id=mCG20964.3 transcript_id=mCT171173.1
FT                   protein_id=mCP94091.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UGE5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:109283"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UGE5"
FT                   /protein_id="EDL37089.1"
FT                   /translation="MAAYSYRPGPGGGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISD
FT                   NELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDR
FT                   DNSGMIDKNELKQALSGFGNSLVLIV"
FT   gene            complement(5798335..5826195)
FT                   /gene="Sdha"
FT                   /locus_tag="mCG_20959"
FT                   /note="gene_id=mCG20959.2"
FT   mRNA            complement(join(5798335..5799254,5799922..5800035,
FT                   5803008..5803138,5803328..5803439,5804378..5804496,
FT                   5807379..5807550,5808180..5808375,5809108..5809276,
FT                   5810416..5810540,5813502..5813650,5815178..5815342,
FT                   5815703..5815846,5819476..5819637,5820819..5820905,
FT                   5826099..5826195))
FT                   /gene="Sdha"
FT                   /locus_tag="mCG_20959"
FT                   /product="succinate dehydrogenase complex, subunit A,
FT                   flavoprotein (Fp)"
FT                   /note="gene_id=mCG20959.2 transcript_id=mCT23787.2 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(5799168..5799254,5799922..5800035,
FT                   5803008..5803138,5803328..5803439,5804378..5804496,
FT                   5807379..5807550,5808180..5808375,5809108..5809276,
FT                   5810416..5810540,5813502..5813650,5815178..5815342,
FT                   5815703..5815846,5819476..5819637,5820819..5820905,
FT                   5826099..5826161))
FT                   /codon_start=1
FT                   /gene="Sdha"
FT                   /locus_tag="mCG_20959"
FT                   /product="succinate dehydrogenase complex, subunit A,
FT                   flavoprotein (Fp)"
FT                   /note="gene_id=mCG20959.2 transcript_id=mCT23787.2
FT                   protein_id=mCP14060.2"
FT                   /protein_id="EDL37092.1"
FT                   /translation="MAGVGAVSRLLRGRRLALTGAWPGTLQKQTCGFHFSVGENKKASA
FT                   KVSDAISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQ
FT                   GGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRT
FT                   EDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFAL
FT                   DLLMENGECRGVIALCIEDGSIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVT
FT                   RAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASR
FT                   DVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEP
FT                   IPVLPTVHYNMGGIPTNYKGQVLKHVNGQDQIVPGLYACGEAACASVHGANRLGANSLL
FT                   DLVVFGRACALSIAESCRPGDKVPSIKANAGEESVMNLDKLRFADGSIRTSELRLNMQK
FT                   SMQNHAAVFRVGSVLQEGCEKISQLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCAL
FT                   QTIYGAEARKESRGAHAREDYKVRVDEYDYSKPIQGQQKKPFGEHWRKHTLSYVDIKTG
FT                   KVTLEYRPVIDKTLNEADCATVPPAIRSY"
FT   assembly_gap    5809754..5809773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5826273..5834801
FT                   /gene="0610011N22Rik"
FT                   /locus_tag="mCG_124230"
FT                   /note="gene_id=mCG124230.1"
FT   mRNA            join(5826273..5826361,5828808..5828938,5832355..5834801)
FT                   /gene="0610011N22Rik"
FT                   /locus_tag="mCG_124230"
FT                   /product="RIKEN cDNA 0610011N22"
FT                   /note="gene_id=mCG124230.1 transcript_id=mCT125469.1
FT                   created on 24-JUL-2002"
FT   CDS             join(5828818..5828938,5832355..5833016)
FT                   /codon_start=1
FT                   /gene="0610011N22Rik"
FT                   /locus_tag="mCG_124230"
FT                   /product="RIKEN cDNA 0610011N22"
FT                   /note="gene_id=mCG124230.1 transcript_id=mCT125469.1
FT                   protein_id=mCP54634.1"
FT                   /protein_id="EDL37093.1"
FT                   /translation="MNNLNDPPNWNIRPNARADGGDGSKWNYALLVPMLGLAAFRWIWS
FT                   RESQKEIEKARKAYHQRTAAFQQDLEAKYHAVISEHRRAVAQLSLELEKEQNRTSSFRE
FT                   ALISQGRKLAEEKKLLEQERAQIKQEKSRLQPLRNVYLSCLQEEDDWQRRAQHVLKEVG
FT                   EALEERQNIYCSLIIPRSARLELEKSLLVRTSVDPVAADLEMAAGLSDIFKHDKHCGDV
FT                   WNTNKRQNGKLMWMYLKYWELLVELKKFKKVEKVILEK"
FT   assembly_gap    5834802..5834821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5835989..5836008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5836009..>5840794)
FT                   /gene="AI595366"
FT                   /locus_tag="mCG_20963"
FT                   /note="gene_id=mCG20963.2"
FT   mRNA            complement(join(5836009..5838234,5839908..>5840794))
FT                   /gene="AI595366"
FT                   /locus_tag="mCG_20963"
FT                   /product="expressed sequence AI595366"
FT                   /note="gene_id=mCG20963.2 transcript_id=mCT23792.2 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(5837589..5838234,5839908..5840794))
FT                   /codon_start=1
FT                   /gene="AI595366"
FT                   /locus_tag="mCG_20963"
FT                   /product="expressed sequence AI595366"
FT                   /note="gene_id=mCG20963.2 transcript_id=mCT23792.2
FT                   protein_id=mCP14073.0"
FT                   /db_xref="GOA:Q3UJB3"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:2145269"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3UJB3"
FT                   /protein_id="EDL37094.1"
FT                   /translation="MRSLRFISAEALVSHSQLVQENLDNIAYNLYPLLFKASYLLEQAD
FT                   VTRALLSHWPLEEFRLAVLLRPNTDHPEDLRDRACKACLEACMQGIADHVLKSGSNRLR
FT                   VADFTGIQDVQVQQCPCGRALGRWGRTKVLARTCCQLQGQPCSAGHPIEVFADLFVTEG
FT                   NFDMVVQALKPLGPAPLQVCCPSLRADSLSPGQLLQVLGLAGPGNLRKLEVVHNVRLHA
FT                   GHVQQLLTQVGFPQLTSLTLPTKAFDAPPTCAPDPEGEDLLLTSIAWELSQMNQLTELS
FT                   VAFSTLTGKIQTLLSPLKTPLRVLDLANCALNHEDISFLADCNHTAHLEVLDLSGHNLV
FT                   HLYPSTFFRLLSQAAQTLRVLTLEECNITDSHVNMMILGLSPCSQLQQFKFLGNPLSGS
FT                   ALRRLFAALCELPRLRHIEFPVPKDCYPEGAIYPQDELSVSKFDQQKYDVIAEDLRAVL
FT                   LRANREDIQVSTPLFGSFDPDIHETSNELGTFLLQAFKTALENFSRALEQME"
FT   gene            complement(5848296..5914907)
FT                   /locus_tag="mCG_141242"
FT                   /note="gene_id=mCG141242.0"
FT   mRNA            complement(join(5848296..5849652,5853260..5853386,
FT                   5911732..5912737,5914502..5914562,5914781..5914907))
FT                   /locus_tag="mCG_141242"
FT                   /product="mCG141242"
FT                   /note="gene_id=mCG141242.0 transcript_id=mCT174022.0
FT                   created on 02-OCT-2002"
FT   CDS             complement(join(5848475..5849652,5853260..5853386,
FT                   5911732..5912737,5914502..5914562,5914781..5914814))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141242"
FT                   /product="mCG141242"
FT                   /note="gene_id=mCG141242.0 transcript_id=mCT174022.0
FT                   protein_id=mCP96941.0"
FT                   /protein_id="EDL37095.1"
FT                   /translation="MLETYQNITAIGYNWEDHHIEEHCQSSRRHERNERSRIGEKPYEC
FT                   YQCGKAFARHNHLQIHKRIHTGEKPYECNQCGKAFACHSRLQRHKRTHTGEKPYECNQC
FT                   GKAFARHSHLQRHEKTHNAEKSYECNQCGKAFSQQNNLQYHKRTHTGEKPYQCNQCGKA
FT                   FAFHNSLQYHKRTHTGEKPYECNQCGKAFAFQYSLQKHTRIHTGEKPYQCDQCGKAFSH
FT                   VIRLQYHKRTHTGEKPYECNQCGKAFAFHNSLQKHKRTHTGEKPYQCNQCGKAFSQQSS
FT                   LQYHKRTHTGEKPYECNQCGKAFACHNSLQKHKRTHTGEKLYQCNQCDKAFAHHNSLQY
FT                   HKRTHTGKNPYECNQCGKAFASHTHHQGWLSFRDVAIDFSAEECECLDAAQWDLYSDVM
FT                   LENYSNLVSLGTKPYKYKECNKTFVRKSLLIQHQRVHTGEKPYKCEQCGKAFSCSSSLT
FT                   PHQRIHTGEKPYKCEQCGQAFNCSSHLYKHQRIHTGEKPYKCPECGKAFNWSSSLTQHQ
FT                   RIHSGEKPYKCEECGLSFNCSHLYRHQRIHTGEKLYKCEECGKAFNCSSYLNYHQILHT
FT                   GDKPYKCRECGKAFTMVSYLTRHQRIHTGEKPYKCKECDKAFSNCSALIQHQRIHTGEK
FT                   PYKCSECGKAFNNSSSLTHHQRIHTGEKPYECKECGKAFNSSSHLNYHHRIHTGEKPYK
FT                   CEECSKAFNNFSALIQHQRIHTGEKPYKCEKCSKAFNNCSALSQHQRIHTGEKPYKCEK
FT                   CGQGFNCSSNLKQHQRIHTREKLYSCEDSGKAFNNGEALPQYHRIHTY"
FT   gene            5876567..5884199
FT                   /locus_tag="mCG_17237"
FT                   /note="gene_id=mCG17237.2"
FT   mRNA            join(5876567..5876624,5882611..5882735,5882935..5882995,
FT                   5883322..5884199)
FT                   /locus_tag="mCG_17237"
FT                   /product="mCG17237, transcript variant mCT174026"
FT                   /note="gene_id=mCG17237.2 transcript_id=mCT174026.0 created
FT                   on 02-OCT-2002"
FT   mRNA            5883232..5884199
FT                   /locus_tag="mCG_17237"
FT                   /product="mCG17237, transcript variant mCT12829"
FT                   /note="gene_id=mCG17237.2 transcript_id=mCT12829.2 created
FT                   on 02-OCT-2002"
FT   CDS             5883436..5883987
FT                   /codon_start=1
FT                   /locus_tag="mCG_17237"
FT                   /product="mCG17237, isoform CRA_a"
FT                   /note="gene_id=mCG17237.2 transcript_id=mCT12829.2
FT                   protein_id=mCP17533.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9CPX4"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014034"
FT                   /db_xref="MGI:MGI:3779109"
FT                   /db_xref="MGI:MGI:95589"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CPX4"
FT                   /protein_id="EDL37096.1"
FT                   /translation="MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVAL
FT                   EGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALAME
FT                   KNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNLRRVAGPQPAQT
FT                   GAPQGSLGEYLFERLTLKHD"
FT   CDS             5883436..5883987
FT                   /codon_start=1
FT                   /locus_tag="mCG_17237"
FT                   /product="mCG17237, isoform CRA_a"
FT                   /note="gene_id=mCG17237.2 transcript_id=mCT174026.0
FT                   protein_id=mCP96945.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9CPX4"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014034"
FT                   /db_xref="MGI:MGI:3779109"
FT                   /db_xref="MGI:MGI:95589"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CPX4"
FT                   /protein_id="EDL37097.1"
FT                   /translation="MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVAL
FT                   EGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALAME
FT                   KNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNLRRVAGPQPAQT
FT                   GAPQGSLGEYLFERLTLKHD"
FT   assembly_gap    5897042..5898059
FT                   /estimated_length=1018
FT                   /gap_type="unknown"
FT   assembly_gap    5902276..5902295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5916986..5917927
FT                   /locus_tag="mCG_1049877"
FT                   /note="gene_id=mCG1049877.1"
FT   mRNA            <5916986..5917927
FT                   /locus_tag="mCG_1049877"
FT                   /product="mCG1049877"
FT                   /note="gene_id=mCG1049877.1 transcript_id=mCT167581.1
FT                   created on 02-OCT-2002"
FT   CDS             <5917119..5917457
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049877"
FT                   /product="mCG1049877"
FT                   /note="gene_id=mCG1049877.1 transcript_id=mCT167581.1
FT                   protein_id=mCP54678.1"
FT                   /protein_id="EDL37098.1"
FT                   /translation="PMFLMDPFAIHRQHLSRMISGGFGYSPFLSITDGNMPATRPASRR
FT                   LQAGVVSPFGILGMSGGFMDMFGMMNYMIGKMEHMTAGGNCQTFSSSTVISYSNTGDGA
FT                   PKVYQETI"
FT   gene            complement(<5924186..5999320)
FT                   /locus_tag="mCG_141241"
FT                   /note="gene_id=mCG141241.0"
FT   mRNA            complement(join(<5924186..5924567,5924730..5925527,
FT                   5927126..5927141,5957489..5958042,5959431..5959491,
FT                   5959709..5959828,5985929..5986587,5987985..5988045,
FT                   5988247..5988373,5999245..5999320))
FT                   /locus_tag="mCG_141241"
FT                   /product="mCG141241"
FT                   /note="gene_id=mCG141241.0 transcript_id=mCT174023.0
FT                   created on 02-OCT-2002"
FT   CDS             complement(join(5924186..5924567,5924730..5925527,
FT                   5927126..5927141,5957489..5958042,5959431..5959491,
FT                   5959709..5959828,5985929..5986587,5987985..5988045,
FT                   5988247..5988373,5999245..5999247))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141241"
FT                   /product="mCG141241"
FT                   /note="gene_id=mCG141241.0 transcript_id=mCT174023.0
FT                   protein_id=mCP96942.0"
FT                   /protein_id="EDL37099.1"
FT                   /translation="MDAVTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIGY
FT                   KWEDHHIEEYCQSSRRHERHERIHIGEKPYERNQCGKAFASDNHLQIHKRTNTGEKPYE
FT                   CNQCGKAFSQGSTLQYHIRRHNGEKPYKCNQCGKAYGHHSSLQYHKRTHTGEKPYQCNQ
FT                   CDKAFSQHSSLEYHKITHTGEKPYECDQCGKAFAWQSSLNIHKRTHSGEKPHECNQCGK
FT                   AFVHHNSLQCHKRTHTGEKPYQCDQCGKAFTHQNNLQCHKRTHTGEKPYECNQCGKAFA
FT                   RHMTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIGYKWEDHHIEEYCQSSR
FT                   RHERHERIHIGEKPYERNQCGKAFASDNHLQIHKRTNTEEKPYECNQCGKAFSQHSRLQ
FT                   YHKRSHTGEKPYKCNQCGKAYGHHSSLQYHKRRHTGEKPYHCNQCDKAFSEHSSLEYHK
FT                   ITHLGEKPYECDQCGKAFAWQSSLNIHKRTHSGEKPYECNECGKAFTHHASLQSHKRIH
FT                   TGEKPYQCDQCEHHCYRLNYEIHKTVKTFEYGEALTWANYRYRHEKIHIGEKPYERNQC
FT                   GKAFGSDNHLQVHKRTNTGEKPYECNQCGKAFSQQSSLQYHKRTHAGQKPYECNQCGKA
FT                   LSCQRSLQYHKRTHTGEKTCECNQCGKAFVRPSQLQKHKGTHTGEKPYECNQCGKAFAH
FT                   HNNLQYHKRTHTGEKPYECDQCGKAFAVQYSLQYHKRRHTGEKPYECNECGETFAFQYS
FT                   LQYHKSTHTGEKPYECNQCGKAFPHHNNLQTIKEYIVERNLMNVIMCSLQYHKRTHTGE
FT                   KPYECDQCRKAFAWQYSLYIHKRIHTGEKPYECNQCGKAFAHHTSLQYHKRTHTGEKPY
FT                   QCDQCGKAFAHQNNLQYHKRTHTGENPYECNQCGKAFASHTHLQVHERTHFRKKP"
FT   assembly_gap    5924615..5924661
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    6005902..6006927
FT                   /estimated_length=1026
FT                   /gap_type="unknown"
FT   gene            6010414..6011581
FT                   /pseudo
FT                   /locus_tag="mCG_6315"
FT                   /note="gene_id=mCG6315.2"
FT   mRNA            6010414..6011581
FT                   /pseudo
FT                   /locus_tag="mCG_6315"
FT                   /note="gene_id=mCG6315.2 transcript_id=mCT5943.2 created on
FT                   02-OCT-2002"
FT   assembly_gap    6015493..6017968
FT                   /estimated_length=2476
FT                   /gap_type="unknown"
FT   assembly_gap    6019379..6033196
FT                   /estimated_length=13818
FT                   /gap_type="unknown"
FT   assembly_gap    6034831..6034850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6041641..6041660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6042865..6042884
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6054755..6067942)
FT                   /locus_tag="mCG_141240"
FT                   /note="gene_id=mCG141240.0"
FT   mRNA            complement(join(6054755..6056402,6057718..6057778,
FT                   6057979..6058105,6067873..6067942))
FT                   /locus_tag="mCG_141240"
FT                   /product="mCG141240"
FT                   /note="gene_id=mCG141240.0 transcript_id=mCT174021.0
FT                   created on 02-OCT-2002"
FT   CDS             complement(join(6055115..6056402,6057718..6057778,
FT                   6057979..6058105,6067873..6067875))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141240"
FT                   /product="mCG141240"
FT                   /note="gene_id=mCG141240.0 transcript_id=mCT174021.0
FT                   protein_id=mCP96940.0"
FT                   /protein_id="EDL37100.1"
FT                   /translation="MDAVTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIGY
FT                   NLEDHHIEEHSQSSRRHERPNYEIHKTVKTFEYGEALTWANYRYRHERIHIGEKPYERN
FT                   QWGKAFASDNHLQIHKKTNTGEKPYECNQCGKAFSQQSSLQYHKRTHAGQKPYECNQCG
FT                   KALSCQRSLQYHKRTHTGEKPYECHQCGKAFVSPSQLQKHKRTHTGEKPYECNQCGKAF
FT                   ANHNNLQRHKRTHTGEKPYECNQCGKAFANHNNLQCHKRTHTGEKPFECNQCGKAFAWQ
FT                   CTLQKHKRTHTGEKLYQCNQCDKAFSQHSTLQYHKRIHTGEKPYECNQCGKAFAWQSSL
FT                   DMHKRKHTGEKPYECDQCGKAFTWQSSLNMHKRKHTGEKPYECDQCGKAFQWQYSLHIH
FT                   KRIHTGEKPYECNECGKAFAGHTGLQSHKRAHTGEKPYQCDQCGKAFAHENNLKYHKRT
FT                   HTGKNSYECNQCGKAFASHSHLQVHERTHFRKKP"
FT   assembly_gap    6059087..6059106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6067346..6067365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6082871..6093902)
FT                   /locus_tag="mCG_141239"
FT                   /note="gene_id=mCG141239.0"
FT   mRNA            complement(join(6082871..6084336,6085723..6085783,
FT                   6086801..6086927,6087865..6087988,6089325..6089549,
FT                   6093827..6093902))
FT                   /locus_tag="mCG_141239"
FT                   /product="mCG141239"
FT                   /note="gene_id=mCG141239.0 transcript_id=mCT174020.0
FT                   created on 02-OCT-2002"
FT   CDS             complement(join(6083379..6084336,6085723..6085783,
FT                   6086801..6086927,6087865..6087921))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141239"
FT                   /product="mCG141239"
FT                   /note="gene_id=mCG141239.0 transcript_id=mCT174020.0
FT                   protein_id=mCP96939.0"
FT                   /protein_id="EDL37101.1"
FT                   /translation="MASVHDINTTQGFRVIGLQDAVTYDDVRVNFTEEEWDLLDPSQKS
FT                   LYEEVMLETYQNITAIGYNWEDHHIEEHCQSSRRHERHERIHIGEKPYERNQWGKAFAS
FT                   DNHLQIRKRTNTGEKPYECNQCGKAFSQQSSLQYHKRTYAGQKPYECNQCGKALSCQRN
FT                   LQYHKRTHTGEKPYECNQCGKAFTHYNNLRYHKRTHTGEKPYECNQCGKAFARYNNLQC
FT                   HKRTHTGEKPHVCDQCGKTFAWQYTLQKHKRIHTGEKPYQCSQCDKAFSEHSSLQYHKR
FT                   THTGEKPYECDQCGKAFAWQCSLHIHKRTHSGEKPYECNECGKAFAHHTSLQSHKRIHT
FT                   GEKPYQCDQCGKAFAHQNNLQYHKRTHTGEKPYECNQCGKAFASHSHLQIHERTHFRKN
FT                   P"
FT   assembly_gap    6089795..6089857
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    6100862..6101111
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    6110506..6113300
FT                   /estimated_length=2795
FT                   /gap_type="unknown"
FT   gene            6116952..6169599
FT                   /gene="Arts1"
FT                   /locus_tag="mCG_15004"
FT                   /note="gene_id=mCG15004.2"
FT   mRNA            join(6116952..6117024,6123281..6123824,6134744..6134882,
FT                   6137381..6137515,6139294..6139414,6140394..6140548,
FT                   6141094..6141207,6143084..6143215,6143429..6143560,
FT                   6143703..6143774,6144943..6145097,6146385..6146464,
FT                   6148293..6148476,6149729..6149885,6150580..6150764,
FT                   6151607..6151768,6152248..6152388,6152810..6152891,
FT                   6167287..6169599)
FT                   /gene="Arts1"
FT                   /locus_tag="mCG_15004"
FT                   /product="type 1 tumor necrosis factor receptor shedding
FT                   aminopeptidase regulator"
FT                   /note="gene_id=mCG15004.2 transcript_id=mCT13856.2 created
FT                   on 24-JUL-2002"
FT   assembly_gap    6117712..6117863
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   CDS             join(6123334..6123824,6134744..6134882,6137381..6137515,
FT                   6139294..6139414,6140394..6140548,6141094..6141207,
FT                   6143084..6143215,6143429..6143560,6143703..6143774,
FT                   6144943..6145097,6146385..6146464,6148293..6148476,
FT                   6149729..6149885,6150580..6150764,6151607..6151768,
FT                   6152248..6152388,6152810..6152891,6167287..6167442)
FT                   /codon_start=1
FT                   /gene="Arts1"
FT                   /locus_tag="mCG_15004"
FT                   /product="type 1 tumor necrosis factor receptor shedding
FT                   aminopeptidase regulator"
FT                   /note="gene_id=mCG15004.2 transcript_id=mCT13856.2
FT                   protein_id=mCP6218.1"
FT                   /db_xref="GOA:Q9EQH2"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR033520"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="MGI:MGI:1933403"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQH2"
FT                   /protein_id="EDL37102.1"
FT                   /translation="MPSLLPLVLTFLSVSSPSWCQNSDIESLKASNGDSFPWNNMRLPE
FT                   YMTPIHYDLMIHANLSTLTFWGKTEVEIIASRPTSTIIMHSHHLQISKATLRRGAGEML
FT                   SEEPLKVLEYPAHEQVALLAAQPLLAGSLYTVIIDYAANLSESFHGFYKSTYRTQEGEM
FT                   RILAATQFEPTAARMAFPCFDEPALKASFSIKIKRDPRHLAISNMPLVKSVNVAEGLIE
FT                   DHFDITVKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEF
FT                   YEDYFNIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESSLLYDKEKSSASSKLGITMIV
FT                   SHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVTVTHPELKVEDYFFGKCFNAMEV
FT                   DALNSSHPVSTPVENPAQIREMFDDVSYEKGACILNMLRDYLSADTFKRGIVQYLQKYS
FT                   YKNTKNEDLWNSMMHICPTDGTQTMDGFCSRSQHSSSTSHWRQEVVDVKTMMNTWTLQK
FT                   GFPLITITVSGRNVHMKQEHYMKGSERFPETGYLWHVPLTFITSKSDSVQRFLLKTKTD
FT                   VLILPEAVQWIKFNVGMNGYYIVHYADDGWASLSGLLKEAHTTISSNDRASLINNAFQL
FT                   VSIEKLSIEKALDLTLYLKNETEIMPIFQALNELIPMYKLMEKRDMIEVETQFKDFLLK
FT                   LLKDLIDKQTWTDEGSVSERMLRSQLLLLACVRNYQPCVQRAERYFREWKSSNGNMSIP
FT                   IDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFK
FT                   GEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQF
FT                   STRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL
FT                   "
FT   assembly_gap    6138693..6138713
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    6162588..6166705
FT                   /estimated_length=4118
FT                   /gap_type="unknown"
FT   gene            complement(6168123..6275110)
FT                   /gene="Cast"
FT                   /locus_tag="mCG_15003"
FT                   /note="gene_id=mCG15003.2"
FT   mRNA            complement(join(6168123..6171545,6172603..6172664,
FT                   6175815..6175883,6177334..6177426,6177926..6177961,
FT                   6179268..6179360,6180811..6180915,6183796..6183894,
FT                   6191082..6191153,6191327..6191377,6194894..6194977,
FT                   6195480..6195581,6197391..6197486,6198456..6198545,
FT                   6201194..6201241,6202209..6202292,6205345..6205446,
FT                   6206860..6206949,6207051..6207137,6207705..6207743,
FT                   6208333..6208413,6209952..6210050,6211466..6211534,
FT                   6214747..6214836,6216100..6216213,6216692..6216745,
FT                   6218314..6218352,6218914..6218970,6224501..6224560,
FT                   6264905..6264967,6274737..6275110))
FT                   /gene="Cast"
FT                   /locus_tag="mCG_15003"
FT                   /product="calpastatin, transcript variant mCT13855"
FT                   /note="gene_id=mCG15003.2 transcript_id=mCT13855.2 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(6168123..6171545,6172603..6172664,
FT                   6175815..6175883,6177334..6177426,6177926..6177961,
FT                   6179268..6179360,6180811..6180912,6183796..6183894,
FT                   6191082..6191153,6191327..6191377,6194894..6194977,
FT                   6195480..6195581,6197391..6197486,6198456..6198545,
FT                   6201194..6201241,6202209..6202292,6204128..6204377))
FT                   /gene="Cast"
FT                   /locus_tag="mCG_15003"
FT                   /product="calpastatin, transcript variant mCT174025"
FT                   /note="gene_id=mCG15003.2 transcript_id=mCT174025.0 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(6172611..6172664,6175815..6175883,
FT                   6177334..6177426,6177926..6177961,6179268..6179360,
FT                   6180811..6180915,6183796..6183894,6191082..6191153,
FT                   6191327..6191377,6194894..6194977,6195480..6195581,
FT                   6197391..6197486,6198456..6198545,6201194..6201241,
FT                   6202209..6202292,6205345..6205446,6206860..6206949,
FT                   6207051..6207137,6207705..6207743,6208333..6208413,
FT                   6209952..6210050,6211466..6211534,6214747..6214836,
FT                   6216100..6216213,6216692..6216745,6218314..6218352,
FT                   6218914..6218970,6224501..6224560,6264905..6264967,
FT                   6274737..6274811))
FT                   /codon_start=1
FT                   /gene="Cast"
FT                   /locus_tag="mCG_15003"
FT                   /product="calpastatin, isoform CRA_b"
FT                   /note="gene_id=mCG15003.2 transcript_id=mCT13855.2
FT                   protein_id=mCP6235.2 isoform=CRA_b"
FT                   /protein_id="EDL37104.1"
FT                   /translation="MSQPGPKPAASPRPSRGAAARHTQEHVNEKNIGSSSKPGEKKGSD
FT                   EVTASSAATSKSPSMSTTETKAIPVNKQLEGPDQKRPREQAVKTESKKPQSSEQPVVHE
FT                   KKSKGGPKEGSEPKNLPKHTSSTGSKHAHKEKALSRSNEQMVSEKPSESKTKFQDVPSA
FT                   GGESVAGGGTVATALDKVVGKKKEQKPFTPASPVQSTPSKPSDKSGMDAALDDLIDTLG
FT                   GHEDTNRDDPPYTGPVVLDPMYSTYLEALGIKEGTIPPEYRKLLEKNEGITQPLPDSPK
FT                   PMGTDQAIDALSSDFTCSSPTGKQSEKEKSTGEIFKAQSAGVTRSSVPPKEKKRKVEEE
FT                   VINDQALQALSDSLGTRQPDPPSHVSQAEQVKEAKAKEERQEKCGEDEDTVPAEYRLKP
FT                   AKDKDGKPLLPEPEETSKSLSESELIGELSADFDRSTYQDKPSTPAEKKSNDTSQTPPG
FT                   ETVPRASMCSIRSAPPKLASLKGVVPEDAVETLAGSLGTREADPEHEKTVEDKVKEKAK
FT                   EEEHEKLGEKEETVPPDYRLEEVKDKDGKPLLPKESQEQLAPLSDDFLLDALSQDFSSP
FT                   ANISSLEFEDAKLSAAISEVVSQTPAPSTHAAAPLPGTEQKDKELDDALDELSDSLGQR
FT                   PPDPDENKPLDDKVKEKIKPEHSEKLGERDDTIPPEYRHLLDNDGKDKPEKPPTKKTEK
FT                   PDQDRDPIDALSEDLDSCPSTTETSKNTAKGKSKKTSSSKASKDGEKTKDSSKKTEEVS
FT                   KPKAKEDARHS"
FT   CDS             complement(join(6172611..6172664,6175815..6175883,
FT                   6177334..6177426,6177926..6177961,6179268..6179360,
FT                   6180811..6180912,6183796..6183894,6191082..6191153,
FT                   6191327..6191377,6194894..6194977,6195480..6195581,
FT                   6197391..6197486,6198456..6198545,6201194..6201241,
FT                   6202209..6202292,6204128..6204292))
FT                   /codon_start=1
FT                   /gene="Cast"
FT                   /locus_tag="mCG_15003"
FT                   /product="calpastatin, isoform CRA_a"
FT                   /note="gene_id=mCG15003.2 transcript_id=mCT174025.0
FT                   protein_id=mCP96944.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1098236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Y7VJN8"
FT                   /protein_id="EDL37103.1"
FT                   /translation="MGQFLSSTFWEGSPAAVWQEKLREGERKGAGETIPILQDHVICSE
FT                   EREHGSKHHEAKAKEERQEKCGEDEDTVPAEYRLKPAKDKDGKPLLPEPEETSKSLSES
FT                   ELIGELSADFDRSTYQDKPSTPAEKKSNDTSQTPPGETVPRASMCSIRSAPPKLASLKG
FT                   VVPEDAVETLAGSLGTREADPEHEKTVEDKVKEKAKEEEHEKLGEKEETVPPDYRLEEV
FT                   KDKDGKPLLPKESQEQLAPLSDDFLLDALSQDFSSPANISSLEFEDAKLSAAISEVVSQ
FT                   TPAPSTHAAAPLPGTEKDKELDDALDELSDSLGQRPPDPDENKPLDDKVKEKIKPEHSE
FT                   KLGERDDTIPPEYRHLLDNDGKDKPEKPPTKKTEKPDQDRDPIDALSEDLDSCPSTTET
FT                   SKNTAKGKSKKTSSSKASKDGEKTKDSSKKTEEVSKPKAKEDARHS"
FT   assembly_gap    6182268..6182369
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    6193929..6193948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6221775..6222083
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   gene            complement(6237797..6239100)
FT                   /pseudo
FT                   /locus_tag="mCG_15000"
FT                   /note="gene_id=mCG15000.1"
FT   mRNA            complement(6237797..6239100)
FT                   /pseudo
FT                   /locus_tag="mCG_15000"
FT                   /note="gene_id=mCG15000.1 transcript_id=mCT13852.1 created
FT                   on 02-OCT-2002"
FT   assembly_gap    6240365..6240384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6244369..6244388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6249032..6249051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6252260..6252279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6253399..6253418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6254996..6259634
FT                   /estimated_length=4639
FT                   /gap_type="unknown"
FT   assembly_gap    6276885..6276904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6278314..6278333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6279602..6280428
FT                   /estimated_length=827
FT                   /gap_type="unknown"
FT   assembly_gap    6281757..6281814
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    6287338..6287449
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    6290778..6291170
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    6304918..6309794
FT                   /estimated_length=4877
FT                   /gap_type="unknown"
FT   assembly_gap    6312885..6312904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6314920..6315317
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    6319494..6322494
FT                   /estimated_length=3001
FT                   /gap_type="unknown"
FT   assembly_gap    6324555..6324574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6333998..6335035
FT                   /locus_tag="mCG_15001"
FT                   /note="gene_id=mCG15001.2"
FT   mRNA            join(6333998..6334411,6334504..6335035)
FT                   /locus_tag="mCG_15001"
FT                   /product="mCG15001"
FT                   /note="gene_id=mCG15001.2 transcript_id=mCT13853.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(6334061..6334411,6334504..6334551)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15001"
FT                   /product="mCG15001"
FT                   /note="gene_id=mCG15001.2 transcript_id=mCT13853.2
FT                   protein_id=mCP6230.2"
FT                   /protein_id="EDL37105.1"
FT                   /translation="MSKSESPKEPEQLRKLFIGGLSFATADESQRSHFEQWGVLTDCVG
FT                   MRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSHRLGAHLTV
FT                   KKILVGGIKEDRTNITYKIILSSMGRLK"
FT   assembly_gap    6335036..6340307
FT                   /estimated_length=5272
FT                   /gap_type="unknown"
FT   assembly_gap    6348138..6348157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6382590..6383273
FT                   /estimated_length=684
FT                   /gap_type="unknown"
FT   assembly_gap    6386858..6386877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6388553..6388612
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    6417118..6417428
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    6470255..6470830
FT                   /estimated_length=576
FT                   /gap_type="unknown"
FT   assembly_gap    6472057..6472829
FT                   /estimated_length=773
FT                   /gap_type="unknown"
FT   assembly_gap    6496049..6496173
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    6498884..6498903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6554449..6554468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6559816..6602783
FT                   /gene="Pcsk1"
FT                   /locus_tag="mCG_15002"
FT                   /note="gene_id=mCG15002.2"
FT   mRNA            join(6559816..6560195,6563037..6563141,6566244..6566354,
FT                   6567855..6568001,6569231..6569307,6575905..6575993,
FT                   6580772..6580944,6582496..6582708,6585191..6585291,
FT                   6595804..6596037,6596678..6596835,6597764..6597897,
FT                   6599996..6600157,6601896..6602783)
FT                   /gene="Pcsk1"
FT                   /locus_tag="mCG_15002"
FT                   /product="proprotein convertase subtilisin/kexin type 1"
FT                   /note="gene_id=mCG15002.2 transcript_id=mCT13854.2 created
FT                   on 25-JUL-2002"
FT   CDS             join(6560016..6560195,6563037..6563141,6566244..6566354,
FT                   6567855..6568001,6569231..6569307,6575905..6575993,
FT                   6580772..6580944,6582496..6582708,6585191..6585291,
FT                   6595804..6596037,6596678..6596835,6597764..6597897,
FT                   6599996..6600157,6601896..6602273)
FT                   /codon_start=1
FT                   /gene="Pcsk1"
FT                   /locus_tag="mCG_15002"
FT                   /product="proprotein convertase subtilisin/kexin type 1"
FT                   /note="gene_id=mCG15002.2 transcript_id=mCT13854.2
FT                   protein_id=mCP6233.1"
FT                   /db_xref="GOA:Q32MU0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022005"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR032815"
FT                   /db_xref="InterPro:IPR034182"
FT                   /db_xref="MGI:MGI:97511"
FT                   /db_xref="UniProtKB/TrEMBL:Q32MU0"
FT                   /protein_id="EDL37106.1"
FT                   /translation="MEQRGWTLQCTAFAFFCVWCALNSVKAKRQFVNEWAAEIPGGQEA
FT                   ASAIAEELGYDLLGQIGSLENHYLFKHKSHPRRSRRSALHITKRLSDDDRVTWAEQQYE
FT                   KERSKRSVQKDSALDLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWEKGITGKGVVI
FT                   TVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDLTNENKHGTRCAGEIAMQANN
FT                   HKCGVGVAYNSKVGGIRMLDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPG
FT                   RLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLS
FT                   PWYAEKCSSTLATSYSSGDYTDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEAN
FT                   PNLTWRDMQHLVVWTSEYDPLASNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTW
FT                   RNVPEKKECVVKDNNFEPRALKANGEVIVEIPTRACEGQENAIKSLEHVQFEATIEYSR
FT                   RGDLHVTLTSAVGTSTVLLAERERDTSPNGFKNWDFMSVHTWGENPVGTWTLKITDMSG
FT                   RMQNEGRIVNWKLILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEKMVNVVEKRPTQKS
FT                   LNGNLLVPKNSSSSNVEGRRDEQVQGTPSKAMLRLLQSAFSKNALSKQSPKKSPSAKLS
FT                   IPYESFYEALEKLNKPSKLEGSEDSLYSDYVDVFYNTKPYKHRDDRLLQALMDILNEEN
FT                   "
FT   assembly_gap    6590974..6590996
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    6614746..6614861
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    6618968..6618987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6622104..6622473
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    6643156..6647752
FT                   /estimated_length=4597
FT                   /gap_type="unknown"
FT   assembly_gap    6657153..6657172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6665625..6666346
FT                   /pseudo
FT                   /locus_tag="mCG_50034"
FT                   /note="gene_id=mCG50034.2"
FT   mRNA            6665625..6666346
FT                   /pseudo
FT                   /locus_tag="mCG_50034"
FT                   /note="gene_id=mCG50034.2 transcript_id=mCT50217.2 created
FT                   on 03-OCT-2002"
FT   assembly_gap    6675925..6680786
FT                   /estimated_length=4862
FT                   /gap_type="unknown"
FT   assembly_gap    6703392..6703442
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    6712643..6712720
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    6735086..6735114
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    6809068..6809141
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    6904285..6904304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6924724..6925005
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    6929150..6929197
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    6966992..6967011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6975842..6976590
FT                   /pseudo
FT                   /locus_tag="mCG_1049891"
FT                   /note="gene_id=mCG1049891.1"
FT   mRNA            6975842..6976590
FT                   /pseudo
FT                   /locus_tag="mCG_1049891"
FT                   /note="gene_id=mCG1049891.1 transcript_id=mCT167595.1
FT                   created on 03-OCT-2002"
FT   assembly_gap    6979326..6979345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6982114..6982942)
FT                   /pseudo
FT                   /locus_tag="mCG_1049892"
FT                   /note="gene_id=mCG1049892.1"
FT   mRNA            complement(6982114..6982942)
FT                   /pseudo
FT                   /locus_tag="mCG_1049892"
FT                   /note="gene_id=mCG1049892.1 transcript_id=mCT167596.1
FT                   created on 03-OCT-2002"
FT   gene            6982127..6982707
FT                   /pseudo
FT                   /locus_tag="mCG_141238"
FT                   /note="gene_id=mCG141238.0"
FT   mRNA            6982127..6982707
FT                   /pseudo
FT                   /locus_tag="mCG_141238"
FT                   /note="gene_id=mCG141238.0 transcript_id=mCT174019.0
FT                   created on 03-OCT-2002"
FT   assembly_gap    6982946..6983362
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   gene            complement(6989872..6990994)
FT                   /pseudo
FT                   /locus_tag="mCG_51305"
FT                   /note="gene_id=mCG51305.2"
FT   mRNA            complement(6989872..6990994)
FT                   /pseudo
FT                   /locus_tag="mCG_51305"
FT                   /note="gene_id=mCG51305.2 transcript_id=mCT51488.2 created
FT                   on 03-OCT-2002"
FT   assembly_gap    7015906..7016102
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    7018649..7018668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7037441..7037528
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    7071392..7071479
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   gene            7111106..7111490
FT                   /pseudo
FT                   /locus_tag="mCG_5551"
FT                   /note="gene_id=mCG5551.1"
FT   mRNA            7111106..7111490
FT                   /pseudo
FT                   /locus_tag="mCG_5551"
FT                   /note="gene_id=mCG5551.1 transcript_id=mCT4833.2 created on
FT                   03-OCT-2002"
FT   assembly_gap    7151543..7151562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7169722..7169954
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   gene            7173294..7238801
FT                   /locus_tag="mCG_5549"
FT                   /note="gene_id=mCG5549.2"
FT   mRNA            join(7173294..7174289,7212699..7212820,7216331..7216494,
FT                   7222673..7222932,7228301..7228425,7228568..7228652,
FT                   7229933..7230500,7232540..7232606,7235935..7236106,
FT                   7236943..7236987,7237077..7238801)
FT                   /locus_tag="mCG_5549"
FT                   /product="mCG5549"
FT                   /note="gene_id=mCG5549.2 transcript_id=mCT4832.2 created on
FT                   25-JUL-2002"
FT   CDS             join(7174143..7174289,7212699..7212820,7216331..7216494,
FT                   7222673..7222932,7228301..7228425,7228568..7228652,
FT                   7229933..7230500,7232540..7232606,7235935..7236106,
FT                   7236943..7236987,7237077..7237193)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5549"
FT                   /product="mCG5549"
FT                   /note="gene_id=mCG5549.2 transcript_id=mCT4832.2
FT                   protein_id=mCP6234.2"
FT                   /protein_id="EDL37107.1"
FT                   /translation="MAAGGAAGLREEQRYGLACGRLGQDNITVLHVKLTETAIRALETY
FT                   QSHKLMKIPKNDPFNEVQNFNFYLSNVGRDNPQGSFDCIQQTLSSSGASQLNCLGFIQD
FT                   KITVCATNDSYQMTRERMTQAEEESRNRSTKVIKPGGPYVGKRVQIRKAPQAISDTVPE
FT                   RKRSTPMNPANTIRKMHSGNSVSQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDK
FT                   NSLGAILQQVANLNPKDLSYTLKDYVFKELQRDWPGYSETDRQTLDLVLSRKLNPSQNA
FT                   STSRSESPLCSSKDAASSPQKRPLDSDFIDPLMNKKARISHLTNRVPPTLNGHLNPTSE
FT                   KSCAGLLPPPAAAAIPTLSPLPSTHLPVSNPPQTVNSNSNSPSTPEGLGTQDLPVDSFS
FT                   QNGSIFEDQQEKYTSRTCLETLPPSSALLKCPKPMEEEHPVSHKKSKKKSKKHKEKDQI
FT                   KKLDIETMEEKEEDLQREETAKLSNASPNPNEGVKEGCTASMEPSSALELPDYLIKYIA
FT                   IVSYEQRQNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQNVHEEV
FT                   LQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGEFDQQQAESWH"
FT   assembly_gap    7182539..7182567
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    7228066..7228140
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   gene            7268893..7269497
FT                   /pseudo
FT                   /locus_tag="mCG_116367"
FT                   /note="gene_id=mCG116367.1"
FT   mRNA            7268893..7269497
FT                   /pseudo
FT                   /locus_tag="mCG_116367"
FT                   /note="gene_id=mCG116367.1 transcript_id=mCT117487.1
FT                   created on 03-OCT-2002"
FT   assembly_gap    7282515..7282534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7284320..7284357
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    7289534..7289553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7295203..7295222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7307958..7318366
FT                   /gene="Glrx"
FT                   /locus_tag="mCG_5555"
FT                   /note="gene_id=mCG5555.3"
FT   mRNA            join(7307958..7308248,7315465..7315593,7317455..7318366)
FT                   /gene="Glrx"
FT                   /locus_tag="mCG_5555"
FT                   /product="glutaredoxin, transcript variant mCT4827"
FT                   /note="gene_id=mCG5555.3 transcript_id=mCT4827.3 created on
FT                   14-FEB-2003"
FT   mRNA            join(7307958..7308248,7315465..7315593,7317459..7318366)
FT                   /gene="Glrx"
FT                   /locus_tag="mCG_5555"
FT                   /product="glutaredoxin, transcript variant mCT180449"
FT                   /note="gene_id=mCG5555.3 transcript_id=mCT180449.0 created
FT                   on 14-FEB-2003"
FT   CDS             join(7308042..7308248,7315465..7315581)
FT                   /codon_start=1
FT                   /gene="Glrx"
FT                   /locus_tag="mCG_5555"
FT                   /product="glutaredoxin, isoform CRA_a"
FT                   /note="gene_id=mCG5555.3 transcript_id=mCT180449.0
FT                   protein_id=mCP103371.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U6L3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="MGI:MGI:2135625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U6L3"
FT                   /protein_id="EDL37108.1"
FT                   /translation="MAQEFVNCKIQSGKVVVFIKPTCPYCRKTQEILSQLPFKQGLLEF
FT                   VDITATNNTSAIQDYLQQLTGARTVPRVFIGKDCIGGCSDLISMQQTGELMTRLKQIGA
FT                   LQL"
FT   CDS             join(7308042..7308248,7315465..7315581)
FT                   /codon_start=1
FT                   /gene="Glrx"
FT                   /locus_tag="mCG_5555"
FT                   /product="glutaredoxin, isoform CRA_a"
FT                   /note="gene_id=mCG5555.3 transcript_id=mCT4827.3
FT                   protein_id=mCP6217.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U6L3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="MGI:MGI:2135625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U6L3"
FT                   /protein_id="EDL37109.1"
FT                   /translation="MAQEFVNCKIQSGKVVVFIKPTCPYCRKTQEILSQLPFKQGLLEF
FT                   VDITATNNTSAIQDYLQQLTGARTVPRVFIGKDCIGGCSDLISMQQTGELMTRLKQIGA
FT                   LQL"
FT   assembly_gap    7330074..7330894
FT                   /estimated_length=821
FT                   /gap_type="unknown"
FT   assembly_gap    7332087..7332106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7338130..7412035)
FT                   /gene="Rhobtb3"
FT                   /locus_tag="mCG_5557"
FT                   /note="gene_id=mCG5557.2"
FT   mRNA            complement(join(7338130..7339492,7343189..7343285,
FT                   7344396..7344562,7345820..7345993,7361018..7361138,
FT                   7370248..7370360,7378677..7379042,7381391..7381502,
FT                   7385722..7385876,7407526..7407712,7411316..7411541,
FT                   7411640..7412035))
FT                   /gene="Rhobtb3"
FT                   /locus_tag="mCG_5557"
FT                   /product="Rho-related BTB domain containing 3, transcript
FT                   variant mCT4825"
FT                   /note="gene_id=mCG5557.2 transcript_id=mCT4825.2 created on
FT                   03-OCT-2002"
FT   mRNA            complement(join(7338130..7339492,7343189..7343285,
FT                   7344396..7344562,7345820..7345993,7361018..7361138,
FT                   7370248..7370360,7378677..7379042,7381391..7381502,
FT                   7385722..7385876,7407526..7407712,7411316..7412035))
FT                   /gene="Rhobtb3"
FT                   /locus_tag="mCG_5557"
FT                   /product="Rho-related BTB domain containing 3, transcript
FT                   variant mCT174028"
FT                   /note="gene_id=mCG5557.2 transcript_id=mCT174028.0 created
FT                   on 03-OCT-2002"
FT   CDS             complement(join(7339377..7339492,7343189..7343285,
FT                   7344396..7344562,7345820..7345993,7361018..7361138,
FT                   7370248..7370360,7378677..7379042,7381391..7381502,
FT                   7385722..7385876,7407526..7407712,7411316..7411541,
FT                   7411640..7411641))
FT                   /codon_start=1
FT                   /gene="Rhobtb3"
FT                   /locus_tag="mCG_5557"
FT                   /product="Rho-related BTB domain containing 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5557.2 transcript_id=mCT4825.2
FT                   protein_id=mCP6221.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q9CTN4"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031260"
FT                   /db_xref="MGI:MGI:1920546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CTN4"
FT                   /protein_id="EDL37111.1"
FT                   /translation="MSIHIVALGNEGDTFHQDNRPSGLIRTYLGRSPLVSGDESSLLLN
FT                   AASTVARPVFTEYQASAFGNVKLVVHDCPVWDIFDSDWYTSRNLIGGADIIVIKYNVND
FT                   KFSFHEVKDNYIPVIKRASNSVPVIIAAVGTRQNEELPCTCPLCTSDRGSCVTTTEGIQ
FT                   LAKELGATYLELHSLDDFYIGKYFGGVLEYFMIQALNQKTSEKMKKRKMTSSFHGIRPP
FT                   QLEQPEKMPVLKAEASHYHSDLNNLLLCCQCVDVVFYHPEVTGVVEAHKIVLCSVSHVF
FT                   MLLFNVKSPADIQDSSIIRTTQDLFAINRDAVLPGASQEAPSNPPLPVIVKDALFCSCL
FT                   SDILRFIYSGAFQWEELEEDVRRKLKDSGDVSDIIEKVKCILKTPGKINCLRNCKTYQA
FT                   RKPLWFYNTSLKFFLNKPMLADVVFEIQGATVPAHRAILVARCEVMAAMFNGNYMEAKS
FT                   VLIPVYGVSKETFLSFLEYLYTDSCCPAGIFQAMCLLICAEMYQVSRLQHICELFIITQ
FT                   LQSMPSRELASMNLDIVDLLKKAKFHHSDCLSTWLLHFIATNYLIFSQKPEFQDLSVEE
FT                   RSFVEKHRWPSNMYLKQLAEYRKYIHSRKCRCLVM"
FT   CDS             complement(join(7339377..7339492,7343189..7343285,
FT                   7344396..7344562,7345820..7345993,7361018..7361138,
FT                   7370248..7370360,7378677..7379042,7381391..7381490))
FT                   /codon_start=1
FT                   /gene="Rhobtb3"
FT                   /locus_tag="mCG_5557"
FT                   /product="Rho-related BTB domain containing 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5557.2 transcript_id=mCT174028.0
FT                   protein_id=mCP96947.0 isoform=CRA_a"
FT                   /protein_id="EDL37110.1"
FT                   /translation="MIQALNQKTSEKMKKRKMTSSFHGIRPPQLEQPEKMPVLKAEASH
FT                   YHSDLNNLLLCCQCVDVVFYHPEVTGVVEAHKIVLCSVSHVFMLLFNVKSPADIQDSSI
FT                   IRTTQDLFAINRDAVLPGASQEAPSNPPLPVIVKDALFCSCLSDILRFIYSGAFQWEEL
FT                   EEDVRRKLKDSGDVSDIIEKVKCILKTPGKINCLRNCKTYQARKPLWFYNTSLKFFLNK
FT                   PMLADVVFEIQGATVPAHRAILVARCEVMAAMFNGNYMEAKSVLIPVYGVSKETFLSFL
FT                   EYLYTDSCCPAGIFQAMCLLICAEMYQVSRLQHICELFIITQLQSMPSRELASMNLDIV
FT                   DLLKKAKFHHSDCLSTWLLHFIATNYLIFSQKPEFQDLSVEERSFVEKHRWPSNMYLKQ
FT                   LAEYRKYIHSRKCRCLVM"
FT   assembly_gap    7340501..7340784
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    7349941..7349960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7403765..7403784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7413418..7413566
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    7417719..7417815
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    7419737..7419756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7424549..7424568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7433217..7433236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7434882..7434901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7442173..7475286
FT                   /gene="Spata9"
FT                   /locus_tag="mCG_5559"
FT                   /note="gene_id=mCG5559.1"
FT   mRNA            join(7442173..7442331,7442491..7442579,7451968..7452195,
FT                   7467322..7467417,7474804..7475286)
FT                   /gene="Spata9"
FT                   /locus_tag="mCG_5559"
FT                   /product="spermatogenesis associated 9"
FT                   /note="gene_id=mCG5559.1 transcript_id=mCT4822.2 created on
FT                   03-OCT-2002"
FT   CDS             join(7442271..7442331,7442491..7442579,7451968..7452195,
FT                   7467322..7467417,7474804..7475088)
FT                   /codon_start=1
FT                   /gene="Spata9"
FT                   /locus_tag="mCG_5559"
FT                   /product="spermatogenesis associated 9"
FT                   /note="gene_id=mCG5559.1 transcript_id=mCT4822.2
FT                   protein_id=mCP6227.1"
FT                   /protein_id="EDL37112.1"
FT                   /translation="MEVRPIGWICGQVVKNFSGRLEGLQKAIMDLIDEFKDDLPTILRL
FT                   SQSSQKTDPVQKTSKVRMALALAKINRGTLIQGLNHISSSSKSVAKLLQPRLAYRLLEL
FT                   RSISHRLLREVNVASQPLHSVQMKRGSLFEIISFPAKTALTSIMYASYAALIYLAVCVN
FT                   AVLAKIKKIFQEEESIRQNRESENFRKAFSEPALRKPMFSESEIKAKPYRSLPEKPDNL
FT                   LDQPKPPANKQSNKIQVLHSVFDQLAELNE"
FT   assembly_gap    7468413..7468432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7469793..7469812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7478440..7484185)
FT                   /gene="AI256775"
FT                   /locus_tag="mCG_5554"
FT                   /note="gene_id=mCG5554.2"
FT   mRNA            complement(join(7478440..7479008,7483871..7483905,
FT                   7483999..7484185))
FT                   /gene="AI256775"
FT                   /locus_tag="mCG_5554"
FT                   /product="expressed sequence AI256775"
FT                   /note="gene_id=mCG5554.2 transcript_id=mCT4835.2 created on
FT                   03-OCT-2002"
FT   CDS             complement(join(7478745..7479008,7483871..7483905,
FT                   7483999..7484173))
FT                   /codon_start=1
FT                   /gene="AI256775"
FT                   /locus_tag="mCG_5554"
FT                   /product="expressed sequence AI256775"
FT                   /note="gene_id=mCG5554.2 transcript_id=mCT4835.2
FT                   protein_id=mCP6222.1"
FT                   /protein_id="EDL37113.1"
FT                   /translation="MDPEISEQDEEKKKYTSVCVGREEDIRKSERMTAVVHDREVVIFY
FT                   HKGEYHAMDIRCYHSGGPLHLGEIEDFNGQSCIVCPWHKYKITLATGEGLYQSINPKDP
FT                   SAKPKWCSKGVKQRIHTVKVDNGNIYVTLSKEPFKCDSDYYATGEFKVIQSSS"
FT   assembly_gap    7481430..7481638
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    7492636..7499096
FT                   /estimated_length=6461
FT                   /gap_type="unknown"
FT   assembly_gap    7500678..7502322
FT                   /estimated_length=1645
FT                   /gap_type="unknown"
FT   assembly_gap    7506967..7509796
FT                   /estimated_length=2830
FT                   /gap_type="unknown"
FT   assembly_gap    7517440..7517459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7520715..7522895)
FT                   /locus_tag="mCG_142729"
FT                   /note="gene_id=mCG142729.0"
FT   mRNA            complement(7520715..7522895)
FT                   /locus_tag="mCG_142729"
FT                   /product="mCG142729"
FT                   /note="gene_id=mCG142729.0 transcript_id=mCT181971.0
FT                   created on 17-APR-2003"
FT   CDS             complement(7521440..7522723)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142729"
FT                   /product="mCG142729"
FT                   /note="gene_id=mCG142729.0 transcript_id=mCT181971.0
FT                   protein_id=mCP104893.0"
FT                   /protein_id="EDL37114.1"
FT                   /translation="MEDPFSLAILNPASNLSVPTQPSWSLNLTSEQGASVPGPHSPPRG
FT                   PPSHRIHLVFLGIILVAAVAGNTTVLCRLCGGSSGPWPGPKRRKMDFLLVQLAAADLYA
FT                   SGGTALSQLAWELLGDPRPALGDLACRLSHLLQASGRGASAHLVALIALERQLAVRIPQ
FT                   GPQLPARALAALSWLLALLLALPPTFVVRWDAPPSSTANAWPGKHCCRGIFAPLPRWHL
FT                   QVYALYEAIVGFAAPVALLGFSCGHLLCVWWQRGSQAPVARMPWSPSMARASLPSALPQ
FT                   AKVQSLKMSLALALLFVGCDLPYFAARLAAAWSSKPAGDWERESLVAAMRVLEVANSAI
FT                   NPLIYLFFQAGDCRLWRRLRRRLGVLCCVREEEADISEWAGDHQALHRHRWPHPHYHHA
FT                   RREERNQGCLRPPPPRPRPPPCSCESAF"
FT   gene            complement(7526601..7559407)
FT                   /gene="Arsk"
FT                   /locus_tag="mCG_5560"
FT                   /note="gene_id=mCG5560.2"
FT   mRNA            complement(join(7526601..7527891,7528337..7528646,
FT                   7531334..7531558,7532678..7532902,7538229..7538400,
FT                   7540907..7541183,7551957..7552116,7554616..7554745,
FT                   7559120..7559407))
FT                   /gene="Arsk"
FT                   /locus_tag="mCG_5560"
FT                   /product="arylsulfatase K"
FT                   /note="gene_id=mCG5560.2 transcript_id=mCT4823.2 created on
FT                   03-OCT-2002"
FT   CDS             complement(join(7527846..7527891,7528337..7528646,
FT                   7531334..7531558,7532678..7532902,7538229..7538400,
FT                   7540907..7541183,7551957..7552116,7554616..7554745,
FT                   7559120..7559254))
FT                   /codon_start=1
FT                   /gene="Arsk"
FT                   /locus_tag="mCG_5560"
FT                   /product="arylsulfatase K"
FT                   /note="gene_id=mCG5560.2 transcript_id=mCT4823.2
FT                   protein_id=mCP6228.2"
FT                   /protein_id="EDL37115.1"
FT                   /translation="MPAMLLLLVSVVAALALAAPAPRTQKKRMQVNQAPNVVLVASDSF
FT                   DGRLTFQPGSQVVKLPFINFMRAHGTTFLNAYTNSPICCPSRAAMWSGLFTHLTESWNN
FT                   FKGLDPNYTTWMDIMEKHGYQTQKFGKVDYTSGHHSISNRVEAWTRDVAFLLRQEGRPI
FT                   INLIPDKNRRRVMTKDWQNTDKAIEWLRQVNYTKPFVLYLGLNLPHPYPSPSSGENFGS
FT                   STFHTSLYWLEKVAYDAIKIPKWLTLSQMHPVDYYSSYTKNCTGKFTENEIKNIRAFYY
FT                   AMCAETDAMLGEIILALHKLDLLQKTIVIYTSDHGEMAMEHRQFYKMSMYEASVHVPLL
FT                   MMGPGIKANLQVPSVVSLVDIYPTMLDIAGIALPPNLSGYSLLTLLSNASANEQAFKFH
FT                   RPPWILSEFHGCNANASTYMLRTGQWKYIAYADGASVQPQLFDLSLDPDELTNIATEFP
FT                   EITYSLDQKLRSIVNYPKVSASVHQYNKEQFIMWKQSVGQNYSNVIAHLRWHQDWQRDP
FT                   RKYENAIQHWLTAHSSPLASSPPQSTSGLVILRPYCCRPLTV"
FT   assembly_gap    7528317..7528336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7533687..7534117
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    7534851..7534870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7559541..7655166
FT                   /locus_tag="mCG_116369"
FT                   /note="gene_id=mCG116369.0"
FT   mRNA            join(7559541..7559575,7560117..7560186,7565436..7565499,
FT                   7566949..7567097,7568912..7569002,7572390..7572533,
FT                   7572892..7572983,7573755..7573830,7574288..7574428,
FT                   7578432..7578527,7582792..7582890,7582986..7583094,
FT                   7587388..7587528,7588199..7588300,7589518..7589657,
FT                   7591719..7591805,7592250..7592353,7593351..7593477,
FT                   7594087..7594266,7594924..7595048,7595933..7596186,
FT                   7597576..7597678,7599400..7599576,7599672..7599816,
FT                   7599947..7600025,7600119..7600180,7601120..7601176,
FT                   7603036..7603104,7604190..7604264,7605230..7605371,
FT                   7607861..7607954,7609877..7609954,7612401..7612525,
FT                   7613433..7613556,7615181..7615399,7616546..7616618,
FT                   7621076..7621129,7621306..7621417,7622903..7623031,
FT                   7636734..7636855,7638606..7638764,7643462..7643614,
FT                   7646231..7646361,7648540..7648663,7652440..7652534,
FT                   7653273..7655166)
FT                   /locus_tag="mCG_116369"
FT                   /product="mCG116369"
FT                   /note="gene_id=mCG116369.0 transcript_id=mCT117489.1
FT                   created on 05-FEB-2003"
FT   CDS             join(7568913..7569002,7572390..7572533,7572892..7572983,
FT                   7573755..7573830,7574288..7574428,7578432..7578527,
FT                   7582792..7582890,7582986..7583094,7587388..7587528,
FT                   7588199..7588300,7589518..7589657,7591719..7591805,
FT                   7592250..7592353,7593351..7593477,7594087..7594266,
FT                   7594924..7595048,7595933..7596186,7597576..7597678,
FT                   7599400..7599576,7599672..7599816,7599947..7600025,
FT                   7600119..7600180,7601120..7601176,7603036..7603104,
FT                   7604190..7604264,7605230..7605371,7607861..7607954,
FT                   7609877..7609954,7612401..7612525,7613433..7613556,
FT                   7615181..7615399,7616546..7616618,7621076..7621129,
FT                   7621306..7621417,7622903..7623031,7636734..7636855,
FT                   7638606..7638764,7643462..7643614,7646231..7646361,
FT                   7648540..7648663,7652440..7652514)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116369"
FT                   /product="mCG116369"
FT                   /note="gene_id=mCG116369.0 transcript_id=mCT117489.1
FT                   protein_id=mCP54709.1"
FT                   /protein_id="EDL37116.1"
FT                   /translation="MSSKEVKTALKSARDAIRNKEYKEALKHCKTVLKQEKNNYNAWVF
FT                   IGVAAAELEQPDQAQGAYKKAAELEPEQLLAWQGLASLYEKCNQVNAKDDLPGVYQKLL
FT                   DLYESADRQKWCDVCKKLVALYHQEKKHLEVARTWHRLIKTRQEDGADRQELYELWRKL
FT                   SQLLAENIEDQNNETQQMGADRQELYELWRKLSQLLAENIEDQNNETQQMLLTAFENAL
FT                   DLADNIPSEDHQVLYRNFIQCLSKFPHETTKLKKACEEMIAIYPTVQYPLEVICLYLID
FT                   SGSLTSEGHQYCCKLVEMNSKSGPGLIGLGIIALQDKKYEDAVRHLTEGLKESPVCIAG
FT                   WCHLAEAQVKMHRPKEAILSCNQALKTIDNFGASGGNLHQKNLCLRLKAEALLKLSDGA
FT                   SSEEAVRTLDQVSDVDNTPGLLVLQGLACLNTGAVDKATKIMEDLVTSYPDLAEAHALE
FT                   GRVHFTKKDYVQAEVSFQRALEKDAEVAEYHYQLGLTYWFMGEETRKDKTKALTHFLKA
FT                   ARLDAHMGKVFCYLGHYYRDVAGDRNRARGCYRKAFELDDNDAESGAAAVDLSLELEDT
FT                   ETALAILTAVTQKASAGAAKWAWLRRGLYHLKAGQHSQAVADLQAALRADPKDCNCWES
FT                   LGEAYLSRGGYTTALKSFMKASELNPDSTYSVFKVAAIQQILGRYSEAIAQYQLIIKMK
FT                   EDYVPALKGLGECHLLLGKVALVDFLDGKAVDYVEQALGYFTRALQHRADVSCLWKLVG
FT                   DACTCLHPVSPSKVHVHVLGALLGQKEGQEVLKKEELLSLGGRCYGRALKLMSTSNTWC
FT                   DLGINYYRQVQHLAETGSSMSDLTELLEKSLHCLKKAVRLDSTNHLHWNALGVAACYRG
FT                   VGNYALAQHCFIKSIQAEQINAAAWTNLGVLYLATENIEQAHEAFKMAQSLDPSYLLCW
FT                   IGQALIAERVGSYDTMDLFRHTTELSMHTEGAIGYAYWVCTTLQDKSNRETELYQYNIL
FT                   EMNAIPAAQGVLCKYVERIQNSASAFTMLGYLNEHLQLKKEAAEAYQRATTLLHSAEDQ
FT                   NTYNVAVRNWGRLLCSIGDYDRAIQAFKSTPLVELEDIIGFALALFMKGLYKESGSAYE
FT                   RALAVCKSEQDKAHILTAMAIVEYKQGKMDAAKSFLFKCSILKEPTAESLQALCALGLA
FT                   MRDATLSKAALNELLKHIKRRNDYHSCLLTSAIYALQGRSVAVQRQAAKAVHSNPADPA
FT                   LWSLLSRIVAQYTQRSAKGGAVAGNVAHILDLNHGKKALLYTAVNQLAMGSSTAEDKSN
FT                   TALKTIQKAAFLSPDDPAVWAGLMAACHADDKLALLNNTQPKRVDLYLALRSAVAASLK
FT                   DKEILQNYNQSLEKWSFSQVVTGLIDTGKTSEAESLCTQSLKSNPDQPAVILLLRQVQC
FT                   TSLLESQKPLPDAVLEELQKTVMSNSTSVPAWQWLAQVYQSQGMMGAAEMCYRKSLQVA
FT                   SQQGNWSGKLSSLLKLALLALEVCMANVSGDHWSSLVQEATSEALKVCFSPLAVFLQAL
FT                   LQFNRKMGARETRRLLERIVYQTGYPSSIVSAARWYLLRHLYAKDDPELIDVLVRNAET
FT                   HGDKRILELNRKLSAQ"
FT   assembly_gap    7574860..7577023
FT                   /estimated_length=2164
FT                   /gap_type="unknown"
FT   assembly_gap    7577779..7578429
FT                   /estimated_length=651
FT                   /gap_type="unknown"
FT   assembly_gap    7594315..7594334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7619859..7619878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7634272..7634362
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    7649636..7649655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7650732..7650751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7670122..7670281
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    7681625..7682618
FT                   /estimated_length=994
FT                   /gap_type="unknown"
FT   assembly_gap    7683729..7683748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7684995..7686293
FT                   /estimated_length=1299
FT                   /gap_type="unknown"
FT   assembly_gap    7688812..7690606
FT                   /estimated_length=1795
FT                   /gap_type="unknown"
FT   assembly_gap    7692246..7692265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7693785..7693804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7695023..7695042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7696134..7696153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7697644..7697746
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    7700158..7700177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<7703618..7742392)
FT                   /locus_tag="mCG_5548"
FT                   /note="gene_id=mCG5548.2"
FT   mRNA            complement(join(<7703618..7703753,7711545..7711663,
FT                   7720620..7720863,7739711..7739770,7742307..7742392))
FT                   /locus_tag="mCG_5548"
FT                   /product="mCG5548"
FT                   /note="gene_id=mCG5548.2 transcript_id=mCT4831.2 created on
FT                   07-OCT-2002"
FT   CDS             complement(join(<7703618..7703753,7711545..7711663,
FT                   7720620..7720863,7739711..7739754))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5548"
FT                   /product="mCG5548"
FT                   /note="gene_id=mCG5548.2 transcript_id=mCT4831.2
FT                   protein_id=mCP6232.2"
FT                   /protein_id="EDL37117.1"
FT                   /translation="MSTKNATDLVEYVDKGCPFLPAMPSNQTSQLEDRLSHQERTVAFL
FT                   LEQAFRIKEDISACLHGSQGFRKEESLARKLLESHIQTITSIVKKLNQNIELLEDQIRI
FT                   RDQVTTGTNFAVQDLNIKHLQGVGDLRGRVARCDSSIVKLSGDIQFIRHECRQMEKSVQ
FT                   ELASALETISKNLDVKVT"
FT   assembly_gap    7704246..7704265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7705372..7705391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7708195..7708214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7713079..7713098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7714641..7714660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7716217..7716236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7717575..7717594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7723989..7724008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7726921..7726940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7735409..7735428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7762453..7762472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7780759..7780778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7816553..7816572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7846184..7846203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7855826..8502983
FT                   /gene="Mctp1"
FT                   /locus_tag="mCG_115775"
FT                   /note="gene_id=mCG115775.1"
FT   mRNA            join(7855826..7856118,8107188..8107302,8152439..8152581,
FT                   8176092..8176171,8186864..8186975,8204533..8204592,
FT                   8219304..8219474,8221996..8222126,8263103..8263289,
FT                   8267890..8267983,8284589..8284691,8286391..8286493,
FT                   8286825..8286926,8287345..8287419,8289300..8289419,
FT                   8355908..8356027,8389794..8389847,8486401..8486510,
FT                   8497032..8497141,8500864..8500961,8502084..8502983)
FT                   /gene="Mctp1"
FT                   /locus_tag="mCG_115775"
FT                   /product="multiple C2 domains, transmembrane 1"
FT                   /note="gene_id=mCG115775.1 transcript_id=mCT116885.1
FT                   created on 07-OCT-2002"
FT   assembly_gap    7859822..7863034
FT                   /estimated_length=3213
FT                   /gap_type="unknown"
FT   assembly_gap    7863716..7864064
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    7870788..7870884
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    7875202..7875267
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    7900146..7900165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7908998..7909625
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    7911553..7911572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7913283..7913302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7914540..7914559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7951644..7951663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7956338..7956357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7958367..7958386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7961955..7967281
FT                   /estimated_length=5327
FT                   /gap_type="unknown"
FT   assembly_gap    7973836..7974998
FT                   /estimated_length=1163
FT                   /gap_type="unknown"
FT   assembly_gap    7979127..7979146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7980736..7980755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7981780..7981799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8006121..8006142
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    8047458..8047804
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    8049347..8049366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8061239..8061377
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    8094789..8094808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8095930..8095949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8097250..8097269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(8107242..8107302,8152439..8152581,8176092..8176171,
FT                   8186864..8186975,8204533..8204592,8219304..8219474,
FT                   8221996..8222126,8263103..8263289,8267890..8267983,
FT                   8284589..8284691,8286391..8286493,8286825..8286926,
FT                   8287345..8287419,8289300..8289419,8355908..8356027,
FT                   8389794..8389847,8486401..8486510,8497032..8497141,
FT                   8500864..8500961,8502084..8502098)
FT                   /codon_start=1
FT                   /gene="Mctp1"
FT                   /locus_tag="mCG_115775"
FT                   /product="multiple C2 domains, transmembrane 1"
FT                   /note="gene_id=mCG115775.1 transcript_id=mCT116885.1
FT                   protein_id=mCP54777.1"
FT                   /protein_id="EDL37118.1"
FT                   /translation="MYQLDITLRRGQSLAARDRGGTSDPYVKFKIGRKEVFRSKIIHKN
FT                   LNPVWEEKACVLIDHLREPLYIKVFDYDFGLQDDFMGSAFLDLTQLELNRSTDVTLTLK
FT                   DPHYPDHDLGIILLSVILTPKEGEHRDVELSENEVFGFHFSVQSFFWRFQTQSLRLSDQ
FT                   HRKSHLWRGIVSITLIEGRDLKAMDSNGLSDPYVKFRLGHQKYKSKIMPKTLNPQWREQ
FT                   FDFHLYEERGGIMDITAWDKDAGKRDDFIGRCQVDLSSLSREQTHKLELHLEEGEGHLV
FT                   LLVTLTASATVCISDLSVNSMEDQKEREEILKRYSPLRIFNNLKDVGFLQVKVIRAEGL
FT                   MAADVTGKSDPFCVVELNNDRLLTHTVYKNLNPEWNKVFTFNIKDIHSVLEVTVYDEDR
FT                   DRSADFLGRVAIPLLSIQNGEQKAYVLKNKQLTGPTKGVIYLEIDVIFNAVKASLRTLI
FT                   PKERKYIEEENRLSKQLLLRNFIRTKRCVIVLVNAAYYVNSCFDWDSPPRSLAAFVLFL
FT                   LIVWNFELYMIPLLLLLLLTWNYFLIISGKDNRQRDTVVEDMLEDEEEEDDRDDKDGEK
FT                   KGFINKIYAIQEVCVSVQNILDEVASLGERIKNTFNWTVPFLSWLAIVALCVFTAILYF
FT                   IPLRYIVLVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVEVAT"
FT   assembly_gap    8145679..8145712
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   gene            complement(8147950..8148427)
FT                   /pseudo
FT                   /locus_tag="mCG_13033"
FT                   /note="gene_id=mCG13033.2"
FT   mRNA            complement(8147950..8148427)
FT                   /pseudo
FT                   /locus_tag="mCG_13033"
FT                   /note="gene_id=mCG13033.2 transcript_id=mCT13778.2 created
FT                   on 07-OCT-2002"
FT   assembly_gap    8181916..8182321
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   assembly_gap    8183516..8184387
FT                   /estimated_length=872
FT                   /gap_type="unknown"
FT   assembly_gap    8197223..8197354
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    8232316..8232335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8258542..8258561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8275777..8276784
FT                   /estimated_length=1008
FT                   /gap_type="unknown"
FT   assembly_gap    8293347..8293678
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    8302333..8302352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8321241..8321313
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    8325490..8325509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8326953..8326972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8330847..8330866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8357965..8358046
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    8391182..8391201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8400462..8408958
FT                   /estimated_length=8497
FT                   /gap_type="unknown"
FT   assembly_gap    8413915..8413934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8415259..8415391
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    8430222..8430241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8431402..8431421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8457116..8462318
FT                   /estimated_length=5203
FT                   /gap_type="unknown"
FT   assembly_gap    8463519..8463851
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    8475692..8475711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8476834..8476853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8488792..8488811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8514892..8609867)
FT                   /gene="Ankrd32"
FT                   /locus_tag="mCG_141275"
FT                   /note="gene_id=mCG141275.0"
FT   mRNA            complement(join(8514892..8515831,8518318..8518500,
FT                   8518905..8518997,8520888..8521018,8521679..8521842,
FT                   8522950..8523095,8539550..8539697,8556863..8557028,
FT                   8557755..8557883,8564273..8564436,8565153..8565311,
FT                   8566324..8566377,8574889..8575023,8577460..8577603,
FT                   8578514..8578657,8579951..8580079,8586357..8586519,
FT                   8598800..8599040,8599935..8600010,8600171..8600284,
FT                   8609759..8609867))
FT                   /gene="Ankrd32"
FT                   /locus_tag="mCG_141275"
FT                   /product="ankyrin repeat domain 32"
FT                   /note="gene_id=mCG141275.0 transcript_id=mCT174270.0
FT                   created on 07-OCT-2002"
FT   CDS             complement(join(8515350..8515831,8518318..8518500,
FT                   8518905..8518997,8520888..8521018,8521679..8521842,
FT                   8522950..8523095,8539550..8539697,8556863..8557028,
FT                   8557755..8557883,8564273..8564436,8565153..8565311,
FT                   8566324..8566377,8574889..8575023,8577460..8577603,
FT                   8578514..8578657,8579951..8580079,8586357..8586519,
FT                   8598800..8599040,8599935..8600010,8600171..8600284))
FT                   /codon_start=1
FT                   /gene="Ankrd32"
FT                   /locus_tag="mCG_141275"
FT                   /product="ankyrin repeat domain 32"
FT                   /note="gene_id=mCG141275.0 transcript_id=mCT174270.0
FT                   protein_id=mCP97189.0"
FT                   /protein_id="EDL37119.1"
FT                   /translation="MEDSATKHIIQMTGFKMEEKEALVKLLLKLDCTFIKSEKYKNCTH
FT                   LIAERLCKSEKFLAACAAGKWVLTKDYIIHSAKSGRWLDETTYEWGYKIEKDSHYSPQM
FT                   QSAPKRWREELKRTGAPGAFHRWKVVLLVRADKRSDSLVRVLEAGKANVILPKNSPSGI
FT                   THVIASNARISAEREQENFKAPFYPIQYLGDFLLEKEIQNDEHSQISPAWTKYNNQEKG
FT                   NDVGFPEMKGAGENMYRTQNKMENHNKNVSDRFVLSEHHKKKFKDFRKDIRSVKKRNTL
FT                   RRHGLENQKETKKKDKNIQRSYILRKKNKKEGYCKTDDAHDTIRSMLKKRGHYREQKEM
FT                   KNPLLTDGTKESKTKDVKTNMNLIEIKNALKKQIYRDIYRAQAVRYNCIRVDKQPVYNV
FT                   EVKNSEFPRGILNLIENLIEGQFFKEAIEELSSLQAHYIPPVCLLHAILENVLQDKIDT
FT                   FSGRYFHILSALLHLHPPWKSPAMLKYYLELFQCPTCMKGAWDFTEVLIRSCLFNEDFC
FT                   HQISENISTKVVHLTLLKFFFNLLEGEVRHLSQKLCDWSDSQSLKVTEKAILHEIFWSG
FT                   SETSGLLTKPVNMLLEWTIYSHKEKCKSNDVFKHELSYLLTGILGAAVDYWIFLGIQMG
FT                   RNVIRHMSDDLGSYISLSCDDFSSKELEIFICSFSSSWLQMFVAEAIFKKLCLQGPTST
FT                   CTEPLSLQKIIDSYLPVLGKMDIHGAGKMQSPKKLCQRPCLESQRALLMLNGAKRKQAE
FT                   GRPELLELNRAKCSSSLKKLKKKSEELSCSKENCPSLVTKMNFHKTNLKGETALHRVCI
FT                   KNQVEKLIILLSLPGIDINVKDNAGWTPLHEACNYGNTECVQEILQRCPEVDLLTQVDG
FT                   VTPLHDALSNGHVEIGKLLLQRGGPELLQQRNSKGELPLDYVLSPKDKEELFAITNIDD
FT                   TVDNFHAKTQKHFYHQQLEFGSFLLSRMLINFCSIFDLSSEFILAFKGLGHLNELLMAC
FT                   NSDTEASNAHTDWLLDVYARNIKTLKKLPSVLKELPENLNVCPGVHTEALLVTLKMMCQ
FT                   SITELS"
FT   assembly_gap    8525856..8525875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8528084..8528103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8535825..8535844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8539061..8539080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8550948..8550967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8560466..8560485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8607613..8607632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8609956..8686664
FT                   /locus_tag="mCG_115777"
FT                   /note="gene_id=mCG115777.1"
FT   mRNA            join(8609956..8610036,8647275..8647406,8656014..8656182,
FT                   8665381..8667164,8686248..8686664)
FT                   /locus_tag="mCG_115777"
FT                   /product="mCG115777"
FT                   /note="gene_id=mCG115777.1 transcript_id=mCT116887.1
FT                   created on 05-FEB-2003"
FT   assembly_gap    8611771..8613130
FT                   /estimated_length=1360
FT                   /gap_type="unknown"
FT   assembly_gap    8614858..8616256
FT                   /estimated_length=1399
FT                   /gap_type="unknown"
FT   assembly_gap    8620111..8620130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8621403..8630842
FT                   /estimated_length=9440
FT                   /gap_type="unknown"
FT   assembly_gap    8632992..8633011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8635676..8635695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8637160..8637179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8638929..8638948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8641177..8642450
FT                   /pseudo
FT                   /locus_tag="mCG_142285"
FT                   /note="gene_id=mCG142285.0"
FT   mRNA            8641177..8642450
FT                   /pseudo
FT                   /locus_tag="mCG_142285"
FT                   /note="gene_id=mCG142285.0 transcript_id=mCT179781.0
FT                   created on 05-FEB-2003"
FT   CDS             join(8647276..8647406,8656014..8656182,8665381..8666055)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115777"
FT                   /product="mCG115777"
FT                   /note="gene_id=mCG115777.1 transcript_id=mCT116887.1
FT                   protein_id=mCP54611.1"
FT                   /protein_id="EDL37120.1"
FT                   /translation="MDALQDYSHNSFDLQCLLNSFPGDLEFKQIFSDIGEQMEQNAASI
FT                   EHCIEEIQSEVNKLCPDAQLQTTSDCFKWLTSYNYNLSKSPSISHGDLINFLKTMKDLL
FT                   NNEDNHEEMILDLLWDLSCQSSISFLSSLGGTTFCHLSRTSIHSVEDFSSVDVKSVWDD
FT                   VRLHLRRFLVNRLERYNEINNSQQKIELKSQCMKQFLLLYSESEVLVKYQSIQKRLLDT
FT                   FLQDSFPSCNRESDLERIVCGYQSTMLMLYSMIKEDFNVLCEILAPSSLVQFFNETYLD
FT                   TVTEEMTKILEYFCELQFKENAVPVVKTSKSCNKRRGAVHALG"
FT   assembly_gap    8657183..8657202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8662279..8662298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8665860..8810042
FT                   /locus_tag="mCG_142286"
FT                   /note="gene_id=mCG142286.0"
FT   mRNA            join(8665860..8666050,8717812..8717973,8726647..8726741,
FT                   8732379..8732606,8734536..8734801,8736177..8736327,
FT                   8739446..8739636,8741546..8741729,8750955..8751118,
FT                   8756918..8757028,8775063..8775202,8779907..8780071,
FT                   8792004..8792228,8799020..8799425,8803537..8803693,
FT                   8807968..8808123,8809934..8810042)
FT                   /locus_tag="mCG_142286"
FT                   /product="mCG142286"
FT                   /note="gene_id=mCG142286.0 transcript_id=mCT179790.0
FT                   created on 05-FEB-2003"
FT   CDS             join(8665939..8666050,8717812..8717973,8726647..8726741,
FT                   8732379..8732606,8734536..8734801,8736177..8736327,
FT                   8739446..8739636,8741546..8741729,8750955..8751118,
FT                   8756918..8757028,8775063..8775202,8779907..8780071,
FT                   8792004..8792228,8799020..8799425,8803537..8803693,
FT                   8807968..8808123,8809934..8810032)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142286"
FT                   /product="mCG142286"
FT                   /note="gene_id=mCG142286.0 transcript_id=mCT179790.0
FT                   protein_id=mCP102712.0"
FT                   /protein_id="EDL37121.1"
FT                   /translation="MTKILEYFCELQFKENAVPVVKTSKSCNKRRGAVHALVSPECSQK
FT                   ERRPSLSLEELRFLSQLTESFVKLENSIQELFAETLSLLQMPRSSPGILEKSKKEVMVE
FT                   KLIANENNKPPEALLPVKEATLLEFGWRNAFKEVPLAIAHCISAAIEGFSTQVLQQEQT
FT                   ERISSVSYTINLVNVPQLCPEGHIFPEEEQPKRVAKFCSDIMEKLDTMLPLALACRDDS
FT                   PQEIRENLVEAYSKVATAVLERLQERGKEVPSRAPLKNLHSILSSAAYVSQRFTHYDNL
FT                   MKETTKKPIFLVPVQRYQEFINTVQFQVTDYCARVCAMSILQDAESHHWDDYKAFYEGE
FT                   RCSFAIQMWHYFSLALHHDLWTILPPKLAQEILAEMLEKSLGLLASRYARAHPSPKRTA
FT                   QIRLDVMAILIFTENMLWSICSSGQEILNPHKFNNHKIFKIHTHCNNLFTTLAILTSPL
FT                   TELYKMWHYFSLALHHDLWTILPPKLAQEILAEMLEKSLGLLASRYARAHPSPKRTAQI
FT                   RTFQHGVDESPSNSLTPLFNQPLHWISCMSQFYPSLLRPPSAGGLTAQGQLKLLLSQPC
FT                   CKWNLLLDTLLHSGGLIPRILLKSSKQAAGMESKQSAGGSLVGAIFEVLYHCHLSPQTF
FT                   GNVFMSHMEEEQLWDFLFNIPVSSFTESQPEVIHCLRLALMDSVKDTVQQIISIMRCRR
FT                   NSETNLNKPRVPDHLLQSIPQGWNYIPRDSRRKESNKGITELAAQAVSIVLSKLPTVIA
FT                   CLPPTIKYFFFLSERKMSKNLAELKKAGLLVWNLIIIICRIFEDGNTVERLTGSSLDRW
FT                   SKEKLGLICLCLESILGKQSNPSQLTQKVILSIERQKPNWMEQQLLKARTLSIQCAFTR
FT                   MEENSGSEGEAALELTEQKTNAMVLDLCHKPGGSKYLQQIYHIMQLNEEYLKEQLFAMN
FT                   GSEEKPLLIRPLKVALRDEDQPPAFNPFHVHKVVSESMLDQVATVTWCCDWSNLLPNYL
FT                   GLNKMTFGALLKNR"
FT   assembly_gap    8668168..8669805
FT                   /estimated_length=1638
FT                   /gap_type="unknown"
FT   assembly_gap    8671170..8671189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8672243..8672262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8673398..8673755
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    8674778..8674797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8690928..8690954
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    8710210..8710229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8711549..8711568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8713645..8713664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8738650..8739328
FT                   /estimated_length=679
FT                   /gap_type="unknown"
FT   assembly_gap    8747959..8747978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8749109..8749128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8751437..8751456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8753725..8753954
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    8756297..8756316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8758820..8759264
FT                   /estimated_length=445
FT                   /gap_type="unknown"
FT   assembly_gap    8760652..8760947
FT                   /estimated_length=296
FT                   /gap_type="unknown"
FT   assembly_gap    8762449..8762468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8765923..8765942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8770720..8770739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8772772..8773005
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    8781565..8781744
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    8829448..8829467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8833424..8833443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8870447..8870466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8871720..8871739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8893358..8896017
FT                   /estimated_length=2660
FT                   /gap_type="unknown"
FT   assembly_gap    8897189..8898913
FT                   /estimated_length=1725
FT                   /gap_type="unknown"
FT   assembly_gap    8900005..8900318
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    8921235..8921254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8923085..8923330
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    8925667..8925686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8927987..8929309
FT                   /estimated_length=1323
FT                   /gap_type="unknown"
FT   assembly_gap    8930342..8930361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8931409..8931428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8933265..8933884
FT                   /estimated_length=620
FT                   /gap_type="unknown"
FT   assembly_gap    8936724..8936743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8951278..8951507
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    8968296..8968315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8980624..8980652
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    8991695..8991714
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9005774..9005807
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   gene            complement(9018786..9019669)
FT                   /pseudo
FT                   /locus_tag="mCG_141276"
FT                   /note="gene_id=mCG141276.0"
FT   mRNA            complement(9018786..9019669)
FT                   /pseudo
FT                   /locus_tag="mCG_141276"
FT                   /note="gene_id=mCG141276.0 transcript_id=mCT174271.0
FT                   created on 07-OCT-2002"
FT   assembly_gap    9029226..9033495
FT                   /estimated_length=4270
FT                   /gap_type="unknown"
FT   assembly_gap    9045868..9045887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9051554..9058318
FT                   /estimated_length=6765
FT                   /gap_type="unknown"
FT   gene            complement(9112807..9114354)
FT                   /pseudo
FT                   /locus_tag="mCG_131991"
FT                   /note="gene_id=mCG131991.1"
FT   mRNA            complement(join(9112807..9113441,9113962..9114354))
FT                   /pseudo
FT                   /locus_tag="mCG_131991"
FT                   /note="gene_id=mCG131991.1 transcript_id=mCT133336.1
FT                   created on 07-OCT-2002"
FT   assembly_gap    9116450..9117654
FT                   /estimated_length=1205
FT                   /gap_type="unknown"
FT   gene            complement(9118272..9118984)
FT                   /pseudo
FT                   /locus_tag="mCG_1049879"
FT                   /note="gene_id=mCG1049879.1"
FT   mRNA            complement(9118272..9118984)
FT                   /pseudo
FT                   /locus_tag="mCG_1049879"
FT                   /note="gene_id=mCG1049879.1 transcript_id=mCT167583.1
FT                   created on 08-OCT-2002"
FT   assembly_gap    9118985..9119004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9125722..9126831
FT                   /estimated_length=1110
FT                   /gap_type="unknown"
FT   assembly_gap    9139233..9139252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <9147228..9596349
FT                   /locus_tag="mCG_1362"
FT                   /note="gene_id=mCG1362.2"
FT   mRNA            join(<9147228..9147387,9197891..9197992,9200301..9200401,
FT                   9262968..9263033,9272162..9272353,9340200..9340421,
FT                   9385957..9386076,9433311..9433427,9440937..9441021,
FT                   9593629..9596349)
FT                   /locus_tag="mCG_1362"
FT                   /product="mCG1362, transcript variant mCT7958"
FT                   /note="gene_id=mCG1362.2 transcript_id=mCT7958.2 created on
FT                   11-JUN-2003"
FT   CDS             join(<9147228..9147387,9197891..9197992,9200301..9200401,
FT                   9262968..9263033,9272162..9272353,9340200..9340421,
FT                   9385957..9386076,9433311..9433427,9440937..9441021,
FT                   9593629..9593771)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1362"
FT                   /product="mCG1362, isoform CRA_b"
FT                   /note="gene_id=mCG1362.2 transcript_id=mCT7958.2
FT                   protein_id=mCP4211.2 isoform=CRA_b"
FT                   /protein_id="EDL37123.1"
FT                   /translation="KFPADPEVQSNLVGARILREKVRARAQGSSPRDLEGHASSHLPSQ
FT                   HCSWGQSSDLLSRIDLDELMKKDEPPFDFPDTLEGFEYAFNEKGQLRHIKTGEPFVFNY
FT                   REDLHRWNQKRYEALGEIITRYVYELLESDCNLKKISIPVDATESEPKSFIFMSEDALT
FT                   NPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAMDEGYGVIVLNPNENYI
FT                   EVEKQKMHKQSSSSDGTDEPAGKRERRDKVSKETKKRRDFYEKYRNPQKEKEMMQLFIR
FT                   ENGSPEEHAVYVWDHFIAQAAAENVFFVAHSYGGLAFVELMIQREADVKSKVTAVALTD
FT                   SVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESMLPDCPRVSAGTDRHELTSWK
FT                   SFPSIFKFFAEASEAKSSSQKPALTRRSHRIKHEEL"
FT   mRNA            join(<9147228..9147387,9197891..9197992,9200301..9200401,
FT                   9262968..9263033,9272162..9272353,9274884..9278173)
FT                   /locus_tag="mCG_1362"
FT                   /product="mCG1362, transcript variant mCT185179"
FT                   /note="gene_id=mCG1362.2 transcript_id=mCT185179.0 created
FT                   on 11-JUN-2003"
FT   CDS             join(<9147228..9147387,9197891..9197992,9200301..9200401,
FT                   9262968..9263033,9272162..9272353,9274884..9274943)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1362"
FT                   /product="mCG1362, isoform CRA_a"
FT                   /note="gene_id=mCG1362.2 transcript_id=mCT185179.0
FT                   protein_id=mCP106437.0 isoform=CRA_a"
FT                   /protein_id="EDL37122.1"
FT                   /translation="KFPADPEVQSNLVGARILREKVRARAQGSSPRDLEGHASSHLPSQ
FT                   HCSWGQSSDLLSRIDLDELMKKDEPPFDFPDTLEGFEYAFNEKGQLRHIKTGEPFVFNY
FT                   REDLHRWNQKRYEALGEIITRYVYELLESDCNLKKISIPVDATESEPKSFIFMSEDALT
FT                   NPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAMDAFLLVCVKGESKVDG
FT                   PAIL"
FT   assembly_gap    9159734..9162993
FT                   /estimated_length=3260
FT                   /gap_type="unknown"
FT   assembly_gap    9190771..9190853
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    9213753..9221412
FT                   /estimated_length=7660
FT                   /gap_type="unknown"
FT   assembly_gap    9223153..9223172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9233127..9233146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9234495..9234514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9237312..9237331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9300816..9300852
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    9313993..9314012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9347365..9347443
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    9364994..9365013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9374964..9374983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9384212..9384231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9390300..9390350
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    9399570..9399589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9426349..9426545
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    9434049..9434068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9435116..9435135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9445575..9445793
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   gene            9459363..9460758
FT                   /locus_tag="mCG_1049894"
FT                   /note="gene_id=mCG1049894.1"
FT   mRNA            9459363..9460758
FT                   /locus_tag="mCG_1049894"
FT                   /product="mCG1049894"
FT                   /note="gene_id=mCG1049894.1 transcript_id=mCT167598.1
FT                   created on 08-OCT-2002"
FT   CDS             9459403..9460392
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049894"
FT                   /product="mCG1049894"
FT                   /note="gene_id=mCG1049894.1 transcript_id=mCT167598.1
FT                   protein_id=mCP54582.1"
FT                   /db_xref="GOA:A0A0R4J273"
FT                   /db_xref="InterPro:IPR000327"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013847"
FT                   /db_xref="InterPro:IPR015585"
FT                   /db_xref="MGI:MGI:1922757"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J273"
FT                   /protein_id="EDL37124.1"
FT                   /translation="MAGRRSSNVFPLSGNSGGGLEVDTPTWLSSQAATSRLMVRPSMGP
FT                   GICPGPEVWGVPLGSSPYEFRGGIAPYRACEARAWSQSSSEDTCPGPYIALRYMPNLAL
FT                   PEDVSAIQKEMEQLAKELRQKRMTLGYSQADVGFAVGAMFGKVLSQTTICRFEAQQLSL
FT                   ANMWKLRPLLKMWLEEVDEKNLLGICRMEMILEQARKRRRASRERRIGSNLEKLFLQCP
FT                   EPTPQQISYIAGRLRLQKDLVQVWFSNRSQMGSWPTNDTSRREDVGATGSPFPGPPVCF
FT                   PMAPGLHFDFPHYEGSCLTPLYSSTPFPVRGALLSAPTTTLGLPRLSS"
FT   assembly_gap    9475584..9475603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9487561..9490856
FT                   /estimated_length=3296
FT                   /gap_type="unknown"
FT   gene            9513706..9514193
FT                   /pseudo
FT                   /locus_tag="mCG_1049880"
FT                   /note="gene_id=mCG1049880.1"
FT   mRNA            9513706..9514193
FT                   /pseudo
FT                   /locus_tag="mCG_1049880"
FT                   /note="gene_id=mCG1049880.1 transcript_id=mCT167584.1
FT                   created on 08-OCT-2002"
FT   gene            9555304..9556952
FT                   /pseudo
FT                   /locus_tag="mCG_131992"
FT                   /note="gene_id=mCG131992.1"
FT   mRNA            9555304..9556952
FT                   /pseudo
FT                   /locus_tag="mCG_131992"
FT                   /note="gene_id=mCG131992.1 transcript_id=mCT133337.1
FT                   created on 08-OCT-2002"
FT   assembly_gap    9566912..9568853
FT                   /estimated_length=1942
FT                   /gap_type="unknown"
FT   assembly_gap    9570099..9570584
FT                   /estimated_length=486
FT                   /gap_type="unknown"
FT   assembly_gap    9581184..9581203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9602742..9602761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9616504..9616523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9620836..9620855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9622163..>9631748)
FT                   /gene="Nr2f1"
FT                   /locus_tag="mCG_1361"
FT                   /note="gene_id=mCG1361.2"
FT   mRNA            complement(join(9622163..9623199,9628348..9628875,
FT                   9631307..>9631748))
FT                   /gene="Nr2f1"
FT                   /locus_tag="mCG_1361"
FT                   /product="nuclear receptor subfamily 2, group F, member 1"
FT                   /note="gene_id=mCG1361.2 transcript_id=mCT7957.2 created on
FT                   25-JUL-2002"
FT   CDS             complement(join(9622919..9623199,9628348..9628875,
FT                   9631307..9631748))
FT                   /codon_start=1
FT                   /gene="Nr2f1"
FT                   /locus_tag="mCG_1361"
FT                   /product="nuclear receptor subfamily 2, group F, member 1"
FT                   /note="gene_id=mCG1361.2 transcript_id=mCT7957.2
FT                   protein_id=mCP4210.2"
FT                   /protein_id="EDL37125.1"
FT                   /translation="MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQ
FT                   GGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFK
FT                   RSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQ
FT                   YALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFS
FT                   AVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMS
FT                   ADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEK
FT                   SQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDM
FT                   LLSGSSFNWPYMSIQCS"
FT   gene            <9631203..9668774
FT                   /locus_tag="mCG_146315"
FT                   /note="gene_id=mCG146315.0"
FT   mRNA            join(<9631203..9631409,9664260..9664455,9667705..9668774)
FT                   /locus_tag="mCG_146315"
FT                   /product="mCG146315"
FT                   /note="gene_id=mCG146315.0 transcript_id=mCT186418.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<9631203..9631409,9664260..9664379)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146315"
FT                   /product="mCG146315"
FT                   /note="gene_id=mCG146315.0 transcript_id=mCT186418.0
FT                   protein_id=mCP107448.0"
FT                   /protein_id="EDL37126.1"
FT                   /translation="HRSPIPTATGTKAREKERAGRRAKRRERSREEIFTFPPHAHFEAL
FT                   LEAAVLALVAVVLVDGTVPVGTACVAMEWCSRLLQMVSIVLLNAPCLCLQEELKALCMA
FT                   IAVT"
FT   assembly_gap    9632084..9632103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9633374..9633772
FT                   /estimated_length=399
FT                   /gap_type="unknown"
FT   assembly_gap    9634935..9635758
FT                   /estimated_length=824
FT                   /gap_type="unknown"
FT   assembly_gap    9658411..9658430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9664829..9666962)
FT                   /locus_tag="mCG_1050008"
FT                   /note="gene_id=mCG1050008.1"
FT   mRNA            complement(join(9664829..9665526,9666777..9666962))
FT                   /locus_tag="mCG_1050008"
FT                   /product="mCG1050008"
FT                   /note="gene_id=mCG1050008.1 transcript_id=mCT167712.1
FT                   created on 09-OCT-2002"
FT   CDS             complement(join(9665428..9665526,9666777..9666827))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050008"
FT                   /product="mCG1050008"
FT                   /note="gene_id=mCG1050008.1 transcript_id=mCT167712.1
FT                   protein_id=mCP54714.1"
FT                   /protein_id="EDL37127.1"
FT                   /translation="MVTTCGELGYAKTGWSPEVGVDGLVSREEERGDRGVLEGKPGKGI
FT                   TFEM"
FT   assembly_gap    9695457..9697610
FT                   /estimated_length=2154
FT                   /gap_type="unknown"
FT   assembly_gap    9704116..9704135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9705047..9705599)
FT                   /pseudo
FT                   /locus_tag="mCG_1049895"
FT                   /note="gene_id=mCG1049895.1"
FT   mRNA            complement(9705047..9705599)
FT                   /pseudo
FT                   /locus_tag="mCG_1049895"
FT                   /note="gene_id=mCG1049895.1 transcript_id=mCT167599.1
FT                   created on 09-OCT-2002"
FT   assembly_gap    9706658..9706677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9707240..9707666)
FT                   /pseudo
FT                   /locus_tag="mCG_1050010"
FT                   /note="gene_id=mCG1050010.1"
FT   mRNA            complement(9707240..9707666)
FT                   /pseudo
FT                   /locus_tag="mCG_1050010"
FT                   /note="gene_id=mCG1050010.1 transcript_id=mCT167714.1
FT                   created on 09-OCT-2002"
FT   assembly_gap    9716985..9717027
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    9760503..9760522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9781741..9782034
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    9785684..9788138
FT                   /estimated_length=2455
FT                   /gap_type="unknown"
FT   gene            complement(9789267..9790380)
FT                   /pseudo
FT                   /locus_tag="mCG_141272"
FT                   /note="gene_id=mCG141272.0"
FT   mRNA            complement(9789267..9790380)
FT                   /pseudo
FT                   /locus_tag="mCG_141272"
FT                   /note="gene_id=mCG141272.0 transcript_id=mCT174267.0
FT                   created on 09-OCT-2002"
FT   assembly_gap    9792997..9793016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9804825..9807507)
FT                   /pseudo
FT                   /locus_tag="mCG_50657"
FT                   /note="gene_id=mCG50657.2"
FT   mRNA            complement(join(9804825..9805635,9807334..9807507))
FT                   /pseudo
FT                   /locus_tag="mCG_50657"
FT                   /note="gene_id=mCG50657.2 transcript_id=mCT50840.2 created
FT                   on 09-OCT-2002"
FT   assembly_gap    9806175..9807333
FT                   /estimated_length=1159
FT                   /gap_type="unknown"
FT   assembly_gap    9811217..9811239
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    9857368..9857387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9861042..9861181
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    9871155..9871174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9881079..9881149
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    9918625..9918716
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    9919866..9921170
FT                   /estimated_length=1305
FT                   /gap_type="unknown"
FT   assembly_gap    9921863..9921882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9947862..9947881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9999093..10004104
FT                   /estimated_length=5012
FT                   /gap_type="unknown"
FT   assembly_gap    10018568..10018587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10032761..10032937
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    10036331..10039319
FT                   /estimated_length=2989
FT                   /gap_type="unknown"
FT   assembly_gap    10040460..10041031
FT                   /estimated_length=572
FT                   /gap_type="unknown"
FT   assembly_gap    10048803..10048878
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    10108827..10108846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10131547..10131618
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    10134077..10134168
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    10151882..10151901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10156216..10156733)
FT                   /locus_tag="mCG_1050013"
FT                   /note="gene_id=mCG1050013.1"
FT   mRNA            complement(join(10156216..10156626,10156652..10156733))
FT                   /locus_tag="mCG_1050013"
FT                   /product="mCG1050013"
FT                   /note="gene_id=mCG1050013.1 transcript_id=mCT167717.1
FT                   created on 09-OCT-2002"
FT   CDS             complement(10156245..10156409)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050013"
FT                   /product="mCG1050013"
FT                   /note="gene_id=mCG1050013.1 transcript_id=mCT167717.1
FT                   protein_id=mCP54736.1"
FT                   /protein_id="EDL37128.1"
FT                   /translation="MSEEEKGLKRKRKKKGDTVLSGGQKGQNKRAEAEEEGKLASVPPP
FT                   YASSAAAYK"
FT   assembly_gap    10164211..10164230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10165448..10165690
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    10253852..10253926
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    10256103..10260287
FT                   /estimated_length=4185
FT                   /gap_type="unknown"
FT   assembly_gap    10266842..10269085
FT                   /estimated_length=2244
FT                   /gap_type="unknown"
FT   assembly_gap    10273450..10273469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10350538..10350557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10372775..10372794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10374892..10374911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10376355..10378059)
FT                   /pseudo
FT                   /locus_tag="mCG_54561"
FT                   /note="gene_id=mCG54561.2"
FT   mRNA            complement(10376355..10378059)
FT                   /pseudo
FT                   /locus_tag="mCG_54561"
FT                   /note="gene_id=mCG54561.2 transcript_id=mCT54744.2 created
FT                   on 09-OCT-2002"
FT   assembly_gap    10388591..10388610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10389873..10389892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10391848..10392868
FT                   /estimated_length=1021
FT                   /gap_type="unknown"
FT   assembly_gap    10394056..10394075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10395300..10395319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10397555..10397574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10398821..10398840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10402610..10404009
FT                   /estimated_length=1400
FT                   /gap_type="unknown"
FT   assembly_gap    10431050..10431069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10507185..10507204
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10536353..10536618
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    10547840..10548597
FT                   /estimated_length=758
FT                   /gap_type="unknown"
FT   assembly_gap    10559847..10559866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10606262..10606984
FT                   /estimated_length=723
FT                   /gap_type="unknown"
FT   assembly_gap    10607727..10608265
FT                   /estimated_length=539
FT                   /gap_type="unknown"
FT   assembly_gap    10627141..10627242
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    10630361..10631312
FT                   /estimated_length=952
FT                   /gap_type="unknown"
FT   assembly_gap    10634162..10634181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10635274..10635293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10665304..10665323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10666610..10666752
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    10678283..10678302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10745284..10745338
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    10785561..10785580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10788098..10788117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10793198..10793217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10844756..10851184
FT                   /estimated_length=6429
FT                   /gap_type="unknown"
FT   assembly_gap    10889396..10889535
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    10938793..10938812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10950496..10950575
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    10962139..10962224
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    11032851..11032870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11070332..11070351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11100082..11100161
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    11127554..11127573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11131454..11132259
FT                   /estimated_length=806
FT                   /gap_type="unknown"
FT   assembly_gap    11151949..11151984
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    11166805..11166824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11170714..11171202
FT                   /estimated_length=489
FT                   /gap_type="unknown"
FT   assembly_gap    11174559..11174578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11190922..11190941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11201793..11201812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11217961..11218865
FT                   /estimated_length=905
FT                   /gap_type="unknown"
FT   assembly_gap    11221155..11221174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11273903..11273922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11276325..11276435
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    11286880..11286899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11293256..11293728
FT                   /pseudo
FT                   /locus_tag="mCG_141273"
FT                   /note="gene_id=mCG141273.0"
FT   mRNA            11293256..11293728
FT                   /pseudo
FT                   /locus_tag="mCG_141273"
FT                   /note="gene_id=mCG141273.0 transcript_id=mCT174268.0
FT                   created on 09-OCT-2002"
FT   assembly_gap    11315061..11315080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11315981..11316817
FT                   /estimated_length=837
FT                   /gap_type="unknown"
FT   assembly_gap    11318312..11318331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11319437..11319456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11335173..11335192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11342492..11342511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11350204..11350223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11423424..11423443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11428391..11428410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11442530..11446706
FT                   /estimated_length=4177
FT                   /gap_type="unknown"
FT   assembly_gap    11462419..11462566
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    11466402..11466421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11510102..11511069)
FT                   /pseudo
FT                   /locus_tag="mCG_67301"
FT                   /note="gene_id=mCG67301.2"
FT   mRNA            complement(11510102..11511069)
FT                   /pseudo
FT                   /locus_tag="mCG_67301"
FT                   /note="gene_id=mCG67301.2 transcript_id=mCT67484.2 created
FT                   on 09-OCT-2002"
FT   assembly_gap    11524115..11524134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11559060..11559396
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   gene            11573411..11574026
FT                   /pseudo
FT                   /locus_tag="mCG_49101"
FT                   /note="gene_id=mCG49101.2"
FT   mRNA            11573411..11574026
FT                   /pseudo
FT                   /locus_tag="mCG_49101"
FT                   /note="gene_id=mCG49101.2 transcript_id=mCT49284.2 created
FT                   on 14-OCT-2002"
FT   assembly_gap    11582494..11582595
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    11616808..11617093
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    11620668..11620687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11669439..11669458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11724293..11724333
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    11741251..11741571
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    11765821..11765840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11771681..11772216
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    11788760..11788779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11839283..11839302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11879637..11880628
FT                   /estimated_length=992
FT                   /gap_type="unknown"
FT   assembly_gap    11899634..11899710
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    11939419..11939438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11962869..11962953
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    11968559..11968578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11970768..11971340
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    11975018..11975678
FT                   /estimated_length=661
FT                   /gap_type="unknown"
FT   assembly_gap    11979885..11980079
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    11999728..11999836
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    12007945..12008096
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    12010777..12014085
FT                   /estimated_length=3309
FT                   /gap_type="unknown"
FT   assembly_gap    12036154..12036429
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    12037848..12037918
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    12078971..12079012
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    12094309..12094328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12095464..12095483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12112118..12114180)
FT                   /locus_tag="mCG_121996"
FT                   /note="gene_id=mCG121996.1"
FT   mRNA            complement(12112118..12114180)
FT                   /locus_tag="mCG_121996"
FT                   /product="mCG121996"
FT                   /note="gene_id=mCG121996.1 transcript_id=mCT123210.1
FT                   created on 04-FEB-2003"
FT   CDS             complement(12112615..12112845)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121996"
FT                   /product="mCG121996"
FT                   /note="gene_id=mCG121996.1 transcript_id=mCT123210.1
FT                   protein_id=mCP54854.1"
FT                   /protein_id="EDL37129.1"
FT                   /translation="MDPNSDFAVLQKHRTRHKQPNITSTCSNVRFRKQTLKTDTAAGTH
FT                   TRGDPHTSKSVLGCEGWSRFPANAPNERPTT"
FT   assembly_gap    12114469..12114507
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    12146181..12146446
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    12160713..12160732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12189660..12189849
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   gene            complement(12203416..12203808)
FT                   /pseudo
FT                   /locus_tag="mCG_1049930"
FT                   /note="gene_id=mCG1049930.0"
FT   mRNA            complement(12203416..12203808)
FT                   /pseudo
FT                   /locus_tag="mCG_1049930"
FT                   /note="gene_id=mCG1049930.0 transcript_id=mCT167634.1
FT                   created on 14-OCT-2002"
FT   assembly_gap    12240187..12240206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12241539..12242082
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    12245685..12245924
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    12252565..12252584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12259457..12260127
FT                   /estimated_length=671
FT                   /gap_type="unknown"
FT   assembly_gap    12277854..12277873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12294924..12294943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12295083..12307783
FT                   /gene="Arrdc3"
FT                   /locus_tag="mCG_5658"
FT                   /note="gene_id=mCG5658.3"
FT   mRNA            join(12295083..12295677,12299154..12299235,
FT                   12300837..12300984,12301844..12301946,12302282..12302538,
FT                   12302810..12302972,12303236..12303390,12305118..12307777)
FT                   /gene="Arrdc3"
FT                   /locus_tag="mCG_5658"
FT                   /product="arrestin domain containing 3, transcript variant
FT                   mCT4852"
FT                   /note="gene_id=mCG5658.3 transcript_id=mCT4852.2 created on
FT                   14-OCT-2002"
FT   mRNA            join(<12295159..12295677,12299154..12299235,
FT                   12300837..12300984,12301844..12301946,12302282..12302538,
FT                   12302810..12302972,12303198..12303390,12305118..12307783)
FT                   /gene="Arrdc3"
FT                   /locus_tag="mCG_5658"
FT                   /product="arrestin domain containing 3, transcript variant
FT                   mCT193520"
FT                   /note="gene_id=mCG5658.3 transcript_id=mCT193520.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<12295281..12295677,12299154..12299235,
FT                   12300837..12300984,12301844..12301946,12302282..12302538,
FT                   12302810..12302972,12303198..12303262)
FT                   /codon_start=1
FT                   /gene="Arrdc3"
FT                   /locus_tag="mCG_5658"
FT                   /product="arrestin domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG5658.3 transcript_id=mCT193520.0
FT                   protein_id=mCP114499.0 isoform=CRA_a"
FT                   /protein_id="EDL37130.1"
FT                   /translation="FFFLARQRHPSVLSEDHILYAILTFFLVLHYIFIDFVIIMVLGKV
FT                   KSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWTESRNA
FT                   GSNTAYTQNYTEEVEYFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFSFELPQTPLA
FT                   TSFEGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDINTPSLLSPQAGTKEKTLCC
FT                   WFCTSGPISLSAKIERKGYTPGESIQIFAEIENCSSRMVVPKAAIYQTQAFYAKGKMKE
FT                   VKQLVANLRGESLSSGKTETWNGKLLKIPPVSPSILDCSIIRVEYSLMVYVDIPGAMDL
FT                   LLSLPLVIGTIPLHPFGSRTSSVSSQCSMSMNWLALALPERPEEHVVRIACIFLLQHHP
FT                   AMQRL"
FT   CDS             join(12295398..12295677,12299154..12299235,
FT                   12300837..12300984,12301844..12301946,12302282..12302538,
FT                   12302810..12302972,12303236..12303390,12305118..12305174)
FT                   /codon_start=1
FT                   /gene="Arrdc3"
FT                   /locus_tag="mCG_5658"
FT                   /product="arrestin domain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG5658.3 transcript_id=mCT4852.2
FT                   protein_id=mCP3046.2 isoform=CRA_b"
FT                   /protein_id="EDL37131.1"
FT                   /translation="MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVK
FT                   SLKIHARGHAKVRWTESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERDDDNSEEGFHT
FT                   IHSGRHEYAFSFELPQTPLATSFEGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHID
FT                   INTPSLLSPQAGTKEKTLCCWFCTSGPISLSAKIERKGYTPGESIQIFAEIENCSSRMV
FT                   VPKAAIYQTQAFYAKGKMKEVKQLVANLRGESLSSGKTETWNGKLLKIPPVSPSILDCS
FT                   IIRVEYSLMVYVDIPGAMDLLLSLPLVIGTIPLHPFGSRTSSVSSQCSMSMNWLALALP
FT                   ERPEAPPSYAEVVTEEQRRNNLAPVGACDDFERALQGPLFAYIQEFRFLPPPLYSEIDP
FT                   NPDQSSEDRPSCPSR"
FT   gene            complement(12295972..12297272)
FT                   /locus_tag="mCG_148280"
FT                   /note="gene_id=mCG148280.0"
FT   mRNA            complement(join(12295972..12296642,12296900..12297272))
FT                   /locus_tag="mCG_148280"
FT                   /product="mCG148280"
FT                   /note="gene_id=mCG148280.0 transcript_id=mCT188543.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(12296270..12296422)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148280"
FT                   /product="mCG148280"
FT                   /note="gene_id=mCG148280.0 transcript_id=mCT188543.0
FT                   protein_id=mCP108255.0"
FT                   /protein_id="EDL37132.1"
FT                   /translation="MLQSSSYTPNPNPMCHILFNSICLPWVSLNPRSKVRHDAPRRKSL
FT                   TPNGF"
FT   assembly_gap    12330533..12330757
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    12338216..12338235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12355728..12355747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12359370..12363694
FT                   /estimated_length=4325
FT                   /gap_type="unknown"
FT   gene            <12374742..12538165
FT                   /locus_tag="mCG_146316"
FT                   /note="gene_id=mCG146316.0"
FT   mRNA            join(<12374742..12376249,12536354..12536586,
FT                   12537479..12538165)
FT                   /locus_tag="mCG_146316"
FT                   /product="mCG146316"
FT                   /note="gene_id=mCG146316.0 transcript_id=mCT186419.0
FT                   created on 14-JUL-2003"
FT   CDS             <12375865..12376155
FT                   /codon_start=1
FT                   /locus_tag="mCG_146316"
FT                   /product="mCG146316"
FT                   /note="gene_id=mCG146316.0 transcript_id=mCT186419.0
FT                   protein_id=mCP107449.0"
FT                   /protein_id="EDL37133.1"
FT                   /translation="PQQEVVPTSDPWTFSFLWETLPASSLLALEQTPQQALVGPSRVLG
FT                   PATQHHKVAHKKHRLSELLTQQRRRSACLVCLKTGVEEGRTEVQNHPPLRP"
FT   gene            <12391305..>12395733
FT                   /locus_tag="mCG_145569"
FT                   /note="gene_id=mCG145569.0"
FT   mRNA            join(<12391305..12391389,12392754..12395427,
FT                   12395444..12395522,12395537..>12395733)
FT                   /locus_tag="mCG_145569"
FT                   /product="mCG145569"
FT                   /note="gene_id=mCG145569.0 transcript_id=mCT184993.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<12395292..12395427,12395444..12395522,
FT                   12395537..>12395733)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145569"
FT                   /product="mCG145569"
FT                   /note="gene_id=mCG145569.0 transcript_id=mCT184993.0
FT                   protein_id=mCP105542.0"
FT                   /protein_id="EDL37134.1"
FT                   /translation="LTQHTHTHDTHAHTLWLGPTTCPINSTCVHAYTHTHTHTHTYIYI
FT                   YIFVIYTYIRWIYICIFVICIYIYIYIYMVDGAKATSNEQVSTQKKLSLILDEKGTPTF
FT                   TAQRKSFTFLFLNVRKKDFTVIAGKKASTFLLL"
FT   assembly_gap    12428944..12429110
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   gene            complement(12440547..12441743)
FT                   /pseudo
FT                   /locus_tag="mCG_54560"
FT                   /note="gene_id=mCG54560.2"
FT   mRNA            complement(12440547..12441743)
FT                   /pseudo
FT                   /locus_tag="mCG_54560"
FT                   /note="gene_id=mCG54560.2 transcript_id=mCT54743.2 created
FT                   on 14-OCT-2002"
FT   assembly_gap    12461349..12461681
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   gene            12476453..12478231
FT                   /pseudo
FT                   /locus_tag="mCG_121991"
FT                   /note="gene_id=mCG121991.2"
FT   mRNA            join(12476453..12477532,12477553..12478231)
FT                   /pseudo
FT                   /locus_tag="mCG_121991"
FT                   /note="gene_id=mCG121991.2 transcript_id=mCT123202.2
FT                   created on 15-JUL-2003"
FT   assembly_gap    12477533..12477552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12493171..12493190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12498292..12499305)
FT                   /pseudo
FT                   /locus_tag="mCG_5655"
FT                   /note="gene_id=mCG5655.1"
FT   mRNA            complement(12498292..12499305)
FT                   /pseudo
FT                   /locus_tag="mCG_5655"
FT                   /note="gene_id=mCG5655.1 transcript_id=mCT4855.1 created on
FT                   14-OCT-2002"
FT   assembly_gap    12505147..12505166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12506837..12992483)
FT                   /locus_tag="mCG_121994"
FT                   /note="gene_id=mCG121994.1"
FT   mRNA            complement(join(12506837..12507270,12514988..12515165,
FT                   12518668..12518856,12567299..12567420,12597214..12597371,
FT                   12680525..12680703,12693137..12693253,12783926..12784026,
FT                   12791957..12792117,12795625..12795764,12796449..12796698,
FT                   12801382..12801566,12806933..12807340,12814930..12815172,
FT                   12822813..12822984,12824340..12824457,12828762..12829864,
FT                   12831895..12832030,12833989..12834163,12837369..12837512,
FT                   12843191..12843664,12845326..12845475,12847241..12847477,
FT                   12849185..12849404,12849820..12850015,12852237..12852385,
FT                   12854117..12854349,12854621..12854806,12854984..12855122,
FT                   12856150..12856270,12858606..12858723,12882747..12882949,
FT                   12884296..12884551,12887444..12887590,12889128..12889332,
FT                   12889664..12889886,12895664..12895786,12896719..12896983,
FT                   12900260..12900367,12900677..12900823,12900918..12901075,
FT                   12902377..12902501,12903991..12904166,12906784..12907046,
FT                   12910802..12910943,12911653..12911791,12911891..12911969,
FT                   12913898..12913991,12916457..12916620,12917167..12917346,
FT                   12918651..12918750,12919296..12919426,12925742..12925951,
FT                   12928291..12929102,12929893..12930074,12931324..12931568,
FT                   12932347..12932562,12933102..12933317,12936237..12936846,
FT                   12939251..12939390,12940695..12940775,12943994..12944123,
FT                   12947643..12947845,12951058..12951238,12952157..12952333,
FT                   12964640..12965013,12966610..12967341,12968340..12968554,
FT                   12969144..12969270,12971254..12971520,12972672..12972795,
FT                   12973952..12974115,12975021..12975201,12976027..12976212,
FT                   12976298..12976424,12980905..12981128,12982649..12982825,
FT                   12985753..12986082,12986410..12986686,12986975..12987540,
FT                   12989382..12989495,12991668..12992483))
FT                   /locus_tag="mCG_121994"
FT                   /product="mCG121994, transcript variant mCT4860"
FT                   /note="gene_id=mCG121994.1 transcript_id=mCT4860.2 created
FT                   on 26-JUL-2002"
FT   CDS             complement(join(12507152..12507270,12514988..12515165,
FT                   12518668..12518856,12567299..12567420,12597214..12597371,
FT                   12680525..12680703,12693137..12693253,12783926..12784026,
FT                   12791957..12792117,12795625..12795764,12796449..12796698,
FT                   12801382..12801566,12806933..12807340,12814930..12815172,
FT                   12822813..12822984,12824340..12824457,12828762..12829864,
FT                   12831895..12832030,12833989..12834163,12837369..12837512,
FT                   12843191..12843664,12845326..12845475,12847241..12847477,
FT                   12849185..12849404,12849820..12850015,12852237..12852385,
FT                   12854117..12854349,12854621..12854806,12854984..12855122,
FT                   12856150..12856270,12858606..12858723,12882747..12882949,
FT                   12884296..12884551,12887444..12887590,12889128..12889332,
FT                   12889664..12889886,12895664..12895786,12896719..12896983,
FT                   12900260..12900367,12900677..12900823,12900918..12901075,
FT                   12902377..12902501,12903991..12904166,12906784..12907046,
FT                   12910802..12910943,12911653..12911791,12911891..12911969,
FT                   12913898..12913991,12916457..12916620,12917167..12917346,
FT                   12918651..12918750,12919296..12919426,12925742..12925951,
FT                   12928291..12929102,12929893..12930074,12931324..12931568,
FT                   12932347..12932562,12933102..12933317,12936237..12936846,
FT                   12939251..12939390,12940695..12940775,12943994..12944123,
FT                   12947643..12947845,12951058..12951238,12952157..12952333,
FT                   12964640..12965013,12966610..12967341,12968340..12968554,
FT                   12969144..12969270,12971254..12971520,12972672..12972795,
FT                   12973952..12974115,12975021..12975201,12976027..12976212,
FT                   12976298..12976424,12980905..12981128,12982649..12982825,
FT                   12985753..12986082,12986410..12986686,12986975..12987540,
FT                   12989382..12989495,12991668..12991688))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121994"
FT                   /product="mCG121994, isoform CRA_c"
FT                   /note="gene_id=mCG121994.1 transcript_id=mCT4860.2
FT                   protein_id=mCP3049.2 isoform=CRA_c"
FT                   /protein_id="EDL37137.1"
FT                   /translation="MVTVTFDVSGGPNPPEEDLNPVRGNITFPPGRATVIYNVTVLDDE
FT                   VPENDELFLIQLRSVEGGAEINASRSSVEIIVKKNDSPVNFMQSVYVVPEDDHVLTIPV
FT                   LRGKDSDGNLIGSDETQVSIRYKVMTWDSTAHAQQNVDFIDLQPDTTLVFPPFVHESHL
FT                   KFQIIDDLIPEIAESFHIMLLKNTLQGDAVLMGPSTVQVTIKPNDKPYGVLSFNSILFE
FT                   RPVIIDEDTASSSRFEEIAVVRNGGTHGNVSVSWVLTRNSSDPSPVTADITPASGTLQF
FT                   AQGQMLAPISLVVFDDDLPEEAEAYLLTILPHTIQGGAEVSEPAQLLFYIQDSDNVYGE
FT                   IAFFPGESQKIESSPSERSLSLSLARRGGSKGDVRVIYSALYIPAGAMDPLRAKDGILN
FT                   TSRRSSLLFPEQNQQVSIKLPIRNDAFLQNGAHFLVQLEAVVLVNIFPPIPPVSPRFGE
FT                   IRNISLLVTPAIANGEIGFLSNLPIILHEPKDSSAEVVSIPLHRDGTDGQATVYWSLRP
FT                   SGFNSKAVTLDDAGPFNGSVVFLSGQNETSINITVKGDDIPELNETVTLSLDRVSVDSD
FT                   VLKSGYTSRDLIILENDDPGGIFEFSYDSRGPYVIKEGDAVELRITRSRGSLVKQFLRF
FT                   HVEPRESNEFYGNMGVLEFTPGEREVVITLLTRLDGTPELDEHFWVILSSHGERESKLG
FT                   CATLVNITILKNDYPHGIIEFVSDGLSASIKESKGEDIYHAVYGVIRTRGNFGAVNVSW
FT                   MVSPDFTQDVFPVQGTVCFGDQEFFKNITVYSLVDEIPEEMEEFTIILLNATGGAQTGI
FT                   RTTASLRILRNDDPVYFAEPCVLRVQEGETANFTVLRNGSVDGACTVQYATVDGKASGE
FT                   EGDFAPVEKGETLVFEVGSREQSISVHVKDDGIPETDEPFYIVLFNSTGDTVVYEYGVA
FT                   TVIIEANDDPNGVFSLEPIDKAVEEGKTNAFWILRHRGHFGNVSVAWQLFQNASLQPGQ
FT                   EFYETSGTVNFTDGEETKPVILRAFPDRIPEFNEFYILRLVNISGPGGQLAETNFQVTV
FT                   MIPFNDDPFGIFILDPECLEREVAEDVLSEDDMSYITSFTILRQQGVFGDVRVGWEVLS
FT                   REFTAGLPPMIDFILLGSFPSTVPLQPHMRRHHSGTDVLYFSGLEGAFGTVDPKYQPFR
FT                   NNTIANFTFSAWVMPNANTNGFLIAKDDSHGSIYYGVKIQTNETHVTLSLHYKTFGSNV
FT                   TYIAKSTVMKYLEEGVWLHVLIILDDGIIEFYLDGKAMPRGIKSLKGEAITDGPGILRI
FT                   GAGMDGGARFTGWMQDVRTYERKLTPEEIYELHAVPARTDLHPISGYLEFRQGESNKSF
FT                   IVAARDDSEEEGEELFLLKLVSVDGGAQISKENTTARLRIQKSDNANGLFGFTGACIPE
FT                   MTEEGSTVSCVVERTRGALGYVHVFYTISQIESEGINYLVDDFANASGTITFLPWQRSE
FT                   VLNLYVLDEDMPELNEYFRVTLVSAVPGDGKLGSTPISGASIDPEKETTGITVKASDHP
FT                   YGLMQFSTGLPPQPEDSMSLPASSVPHITVQEEDGEIRLLVIRAQGLLGRVTVGFRTVS
FT                   LTAFSPEDYQSTAGTLEFQSGERYKYIFVNITDNSIPELEKSFKVELLNLDGGVSDLFR
FT                   VDGSGSGEADTDFFLPPVLPHASLGVASQILVTIAASDHAHGVFEFSPESLFVSGTEPE
FT                   DGYSTVVLNVTRTRGALSAVTLQWKVDSDLDGDLAITSGNITFETGQRIASITVEILSD
FT                   EEPELDKALTVSILNVSSGSLGVLTNATLTILASDDPYGVFIFPNKTRPLSVEEATQNV
FT                   TLSIIRLKGLMGEVAVSYATIDDMEKPPYFPPNLARATQGGDYISASGLALFRANQTEA
FT                   TITISILDDAEPERSESVFIELFNSSLVDKVQNRPIPHSPRLGPKVETVAHLVIVANDD
FT                   AFGTVQLSATSVHVAENHVGPIINVTRTGGTFADVSVKFKAVPITAAAGEDYSIASSDV
FT                   VLLEGETTKAVPIYIINDIYPELEETFLVQLLNETTGGATLGPLREAVITIEASDDPYG
FT                   LFGFQNTKFIVEEPEFNSVRVNVPIIRNSGTLGNVTVQWVAIINGQFATGDLRVVSGNV
FT                   TFAPGETIQTLLLEVLADDVPEIEEVVQVQLAAASGGGTIGLDRVANIVIPANDNPYGS
FT                   VAFVQSVFRVQEPLERSSYANITVRRSGGHFGRLLLCYGTSDIDVVARAVEEGEDVLSY
FT                   YESPTQGVPDPLWRTWVNVSAVEETQYTCATLCLKERACSAFSVVSGAEGPRCFWMTSW
FT                   VSGTVNSSDFQTYKKNMTRVASLFSGQAVAGSDYEPVTRQWAVILEGDEFANLTVSVLP
FT                   DDAPEMDESFLISLLEVHLMNISDSFKNQPTIGHPNTSAVVIGLNGDAFGVFIIYSVSP
FT                   NTSEDGLCVEVQEQPQTSVELVIYRTGGSLGQVMVEWRVVGGTATEGLDFMGAGDILTF
FT                   AEGETKKMAILTILDDSEPEDNESILVRLVATEGGSRILPSSDTVTVNILANDNVAGIV
FT                   SFQTASRSVIGHEGEMLQFHVVRTPPGRGNVTVNWKVVGQNLEVNFANFTGQLFFSEGT
FT                   LNKTIFVHLLDDNIPEEKEVYQVVLYDVKTQGVSPAGVALLDAQGYAAVLTVEASDEPH
FT                   GVLNFALSSRFVVLQEANVTIQLFVNREFGSLGAINVTYATVPGIVSLKNNTEGNLAEP
FT                   ESDFIPVVGSLVLEEGETTAAISITVLEDDIPELKEYFLVNLTHVDLIMAPLTSSPPRL
FT                   DSEGLTAQIVIDANDGAQGMIEWQRNRFEVNETDGVVTLVAQRSRAALGQVSLFMYAQN
FT                   LEAQAGLDYMCTPQILHFTDGERFKHVDVMILDDDMPEGDERFQLLLTNPSPGLELGKN
FT                   TIALITVLANDDGPGVLSFNNSGHIFLREPTSLYVQESVAVLVIVREPAQGLFGTVAVQ
FT                   FVVTEVNSSTESKDLSPSKGFIVLEEGVRSKTLRISAILDTEPEMDEHFVCTLFNPTGG
FT                   ARLGAHVQTLITIFQNQAPLGLFSISAVENSATSIDVEESNRSVYLNVSRTNGLDLTAS
FT                   VQWETVSETAFGMRGMDVVFSIFQSFFDKTALDWCFFTVEGSVYGVMLRKSSLVVYRWQ
FT                   GTFVPVEDLKVESPKTCEAFNIGVSPYLVITHGERSGEKPSINSVYMLTAGFRLVLIQT
FT                   IIISGSCQVRHFTSDSQDYFIIASRRNDSELTQVFRWNGNNFAWHQTLPVRGVLGMALF
FT                   SRGGSVFLAISQANIRQTSLLFTWSGTQFINFQELPISGITQVEALSSGDDVYLCFAKN
FT                   TFLGNQNAIDIFVWEMGHSSLRYFQSLDFAAVKRIRSFTPASGIVHILLTAQDGSALYC
FT                   WNSELNAFSFVLEAPAAHDAAFVTVKSLNSSKTLIALVGATDSHLYELTYVSSQSDFIP
FT                   SLGELIFEPGDKEAIIAVNVLDDTVPEKEESFRVQLKSPRGGAEIGINSSVRVTVLAND
FT                   GAYGVVAFAQNSLHKQLEELERDSLVTLNVERLRGTHGRITVAWEAAGSVSDVFPTSGV
FT                   ISFTEDQAMSMITLTVLADDLPELSEAVVVTLTQIVTEGVEDPLKGATIDQSRSRSVLT
FT                   ILPSDSPYGVVRWHTESLFNRVPEPTENITVVQLHIVRDKGLFGDISIHLIAKPNFLLH
FT                   INNQATEDEDFVLQDSVIIMKENIKETHAEVAILPTESQKSVILHTLKDGMVGEDRRFI
FT                   IELTAADEVEISPVKGSASVIIRGDKSISEVGIASSSRHIIIGEPSATYNGTAIIDLVR
FT                   GPGVSGEITVNWKILPPSRGEFVETSGQLTMLDGQTAATVVIQALNDDIPEEKCHYEFQ
FT                   LTEISEGRMLHEASVSARITMVASDAPYGRFSFSHEQLHVSEAAQRVNVTVVRSGGSFG
FT                   RARVLYETGSRTAEAGWDFVPASGELLFEAREKMKSLYIDILDDNLPEGPEEFVLAITR
FT                   VDLQGRGYDFTIQENGLQIDQPPEIGNISIVRIIIMKNDNAEGIIEFDPKYTDISVEED
FT                   AGVITLPVLRLHGTYGHVSADFSSRGFSAVPGGYVLHGSSVTFQHGQNLSFINVSIIDD
FT                   NGSEFEKQFEILLIGATGGAILGRHLVSKITIAKSDSPFGIIRFLNQSKISLPNPSSTM
FT                   ALHLVLERTGGLLGEIQVSWEVVGPDAEEPLPPHNGDFADPVSGTVSFGDGEGGVRSII
FT                   LRVCPHEETEAEETFIVQLKPLREAKLDPRAKAVTLTIQKFGDPNGVIHFAPESLSKRR
FT                   FSEPPPSDGPLLVSFLVTRSKGTSGDIKVHWELSSEFDITRDFLSTRGFFTIADGESDA
FT                   SFDVHLLPDDVPEIEEEYAVQLVSVEGGAELDLGKCTARFSVSANDDPHGVFALYSDRQ
FT                   SVLIGQNLDRSIQINITRLAGAFGAVAVRVQILSDNKEDPVATENEERQLVITDGARYK
FT                   VGLVPLKNQVFLSLGSNFTLQLVSVRLLSGPFYGIPTILQEAKNAILSVPEEAANSQVG
FT                   FESAAFQLMDIKAGTSQVMVSRKGTYGRLSVAWTTGYAPGSEIPEPIVIGNMTPTLGSL
FT                   SFVHGEERKGVLLWTFPSPGRPEAFVLHLSGLRSSAAGGAQLRSGFTTAEIEPMGVFQF
FT                   SPSSRNITVSEDAQTIRICVQRLFGFHGDLIKVSYETTAGSAKPPEDFEAVQKGEVFFQ
FT                   RFQPEIDFEITIINDQLPEIEETFYINLTSVETRGLGKGGVNWRPRLNPDLSVAVVTIV
FT                   DNDDLTGVAVSVPVTAGTVAVDSTLLAMETGSTTHPNKSKITTIPYTTEVFAPVTETVT
FT                   VSAIPEKLATAHSVISVKPDVVPGTVLASVYGTLSIGPPIVYVSEEMKNGTLSTADILI
FT                   QRMGGFAGNVTITVKTFGGRCAQKEPSVWPFQDVYGVGNLTTWAFEEEDFEEQLLTLTF
FT                   LYGERERKIAVQILDDDEPEGQEFFYVFLTDPQGGAEIVRGKDSTGFSAFAVIIISGSD
FT                   LHNGIIGFSEESQRGLELREGADKNSQRLVVTRQPNRAFEEVQIFWRVTLNQTVTILQE
FT                   KGLNLTDELRFVAGVTTCTGGQTRCFIHLELNPKKVHQVEMPFFVELYDVTAGAAINNS
FT                   ARFAPIKLSKSGAPQSLVSFSVGSRLAVAHKKSTLISLQVARDSGTGIMMSVNFITQEL
FT                   RSAETVGRVLISPAVSGKDFVRTEGTLVFEPGQKSAVLDVVLTPETGSLNKFPKRFQIV
FT                   LFDPKGGARIDKVYGTANITLISDADSQAVWGLEDLLHQPLHEDILNRVLHNLNLRVAT
FT                   ESTDEQLSAVMLIMEKITMEGRNQAFSIKSRTLLYELLCVLINPKRKDTRGFSHFVEVA
FT                   EHFAFSLLTDVTCGSPGEKSKTILDSCPYLSILALHWNPQQINGHKFEGKEGDYIQIPE
FT                   RLLDVPEAEMLDGKNACTLVQFVEYSSQQWFIAGDNLPALKDKVLSLNVKGQSAQPLPN
FT                   NNEVLYRIHAAEPRVVPHTSRCLLWNQAAASWLSDSQFCKVVEDASDYVECACSHMSVY
FT                   AVYAQTDNSSSYNEAFFSAGLICISGLCLAVVSHMFCARHSMFAAKLLTHMMVASLGTQ
FT                   ILFLASAYASPHLSEESCSAVAAVAHYLYLCQFSWMLIQSVNFWYVLVVSDEHTERRCL
FT                   LFCLLSWGLPSFVVILLILILRGIYHRSMPQIYGLIHGDLCFIPNIYAALFTAALVPLM
FT                   CLVVVFVVFIHAYQLKPQWKGYDDVFRGRTNAAEIPLILYLFALISMTWLWGGLHMAYR
FT                   HFWMLVLFVIFNSLQGLYVFVVYFILHNQTCCPMKASYTVEMNGHPGPSTAFFTPGSGI
FT                   PPAGEINKSTQNLINAMEEVPSDWERSSFQQTSQASPDLKTSPQNGASFPSSGGYGPGS
FT                   LIADEESQEFDDLIFALKTGAGLSVSDNESGQGSQEGGTLTDSQIVELRRIPIADTHL"
FT   assembly_gap    12554793..12554812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12574577..12574596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12576496..12576515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12608127..12608146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12610821..12610840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12650718..12650769
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    12666643..12666662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12709787..12709806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12734156..12734379
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    12738027..12738046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12766501..12766520
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12786316..12786654
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    12790187..12790206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12797911..12798248
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   assembly_gap    12863323..12882019
FT                   /estimated_length=18697
FT                   /gap_type="unknown"
FT   assembly_gap    12903326..12903399
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   mRNA            complement(join(12913531..12913991,12916457..12916620,
FT                   12917167..12917346,12918651..12918750,12919296..12919426,
FT                   12925742..12925951,12928291..12929102,12929893..12930074,
FT                   12931324..12931568,12932347..12932562,12933102..12933317,
FT                   12936237..12936846,12939251..12939390,12940695..12940775,
FT                   12943994..12944123,12947643..12947845,12951058..12951238,
FT                   12952157..12952333,12964640..12965013,12966610..12967341,
FT                   12968340..12968554,12969144..12969270,12971254..12971520,
FT                   12972672..12972795,12973952..12974115,12975021..12975201,
FT                   12976027..12976212,12976298..12976424,12978173..12978330))
FT                   /locus_tag="mCG_121994"
FT                   /product="mCG121994, transcript variant mCT171162"
FT                   /note="gene_id=mCG121994.1 transcript_id=mCT171162.0
FT                   created on 26-JUL-2002"
FT   mRNA            complement(join(12913532..12913991,12916457..12916620,
FT                   12917167..12917346,12918651..12918750,12919296..12919426,
FT                   12925742..12925951,12928291..12929102,12929893..12930074,
FT                   12931324..12931568,12932347..12932562,12933102..12933317,
FT                   12936237..12936846,12939251..12939390,12940695..12940775,
FT                   12943994..12944123,12947643..12947845,12951058..12951238,
FT                   12952157..12952333,12964640..12965013,12966610..12967341,
FT                   12968340..12968554,12969144..12969270,12971254..12971520,
FT                   12972672..12972795,12973952..12974115,12975021..12975201,
FT                   12976027..12976212,12976298..12976424,12980905..12981128,
FT                   12982649..12982825,12985753..12986082,12986410..12986686,
FT                   12986975..12987540,12989382..12989495,12991668..12992483))
FT                   /locus_tag="mCG_121994"
FT                   /product="mCG121994, transcript variant mCT123207"
FT                   /note="gene_id=mCG121994.1 transcript_id=mCT123207.1
FT                   created on 26-JUL-2002"
FT   CDS             complement(join(12913833..12913991,12916457..12916620,
FT                   12917167..12917346,12918651..12918750,12919296..12919426,
FT                   12925742..12925951,12928291..12929102,12929893..12930074,
FT                   12931324..12931568,12932347..12932562,12933102..12933317,
FT                   12936237..12936846,12939251..12939390,12940695..12940775,
FT                   12943994..12944123,12947643..12947845,12951058..12951238,
FT                   12952157..12952333,12964640..12965013,12966610..12967341,
FT                   12968340..12968554,12969144..12969270,12971254..12971520,
FT                   12972672..12972795,12973952..12974115,12975021..12975201,
FT                   12976027..12976212,12976298..12976424,12980905..12981128,
FT                   12982649..12982825,12985753..12986082,12986410..12986686,
FT                   12986975..12987540,12989382..12989495,12991668..12991688))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121994"
FT                   /product="mCG121994, isoform CRA_b"
FT                   /note="gene_id=mCG121994.1 transcript_id=mCT123207.1
FT                   protein_id=mCP54817.1 isoform=CRA_b"
FT                   /protein_id="EDL37136.1"
FT                   /translation="MVTVTFDVSGGPNPPEEDLNPVRGNITFPPGRATVIYNVTVLDDE
FT                   VPENDELFLIQLRSVEGGAEINASRSSVEIIVKKNDSPVNFMQSVYVVPEDDHVLTIPV
FT                   LRGKDSDGNLIGSDETQVSIRYKVMTWDSTAHAQQNVDFIDLQPDTTLVFPPFVHESHL
FT                   KFQIIDDLIPEIAESFHIMLLKNTLQGDAVLMGPSTVQVTIKPNDKPYGVLSFNSILFE
FT                   RPVIIDEDTASSSRFEEIAVVRNGGTHGNVSVSWVLTRNSSDPSPVTADITPASGTLQF
FT                   AQGQMLAPISLVVFDDDLPEEAEAYLLTILPHTIQGGAEVSEPAQLLFYIQDSDNVYGE
FT                   IAFFPGESQKIESSPSERSLSLSLARRGGSKGDVRVIYSALYIPAGAMDPLRAKDGILN
FT                   TSRRSSLLFPEQNQQVSIKLPIRNDAFLQNGAHFLVQLEAVVLVNIFPPIPPVSPRFGE
FT                   IRNISLLVTPAIANGEIGFLSNLPIILHEPKDSSAEVVSIPLHRDGTDGQATVYWSLRP
FT                   SGFNSKAVTLDDAGPFNGSVVFLSGQNETSINITVKGDDIPELNETVTLSLDRVSVDSD
FT                   VLKSGYTSRDLIILENDDPGGIFEFSYDSRGPYVIKEGDAVELRITRSRGSLVKQFLRF
FT                   HVEPRESNEFYGNMGVLEFTPGEREVVITLLTRLDGTPELDEHFWVILSSHGERESKLG
FT                   CATLVNITILKNDYPHGIIEFVSDGLSASIKESKGEDIYHAVYGVIRTRGNFGAVNVSW
FT                   MVSPDFTQDVFPVQGTVCFGDQEFFKNITVYSLVDEIPEEMEEFTIILLNATGGAQTGI
FT                   RTTASLRILRNDDPVYFAEPCVLRVQEGETANFTVLRNGSVDGACTVQYATVDGKASGE
FT                   EGDFAPVEKGETLVFEVGSREQSISVHVKDDGIPETDEPFYIVLFNSTGDTVVYEYGVA
FT                   TVIIEANDDPNGVFSLEPIDKAVEEGKTNAFWILRHRGHFGNVSVAWQLFQNASLQPGQ
FT                   EFYETSGTVNFTDGEETKPVILRAFPDRIPEFNEFYILRLVNISGPGGQLAETNFQVTV
FT                   MIPFNDDPFGIFILDPECLEREVAEDVLSEDDMSYITSFTILRQQGVFGDVRVGWEVLS
FT                   REFTAGLPPMIDFILLGSFPSTVPLQPHMRRHHSGTDVLYFSGLEGAFGTVDPKYQPFR
FT                   NNTIANFTFSAWVMPNANTNGFLIAKDDSHGSIYYGVKIQTNETHVTLSLHYKTFGSNV
FT                   TYIAKSTVMKYLEEGVWLHVLIILDDGIIEFYLDGKAMPRGIKSLKGEAITDGPGILRI
FT                   GAGMDGGARFTGWMQDVRTYERKLTPEEIYELHAVPARTDLHPISGYLEFRQGESNKSF
FT                   IVAARDDSEEEGEELFLLKLVSVDGGAQISKENTTARLRIQKSDNANGLFGFTGACIPE
FT                   MTEEGSTVSCVVERTRGALGYVHVFYTISQIESEGINYLVDDFANASGTITFLPWQRSE
FT                   VLNLYVLDEDMPELNEYFRVTLVSAVPGDGKLGSTPISGASIDPEKETTGITVKASDHP
FT                   YGLMQFSTGLPPQPEDSMSLPASSVPHITVQEEDGEIRLLVIRAQGLLGRVTVGFRTVS
FT                   LTAFSPEDYQSTAGTLEFQSGERYKYIFVNITDNSIPELEKSFKVELLNLDGGVSDLFR
FT                   VDGSGSGEADTDFFLPPVLPHASLGVASQILVTIAASDHAHGVFEFSPESLFVSGTEPE
FT                   DGYSTVVLNVTRTRGALSAVTLQWKVDSDLDGDLAITSGNITFETGQRIASITVEILSD
FT                   EEPELDKALTVSILNVSSGSLGVLTNATLTILASDDPYGVFIFPNKTRPLSVEEATQNV
FT                   TLSIIRLKGLMGEVAVSYATIDDMEKPPYFPPNLARATQGGDYISASGLALFRANQTEA
FT                   TITISILDDAEPERSESVFIELFNSSLVDKVQNRPIPHSPRLGPKVETVAHLVIVANDD
FT                   AFGTVQLSATSVHVAENHVGPIINVTRTGGTFADVSVKFKAVPITAAAGEDYSIASSDV
FT                   VLLEGETTKAVPIYIINDIYPELEETFLVQLLNETTGGATLGPLREAVITIEASDDPYG
FT                   LFGFQNTKFIVEEPEFNSVRVNVPIIRNSGTLGNVTVQWVAIINGQFATGDLRVVSGNV
FT                   TFAPGETIQTLLLEVLADDVPEIEEVVQVQLAAASGGGTIGLDRVANIVIPANDNPYGS
FT                   VAFVQSVFRVQEPLERSSYANITVRRSGGHFGRLLLCYGTSDIDVVARAVEEGEDVLSY
FT                   YESPTQGVPDPLWRTWVNVSAVEETQYTCATLCLKERACSAFSVVSGAEGPRCFWMTSW
FT                   VSGTVNSSDFQTYKKNMTRVASLFSGQAVAGSDYEPVTRQWAVILEGDEFANLTVSVLP
FT                   DDAPEMDESFLISLLEVHLMNISDSFKNQPTIGHPNTSAVVIGLNGDAFGVFIIYSVSP
FT                   NTSEDGLCVEVQEQPQTSVELVIYRTGGSLGQVMVEWRVVGGTATEGLDFMGAGDILTF
FT                   AEGETKKMAILTILDDSEPEDNESILVRLVATEGGSRILPSSDTVTVNILANDNVAGIV
FT                   SFQTASRSVIGHEGEMLQFHVVRTPPGRGNVTVNWKVVGQNLEVNFANFTGQLFFSEGT
FT                   LNKTIFVHLLDDNIPEEKEVYQVVLYDVKTQGVSPAGVALLDAQGYAAVLTVEASDEPH
FT                   GVLNFALSSRFVVLQEANVTIQLFVNREFGSLGAINVTYATVPGIVSLKNNTEGNLAEP
FT                   ESDFIPVVGSLVLEEGETTAAISITVLEDDIPELKEYFLVNLTHVDLIMAPLTSSPPRL
FT                   GMGLSFMNLLTNCESQRTSLF"
FT   CDS             complement(join(12913833..12913991,12916457..12916620,
FT                   12917167..12917346,12918651..12918750,12919296..12919426,
FT                   12925742..12925951,12928291..12929102,12929893..12930074,
FT                   12931324..12931568,12932347..12932562,12933102..12933317,
FT                   12936237..12936846,12939251..12939390,12940695..12940775,
FT                   12943994..12944123,12947643..12947845,12951058..12951238,
FT                   12952157..12952333,12964640..12965013,12966610..12967341,
FT                   12968340..12968554,12969144..12969270,12971254..12971520,
FT                   12972672..12972795,12973952..12974115,12975021..12975201,
FT                   12976027..12976212,12976298..12976424,12978173..12978255))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121994"
FT                   /product="mCG121994, isoform CRA_a"
FT                   /note="gene_id=mCG121994.1 transcript_id=mCT171162.0
FT                   protein_id=mCP94080.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8P3"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR026919"
FT                   /db_xref="MGI:MGI:1274784"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8P3"
FT                   /protein_id="EDL37135.1"
FT                   /translation="MCLPSLRPSHCSFCVDRVETERFVVYFGVSVDSDVLKSGYTSRDL
FT                   IILENDDPGGIFEFSYDSRGPYVIKEGDAVELRITRSRGSLVKQFLRFHVEPRESNEFY
FT                   GNMGVLEFTPGEREVVITLLTRLDGTPELDEHFWVILSSHGERESKLGCATLVNITILK
FT                   NDYPHGIIEFVSDGLSASIKESKGEDIYHAVYGVIRTRGNFGAVNVSWMVSPDFTQDVF
FT                   PVQGTVCFGDQEFFKNITVYSLVDEIPEEMEEFTIILLNATGGAQTGIRTTASLRILRN
FT                   DDPVYFAEPCVLRVQEGETANFTVLRNGSVDGACTVQYATVDGKASGEEGDFAPVEKGE
FT                   TLVFEVGSREQSISVHVKDDGIPETDEPFYIVLFNSTGDTVVYEYGVATVIIEANDDPN
FT                   GVFSLEPIDKAVEEGKTNAFWILRHRGHFGNVSVAWQLFQNASLQPGQEFYETSGTVNF
FT                   TDGEETKPVILRAFPDRIPEFNEFYILRLVNISGPGGQLAETNFQVTVMIPFNDDPFGI
FT                   FILDPECLEREVAEDVLSEDDMSYITSFTILRQQGVFGDVRVGWEVLSREFTAGLPPMI
FT                   DFILLGSFPSTVPLQPHMRRHHSGTDVLYFSGLEGAFGTVDPKYQPFRNNTIANFTFSA
FT                   WVMPNANTNGFLIAKDDSHGSIYYGVKIQTNETHVTLSLHYKTFGSNVTYIAKSTVMKY
FT                   LEEGVWLHVLIILDDGIIEFYLDGKAMPRGIKSLKGEAITDGPGILRIGAGMDGGARFT
FT                   GWMQDVRTYERKLTPEEIYELHAVPARTDLHPISGYLEFRQGESNKSFIVAARDDSEEE
FT                   GEELFLLKLVSVDGGAQISKENTTARLRIQKSDNANGLFGFTGACIPEMTEEGSTVSCV
FT                   VERTRGALGYVHVFYTISQIESEGINYLVDDFANASGTITFLPWQRSEVLNLYVLDEDM
FT                   PELNEYFRVTLVSAVPGDGKLGSTPISGASIDPEKETTGITVKASDHPYGLMQFSTGLP
FT                   PQPEDSMSLPASSVPHITVQEEDGEIRLLVIRAQGLLGRVTVGFRTVSLTAFSPEDYQS
FT                   TAGTLEFQSGERYKYIFVNITDNSIPELEKSFKVELLNLDGGVSDLFRVDGSGSGEADT
FT                   DFFLPPVLPHASLGVASQILVTIAASDHAHGVFEFSPESLFVSGTEPEDGYSTVVLNVT
FT                   RTRGALSAVTLQWKVDSDLDGDLAITSGNITFETGQRIASITVEILSDEEPELDKALTV
FT                   SILNVSSGSLGVLTNATLTILASDDPYGVFIFPNKTRPLSVEEATQNVTLSIIRLKGLM
FT                   GEVAVSYATIDDMEKPPYFPPNLARATQGGDYISASGLALFRANQTEATITISILDDAE
FT                   PERSESVFIELFNSSLVDKVQNRPIPHSPRLGPKVETVAHLVIVANDDAFGTVQLSATS
FT                   VHVAENHVGPIINVTRTGGTFADVSVKFKAVPITAAAGEDYSIASSDVVLLEGETTKAV
FT                   PIYIINDIYPELEETFLVQLLNETTGGATLGPLREAVITIEASDDPYGLFGFQNTKFIV
FT                   EEPEFNSVRVNVPIIRNSGTLGNVTVQWVAIINGQFATGDLRVVSGNVTFAPGETIQTL
FT                   LLEVLADDVPEIEEVVQVQLAAASGGGTIGLDRVANIVIPANDNPYGSVAFVQSVFRVQ
FT                   EPLERSSYANITVRRSGGHFGRLLLCYGTSDIDVVARAVEEGEDVLSYYESPTQGVPDP
FT                   LWRTWVNVSAVEETQYTCATLCLKERACSAFSVVSGAEGPRCFWMTSWVSGTVNSSDFQ
FT                   TYKKNMTRVASLFSGQAVAGSDYEPVTRQWAVILEGDEFANLTVSVLPDDAPEMDESFL
FT                   ISLLEVHLMNISDSFKNQPTIGHPNTSAVVIGLNGDAFGVFIIYSVSPNTSEDGLCVEV
FT                   QEQPQTSVELVIYRTGGSLGQVMVEWRVVGGTATEGLDFMGAGDILTFAEGETKKMAIL
FT                   TILDDSEPEDNESILVRLVATEGGSRILPSSDTVTVNILANDNVAGIVSFQTASRSVIG
FT                   HEGEMLQFHVVRTPPGRGNVTVNWKVVGQNLEVNFANFTGQLFFSEGTLNKTIFVHLLD
FT                   DNIPEEKEVYQVVLYDVKTQGVSPAGVALLDAQGYAAVLTVEASDEPHGVLNFALSSRF
FT                   VVLQEANVTIQLFVNREFGSLGAINVTYATVPGIVSLKNNTEGNLAEPESDFIPVVGSL
FT                   VLEEGETTAAISITVLEDDIPELKEYFLVNLTHVDLIMAPLTSSPPRLGMGLSFMNLLT
FT                   NCESQRTSLF"
FT   assembly_gap    12923124..12923143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12938855..12939057
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   gene            complement(12986729..13040877)
FT                   /locus_tag="mCG_5654"
FT                   /note="gene_id=mCG5654.2"
FT   mRNA            complement(join(12986729..12987540,12989382..12989495,
FT                   12991668..12991772,13000052..13000147,13000484..13000633,
FT                   13002671..13002852,13040545..13040679,13040775..13040877))
FT                   /locus_tag="mCG_5654"
FT                   /product="mCG5654"
FT                   /note="gene_id=mCG5654.2 transcript_id=mCT4854.2 created on
FT                   05-FEB-2003"
FT   CDS             complement(join(12986959..12987540,12989382..12989495,
FT                   12991668..12991772,13000052..13000147,13000484..13000633,
FT                   13002671..13002852,13040545..13040566))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5654"
FT                   /product="mCG5654"
FT                   /note="gene_id=mCG5654.2 transcript_id=mCT4854.2
FT                   protein_id=mCP3060.2"
FT                   /db_xref="GOA:Q8BPQ5"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR026919"
FT                   /db_xref="MGI:MGI:1274784"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BPQ5"
FT                   /protein_id="EDL37138.1"
FT                   /translation="MSVTSEPGMISSFLLVYLSTLFISFVFGEAEIRFTGQTEFFVNET
FT                   STTVIRLVIERIGEPANVTAIVSLSGEDTGDFFDTYAAAFIPARGTNRTVYIAVCDDDL
FT                   PEPDETFTFHLTLQKPSANVKLGWPRAASVTILSNDNAFGIISFSTPSSISVIEPRSRN
FT                   ASVPLTLIREKGTYGMVTVTFDVSGGPNPPEEDLNPVRGNITFPPGRATVIYNVTVLDD
FT                   EVPENDELFLIQLRSVEGGAEINASRSSVEIIVKKNDSPVNFMQSVYVVPEDDHVLTIP
FT                   VLRGKDSDGNLIGSDETQVSIRYKVMTWDSTAHAQQNVDFIDLQPDTTLVFPPFVHESH
FT                   LKFQIIDDLIPEIAESFHIMLLKNTLQGDAVLMGPSTVQVTIKPNDKPYGVLSFNSILF
FT                   ERPVIIDEDTASRYNLL"
FT   assembly_gap    12990891..12990945
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    12994076..12995603
FT                   /estimated_length=1528
FT                   /gap_type="unknown"
FT   assembly_gap    12996603..12998086
FT                   /estimated_length=1484
FT                   /gap_type="unknown"
FT   assembly_gap    12999348..12999574
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    13003211..13003230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13024105..13024124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13035821..13035881
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    13045863..13045882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13057738..13058568
FT                   /estimated_length=831
FT                   /gap_type="unknown"
FT   gene            13065056..13080205
FT                   /gene="Lysmd3"
FT                   /locus_tag="mCG_5647"
FT                   /note="gene_id=mCG5647.2"
FT   mRNA            join(13065056..13065280,13072349..13072613,
FT                   13076505..13080205)
FT                   /gene="Lysmd3"
FT                   /locus_tag="mCG_5647"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 3, transcript variant mCT4859"
FT                   /note="gene_id=mCG5647.2 transcript_id=mCT4859.2 created on
FT                   26-JUL-2002"
FT   mRNA            join(<13065171..13065280,13072349..13072613,
FT                   13076564..13078528)
FT                   /gene="Lysmd3"
FT                   /locus_tag="mCG_5647"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 3, transcript variant mCT193516"
FT                   /note="gene_id=mCG5647.2 transcript_id=mCT193516.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(13072359..13072613,13076505..13077167)
FT                   /codon_start=1
FT                   /gene="Lysmd3"
FT                   /locus_tag="mCG_5647"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG5647.2 transcript_id=mCT4859.2
FT                   protein_id=mCP3061.2 isoform=CRA_b"
FT                   /protein_id="EDL37140.1"
FT                   /translation="MAGRNQNRTVSLPGIQASGHVLAFGNCTDNDMLEEDAEVYELRSR
FT                   GKEKVRRSASRDRLDDIVILTKDIQEGDTLNAVALQYCCTVADIKRVNNLISDQDFFAL
FT                   RSIKIPVKRFSSLTETLHPLKGRHILHPPPVPYFQEQDIVPADGSLSSSESAGSFLKEV
FT                   DRDIEQIVKCTDTKKENLNEVVSALTAQQVRFEPDNKSIHRKDPYYGADWGIGWWTAVV
FT                   IMLIVGIITPVFYLLYYEILAKVDVSHHSTVGSSHLHPGLTPPTQHREMENEIGPTKGI
FT                   PVGQQDDHKLYRQDPQAHDAQHKT"
FT   CDS             join(<13072594..13072613,13076564..13077167)
FT                   /codon_start=1
FT                   /gene="Lysmd3"
FT                   /locus_tag="mCG_5647"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG5647.2 transcript_id=mCT193516.0
FT                   protein_id=mCP114498.0 isoform=CRA_a"
FT                   /protein_id="EDL37139.1"
FT                   /translation="PFSTAVRSIKIPVKRFSSLTETLHPLKGRHILHPPPVPYFQEQDI
FT                   VPADGSLSSSESAGSFLKEVDRDIEQIVKCTDTKKENLNEVVSALTAQQVRFEPDNKSI
FT                   HRKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYYEILAKVDVSHHSTVGSSHLHPG
FT                   LTPPTQHREMENEIGPTKGIPVGQQDDHKLYRQDPQAHDAQHKT"
FT   gene            complement(13081177..13118860)
FT                   /locus_tag="mCG_5652"
FT                   /note="gene_id=mCG5652.2"
FT   mRNA            complement(join(13081177..13083456,13085450..13085593,
FT                   13089446..13089528,13094443..13094493,13096514..13096573,
FT                   13101965..13102094,13107061..13107210,13118175..13118860))
FT                   /locus_tag="mCG_5652"
FT                   /product="mCG5652"
FT                   /note="gene_id=mCG5652.2 transcript_id=mCT4864.2 created on
FT                   26-JUL-2002"
FT   CDS             complement(join(13083370..13083456,13085450..13085593,
FT                   13089446..13089528,13094443..13094493,13096514..13096573,
FT                   13101965..13102094,13107061..13107177))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5652"
FT                   /product="mCG5652"
FT                   /note="gene_id=mCG5652.2 transcript_id=mCT4864.2
FT                   protein_id=mCP3058.2"
FT                   /protein_id="EDL37141.1"
FT                   /translation="MAGNKGRGRAAYTFNIEAVGFSRGEKLPDVVLKPPPLFPDTDYKP
FT                   VPLKTGEDEDYMLALKQELRETVKRLPYFIEPPEEKQDDIERYSKRYMKVYKEEWVPDW
FT                   RRLPREMMPRKKCKKGDPKSKPSKAAAKATSLINSADVLKTIEELEKRGEGERSDEENE
FT                   EKEGSKEKDKDDEEDGEEDAEQEDYDEEEQEEENDYINSYFDNGDDFGVDSDDNMDEAT
FT                   Y"
FT   gene            13118810..13155277
FT                   /gene="2900024O10Rik"
FT                   /locus_tag="mCG_5653"
FT                   /note="gene_id=mCG5653.2"
FT   mRNA            join(13118810..13119299,13154027..13155277)
FT                   /gene="2900024O10Rik"
FT                   /locus_tag="mCG_5653"
FT                   /product="RIKEN cDNA 2900024O10"
FT                   /note="gene_id=mCG5653.2 transcript_id=mCT4853.2 created on
FT                   14-OCT-2002"
FT   CDS             join(13118846..13119299,13154027..13154412)
FT                   /codon_start=1
FT                   /gene="2900024O10Rik"
FT                   /locus_tag="mCG_5653"
FT                   /product="RIKEN cDNA 2900024O10"
FT                   /note="gene_id=mCG5653.2 transcript_id=mCT4853.2
FT                   protein_id=mCP3055.2"
FT                   /db_xref="GOA:Q8BL86"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="MGI:MGI:1920102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BL86"
FT                   /protein_id="EDL37142.1"
FT                   /translation="MSALEWYAHKSLGDGIFWIQERFYESGNRANIWLVRGSEQDVVID
FT                   TGLGLRSLPEYLYSSGLLQDCGSKEDAGRRPLLAVATHVHFDHSGGLYQFDQVAVHRAE
FT                   AEALARGDNFETVTWLSDSEVVRAPSPGWRARQFRVQAVQPTLILQDGDVINLGDRQLT
FT                   VMHMPGHSRGSICLHDKDRKVLFSGDVVYDGSLIDWLPYSRISDYVGTCERLIELVDRG
FT                   LVEKVLPGHFNTFGAERLFRLASNYISKAGICHKVSTFAMRSLASLALRVTNPRTSP"
FT   assembly_gap    13124840..13124859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13125178..13125197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13127648..13127667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13161971..13162837
FT                   /estimated_length=867
FT                   /gap_type="unknown"
FT   assembly_gap    13165022..13165041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13168786..13169003
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    13177156..13177189
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   gene            13187176..13201086
FT                   /gene="Cetn3"
FT                   /locus_tag="mCG_5651"
FT                   /note="gene_id=mCG5651.2"
FT   mRNA            join(13187176..13187287,13188572..13188707,
FT                   13190774..13190888,13195887..13196078,13200585..13201086)
FT                   /gene="Cetn3"
FT                   /locus_tag="mCG_5651"
FT                   /product="centrin 3"
FT                   /note="gene_id=mCG5651.2 transcript_id=mCT4863.2 created on
FT                   26-JUL-2002"
FT   CDS             join(13187271..13187287,13188572..13188707,
FT                   13190774..13190888,13195887..13196078,13200585..13200628)
FT                   /codon_start=1
FT                   /gene="Cetn3"
FT                   /locus_tag="mCG_5651"
FT                   /product="centrin 3"
FT                   /note="gene_id=mCG5651.2 transcript_id=mCT4863.2
FT                   protein_id=mCP3045.1"
FT                   /db_xref="GOA:Q545L8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1097706"
FT                   /db_xref="UniProtKB/TrEMBL:Q545L8"
FT                   /protein_id="EDL37143.1"
FT                   /translation="MSLALRGELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDQAI
FT                   DYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEIL
FT                   KAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIM
FT                   TGDI"
FT   assembly_gap    13222677..13223203
FT                   /estimated_length=527
FT                   /gap_type="unknown"
FT   assembly_gap    13236441..13236460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13273445..13273464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13288537..13288556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13295990..13296009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13297708..13297727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13302033..13302235
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    13311687..13311706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13315838..13316733
FT                   /estimated_length=896
FT                   /gap_type="unknown"
FT   assembly_gap    13318032..13318077
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    13332673..13332900
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    13365504..13365592
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    13379968..13379988
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    13383517..13383923
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    13417777..13417796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13421387..13421406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13445223..13445242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13450331..13450699
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    13461255..13461274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13531471..13531774
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    13540103..13540277
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    13551620..13551639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13581386..13581405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13648330..13648457
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    13650451..13650536
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   gene            <13650726..13652943
FT                   /locus_tag="mCG_141322"
FT                   /note="gene_id=mCG141322.0"
FT   mRNA            join(<13650726..13650791,13652539..13652943)
FT                   /locus_tag="mCG_141322"
FT                   /product="mCG141322"
FT                   /note="gene_id=mCG141322.0 transcript_id=mCT174610.0
FT                   created on 15-OCT-2002"
FT   CDS             join(<13650732..13650791,13652539..13652691)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141322"
FT                   /product="mCG141322"
FT                   /note="gene_id=mCG141322.0 transcript_id=mCT174610.0
FT                   protein_id=mCP97529.0"
FT                   /protein_id="EDL37144.1"
FT                   /translation="ILGLPFTAATEQLLGIGLPTICGGLNENGSHRPIGHGMIRMSGLV
FT                   GGNVSLGAGFSVSDVQARPSALFSC"
FT   assembly_gap    13691234..13691266
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    13720877..13721010
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    13728326..13728722
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    13737615..13738225
FT                   /estimated_length=611
FT                   /gap_type="unknown"
FT   assembly_gap    13741749..13741768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13758425..13758444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13776320..13776339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13779637..13780536)
FT                   /pseudo
FT                   /locus_tag="mCG_50703"
FT                   /note="gene_id=mCG50703.1"
FT   mRNA            complement(13779637..13780536)
FT                   /pseudo
FT                   /locus_tag="mCG_50703"
FT                   /note="gene_id=mCG50703.1 transcript_id=mCT50886.1 created
FT                   on 15-OCT-2002"
FT   assembly_gap    13849580..13849599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13876993..13877012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13912683..13912702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13921162..13923075)
FT                   /pseudo
FT                   /locus_tag="mCG_1050042"
FT                   /note="gene_id=mCG1050042.0"
FT   mRNA            complement(join(13921162..13921714,13921832..13922024,
FT                   13922242..13922451,13922539..13923075))
FT                   /pseudo
FT                   /locus_tag="mCG_1050042"
FT                   /note="gene_id=mCG1050042.0 transcript_id=mCT167746.1
FT                   created on 15-OCT-2002"
FT   gene            complement(13923507..13924300)
FT                   /pseudo
FT                   /locus_tag="mCG_141323"
FT                   /note="gene_id=mCG141323.0"
FT   mRNA            complement(13923507..13924300)
FT                   /pseudo
FT                   /locus_tag="mCG_141323"
FT                   /note="gene_id=mCG141323.0 transcript_id=mCT174611.0
FT                   created on 15-OCT-2002"
FT   assembly_gap    13927925..13928025
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    13939223..13939469
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    13947813..13947940
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    13950194..13950213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13958085..13958130
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    13960833..13961623
FT                   /estimated_length=791
FT                   /gap_type="unknown"
FT   assembly_gap    13975125..13975144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13991425..13991444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14016244..14016263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14040677..14040696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14047787..14047806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14116185..14116204
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14120035..14120298
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    14135438..14135618
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    14149309..14149385
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    14160550..14160569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14188712..14189089
FT                   /estimated_length=378
FT                   /gap_type="unknown"
FT   assembly_gap    14224605..14224671
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    14228735..14229523
FT                   /estimated_length=789
FT                   /gap_type="unknown"
FT   assembly_gap    14238645..14238743
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    14244198..14244429
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    14327975..14327994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14331896..14332635
FT                   /pseudo
FT                   /locus_tag="mCG_55625"
FT                   /note="gene_id=mCG55625.2"
FT   mRNA            14331896..14332635
FT                   /pseudo
FT                   /locus_tag="mCG_55625"
FT                   /note="gene_id=mCG55625.2 transcript_id=mCT55808.1 created
FT                   on 15-OCT-2002"
FT   assembly_gap    14337076..14337095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14378379..14378398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14396726..14397176
FT                   /estimated_length=451
FT                   /gap_type="unknown"
FT   assembly_gap    14400073..14400932
FT                   /estimated_length=860
FT                   /gap_type="unknown"
FT   assembly_gap    14428103..14428122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14441947..14442221
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    14443465..14443484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14454279..14454459
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    14456104..14456313
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    14460049..14460161
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   gene            14472009..14597864
FT                   /locus_tag="mCG_141321"
FT                   /note="gene_id=mCG141321.0"
FT   mRNA            join(14472009..14472501,14472780..14472814,
FT                   14502364..14502412,14597409..14597864)
FT                   /locus_tag="mCG_141321"
FT                   /product="mCG141321"
FT                   /note="gene_id=mCG141321.0 transcript_id=mCT174609.0
FT                   created on 15-OCT-2002"
FT   CDS             join(14502403..14502412,14597409..14597638)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141321"
FT                   /product="mCG141321"
FT                   /note="gene_id=mCG141321.0 transcript_id=mCT174609.0
FT                   protein_id=mCP97528.0"
FT                   /protein_id="EDL37145.1"
FT                   /translation="MQKEGSCCSIVLPGQSSARKKWCRKPGTRNIFRHERRPPATGRIQ
FT                   NCITGKEQSIKVPVKQTAEKDLAWIQNSSAGERW"
FT   assembly_gap    14502638..14503476
FT                   /estimated_length=839
FT                   /gap_type="unknown"
FT   assembly_gap    14507951..14507970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14510575..14510594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14511725..14511744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14514744..14514949
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    14554153..14554213
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    14554883..14555114
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    14584482..14589705
FT                   /estimated_length=5224
FT                   /gap_type="unknown"
FT   assembly_gap    14601878..14601897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14653343..14653362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14660578..14661192
FT                   /estimated_length=615
FT                   /gap_type="unknown"
FT   assembly_gap    14661953..14663307
FT                   /estimated_length=1355
FT                   /gap_type="unknown"
FT   assembly_gap    14666081..14666254
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    14668448..14668467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14681879..14681898
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14697227..14697585
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    14796195..14796266
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    14844376..14847178
FT                   /estimated_length=2803
FT                   /gap_type="unknown"
FT   assembly_gap    14862538..14862557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14873639..14873743
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            14907423..15068545
FT                   /gene="Mef2c"
FT                   /locus_tag="mCG_130733"
FT                   /note="gene_id=mCG130733.1"
FT   mRNA            join(14907423..14907604,14923615..14923710,
FT                   14978659..14978851,14994300..14994503,15027063..15027200,
FT                   15034564..15034750,15036918..15036965,15054307..15054479,
FT                   15056988..15057117,15057697..15057832,15063871..15068545)
FT                   /gene="Mef2c"
FT                   /locus_tag="mCG_130733"
FT                   /product="myocyte enhancer factor 2C, transcript variant
FT                   mCT115626"
FT                   /note="gene_id=mCG130733.1 transcript_id=mCT115626.2
FT                   created on 14-FEB-2003"
FT   mRNA            join(14927873..14928319,14978659..14978851,
FT                   14994300..14994503,15026858..15027001,15034564..15034750,
FT                   15036918..15036965,15054307..15054479,15056079..15056102,
FT                   15056988..15057117,15057697..15057832,15063871..15068545)
FT                   /gene="Mef2c"
FT                   /locus_tag="mCG_130733"
FT                   /product="myocyte enhancer factor 2C, transcript variant
FT                   mCT132058"
FT                   /note="gene_id=mCG130733.1 transcript_id=mCT132058.1
FT                   created on 14-FEB-2003"
FT   mRNA            join(14976728..14976895,14978656..14978851,
FT                   14994300..14994503,15026858..15027001,15034564..15034750,
FT                   15036918..15036965,15054307..15054479,15056079..15056102,
FT                   15056988..15057117,15057697..15057832,15063871..15068545)
FT                   /gene="Mef2c"
FT                   /locus_tag="mCG_130733"
FT                   /product="myocyte enhancer factor 2C, transcript variant
FT                   mCT171128"
FT                   /note="gene_id=mCG130733.1 transcript_id=mCT171128.0
FT                   created on 14-FEB-2003"
FT   mRNA            join(14978656..14978851,14994300..14994503,
FT                   15026858..15027001,15034564..15034750,15036918..15036965,
FT                   15054307..15054479,15056988..15057117,15057697..15057832,
FT                   15063775..15068545)
FT                   /gene="Mef2c"
FT                   /locus_tag="mCG_130733"
FT                   /product="myocyte enhancer factor 2C, transcript variant
FT                   mCT171129"
FT                   /note="gene_id=mCG130733.1 transcript_id=mCT171129.0
FT                   created on 14-FEB-2003"
FT   CDS             join(14978798..14978851,14994300..14994503,
FT                   15026858..15027001,15034564..15034750,15036918..15036965,
FT                   15054307..15054479,15056079..15056102,15056988..15057117,
FT                   15057697..15057832,15063871..15064099)
FT                   /codon_start=1
FT                   /gene="Mef2c"
FT                   /locus_tag="mCG_130733"
FT                   /product="myocyte enhancer factor 2C, isoform CRA_c"
FT                   /note="gene_id=mCG130733.1 transcript_id=mCT132058.1
FT                   protein_id=mCP54609.1 isoform=CRA_c"
FT                   /protein_id="EDL37148.1"
FT                   /translation="MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIAL
FT                   IIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDAD
FT                   DSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPSFEMPVTIPVSSHNSLVYSNPVST
FT                   LGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNS
FT                   PGLLVSPGNLNKNIQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQR
FT                   INNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTAS
FT                   ALHLGSVTGWQQQHLHNMPPSALSQLGDRTTTPSRYPQHTTRHEAGRSPVDSLSSCSSS
FT                   YDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT"
FT   CDS             join(14978798..14978851,14994300..14994503,
FT                   15026858..15027001,15034564..15034750,15036918..15036965,
FT                   15054307..15054479,15056079..15056102,15056988..15057117,
FT                   15057697..15057832,15063871..15064099)
FT                   /codon_start=1
FT                   /gene="Mef2c"
FT                   /locus_tag="mCG_130733"
FT                   /product="myocyte enhancer factor 2C, isoform CRA_c"
FT                   /note="gene_id=mCG130733.1 transcript_id=mCT171128.0
FT                   protein_id=mCP94046.0 isoform=CRA_c"
FT                   /protein_id="EDL37149.1"
FT                   /translation="MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIAL
FT                   IIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDAD
FT                   DSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPSFEMPVTIPVSSHNSLVYSNPVST
FT                   LGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNS
FT                   PGLLVSPGNLNKNIQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQR
FT                   INNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTAS
FT                   ALHLGSVTGWQQQHLHNMPPSALSQLGDRTTTPSRYPQHTTRHEAGRSPVDSLSSCSSS
FT                   YDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT"
FT   CDS             join(14978798..14978851,14994300..14994503,
FT                   15026858..15027001,15034564..15034750,15036918..15036965,
FT                   15054307..15054479,15056988..15057117,15057697..15057832,
FT                   15063775..15064099)
FT                   /codon_start=1
FT                   /gene="Mef2c"
FT                   /locus_tag="mCG_130733"
FT                   /product="myocyte enhancer factor 2C, isoform CRA_b"
FT                   /note="gene_id=mCG130733.1 transcript_id=mCT171129.0
FT                   protein_id=mCP94047.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V1B5"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="InterPro:IPR022102"
FT                   /db_xref="InterPro:IPR033896"
FT                   /db_xref="MGI:MGI:99458"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V1B5"
FT                   /protein_id="EDL37147.1"
FT                   /translation="MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIAL
FT                   IIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDAD
FT                   DSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPSFEMPVTIPVSSHNSLVYSNPVST
FT                   LGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNS
FT                   PGLLVSPGNLNKNIQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINNSQSAQ
FT                   SLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVT
FT                   GWQQQHLHNMPPSALSQLGACTSTHLSQSSNLSLPSTQSLSIKSEPVSPPRDRTTTPSR
FT                   YPQHTTRHEAGRSPVDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRM
FT                   RLSEGWAT"
FT   CDS             join(14978798..14978851,14994300..14994503,
FT                   15027063..15027200,15034564..15034750,15036918..15036965,
FT                   15054307..15054479,15056988..15057117,15057697..15057832,
FT                   15063871..15064099)
FT                   /codon_start=1
FT                   /gene="Mef2c"
FT                   /locus_tag="mCG_130733"
FT                   /product="myocyte enhancer factor 2C, isoform CRA_a"
FT                   /note="gene_id=mCG130733.1 transcript_id=mCT115626.2
FT                   protein_id=mCP54672.2 isoform=CRA_a"
FT                   /protein_id="EDL37146.1"
FT                   /translation="MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIAL
FT                   IIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENKGSESPDPDSS
FT                   YALTPRTEEKYKKINEEFDNMIKSHKIPAVPPPSFEMPVTIPVSSHNSLVYSNPVSTLG
FT                   NPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPG
FT                   LLVSPGNLNKNIQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINNSQSAQSL
FT                   ATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGW
FT                   QQQHLHNMPPSALSQLGDRTTTPSRYPQHTTRHEAGRSPVDSLSSCSSSYDGSDREDHR
FT                   NEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT"
FT   assembly_gap    14986853..14986872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15065360..15068547)
FT                   /locus_tag="mCG_55961"
FT                   /note="gene_id=mCG55961.2"
FT   mRNA            complement(15065360..15068547)
FT                   /locus_tag="mCG_55961"
FT                   /product="mCG55961"
FT                   /note="gene_id=mCG55961.2 transcript_id=mCT56144.2 created
FT                   on 16-OCT-2002"
FT   CDS             complement(15068099..15068272)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55961"
FT                   /product="mCG55961"
FT                   /note="gene_id=mCG55961.2 transcript_id=mCT56144.2
FT                   protein_id=mCP26174.2"
FT                   /protein_id="EDL37150.1"
FT                   /translation="METSPQKRKRKKNDTANHLKQSKLHACSDPCLLTSRVHCCIQTTT
FT                   RIQHLANLSELN"
FT   assembly_gap    15095103..15095269
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    15104090..15105009
FT                   /estimated_length=920
FT                   /gap_type="unknown"
FT   assembly_gap    15108996..15109015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15122213..15122232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15126405..15131038)
FT                   /locus_tag="mCG_141324"
FT                   /note="gene_id=mCG141324.0"
FT   mRNA            complement(join(15126405..15126939,15130945..15131038))
FT                   /locus_tag="mCG_141324"
FT                   /product="mCG141324"
FT                   /note="gene_id=mCG141324.0 transcript_id=mCT174612.0
FT                   created on 16-OCT-2002"
FT   CDS             complement(15126487..15126594)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141324"
FT                   /product="mCG141324"
FT                   /note="gene_id=mCG141324.0 transcript_id=mCT174612.0
FT                   protein_id=mCP97531.0"
FT                   /protein_id="EDL37151.1"
FT                   /translation="MVLGEPQKGPDNTGNTHNLYSKILSSGTLGTCKYC"
FT   assembly_gap    15129173..15130051
FT                   /estimated_length=879
FT                   /gap_type="unknown"
FT   gene            15131679..15136935
FT                   /locus_tag="mCG_148279"
FT                   /note="gene_id=mCG148279.0"
FT   mRNA            join(15131679..15131766,15133968..15134097,
FT                   15135927..15136935)
FT                   /locus_tag="mCG_148279"
FT                   /product="mCG148279"
FT                   /note="gene_id=mCG148279.0 transcript_id=mCT188542.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    15132083..15132497
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   CDS             15136593..15136751
FT                   /codon_start=1
FT                   /locus_tag="mCG_148279"
FT                   /product="mCG148279"
FT                   /note="gene_id=mCG148279.0 transcript_id=mCT188542.0
FT                   protein_id=mCP108256.0"
FT                   /protein_id="EDL37152.1"
FT                   /translation="MFQVMFQQFGDLQTICKQAQQPYSNLLDSSENLVLEFRLLEFSIS
FT                   FSMLIFK"
FT   assembly_gap    15145157..15145176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15159491..15159567
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    15159918..15160003
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   gene            complement(15162256..15163456)
FT                   /pseudo
FT                   /locus_tag="mCG_48947"
FT                   /note="gene_id=mCG48947.2"
FT   mRNA            complement(15162256..15163456)
FT                   /pseudo
FT                   /locus_tag="mCG_48947"
FT                   /note="gene_id=mCG48947.2 transcript_id=mCT49130.2 created
FT                   on 16-OCT-2002"
FT   assembly_gap    15194718..15195068
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    15204030..15205031
FT                   /estimated_length=1002
FT                   /gap_type="unknown"
FT   assembly_gap    15215361..15215380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <15227705..15229208
FT                   /locus_tag="mCG_1224"
FT                   /note="gene_id=mCG1224.1"
FT   mRNA            <15227705..15229208
FT                   /locus_tag="mCG_1224"
FT                   /product="mCG1224"
FT                   /note="gene_id=mCG1224.1 transcript_id=mCT8529.1 created on
FT                   16-OCT-2002"
FT   CDS             <15227798..15228730
FT                   /codon_start=1
FT                   /locus_tag="mCG_1224"
FT                   /product="mCG1224"
FT                   /note="gene_id=mCG1224.1 transcript_id=mCT8529.1
FT                   protein_id=mCP3065.2"
FT                   /protein_id="EDL37153.1"
FT                   /translation="LQLLRVGTICMACAISILKKDLADELALVVFMENKLKGEMMDLQH
FT                   GSLFLKTPKIVSSKDYCVTANSKLVIITTGARQQEGESRLNLVQRNMNIFKFILPNIVK
FT                   YSPHCKLLIVSNPVGILTYVAWKISGFPKSRVIGSGCSLDSARFRYLMGERLGVHALSC
FT                   HGWVLGEHGDSSVPVWSGVNVAGVSLKSLTPELVTDTDKEQWKEVHKQVVDSASEVIKL
FT                   KGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINDDVFLSVPCILGQNGISDV
FT                   VKVTLTPEEETRLKKSADTLWGIQKELQF"
FT   assembly_gap    15230374..15230393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15241739..15241758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15247208..15247313
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    15254629..15254648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15271373..15271716)
FT                   /locus_tag="mCG_1050051"
FT                   /note="gene_id=mCG1050051.1"
FT   mRNA            complement(15271373..15271716)
FT                   /locus_tag="mCG_1050051"
FT                   /product="mCG1050051"
FT                   /note="gene_id=mCG1050051.1 transcript_id=mCT167755.1
FT                   created on 16-OCT-2002"
FT   CDS             complement(15271457..15271570)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050051"
FT                   /product="mCG1050051"
FT                   /note="gene_id=mCG1050051.1 transcript_id=mCT167755.1
FT                   protein_id=mCP54640.1"
FT                   /protein_id="EDL37154.1"
FT                   /translation="MHLTIFYLKCSELQRQRFSSKYSIGRIFSLLTLSNRC"
FT   gene            15287474..15324995
FT                   /locus_tag="mCG_1050052"
FT                   /note="gene_id=mCG1050052.0"
FT   mRNA            join(15287474..15287680,15306989..15307075,
FT                   15324188..15324995)
FT                   /locus_tag="mCG_1050052"
FT                   /product="mCG1050052"
FT                   /note="gene_id=mCG1050052.0 transcript_id=mCT167756.0
FT                   created on 16-OCT-2002"
FT   CDS             join(15287645..15287680,15306989..15307075,
FT                   15324188..15324319)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050052"
FT                   /product="mCG1050052"
FT                   /note="gene_id=mCG1050052.0 transcript_id=mCT167756.0
FT                   protein_id=mCP54641.1"
FT                   /protein_id="EDL37155.1"
FT                   /translation="MHCPWTYQPQLRQSISFTSPMWDASPTSSLLLPLLGIYSSQTEAF
FT                   SPLRVSIQKLTERDADTHSQTVDRAWGLLWKNRRKNCWP"
FT   assembly_gap    15318964..15319508
FT                   /estimated_length=545
FT                   /gap_type="unknown"
FT   assembly_gap    15332248..15332267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15334191..15334210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15337896..15338037
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    15390795..15390842
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    15391981..15392113
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    15397168..15397187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15421256..15460669)
FT                   /locus_tag="mCG_3040"
FT                   /note="gene_id=mCG3040.2"
FT   mRNA            complement(join(15421256..15421656,15460546..15460669))
FT                   /locus_tag="mCG_3040"
FT                   /product="mCG3040, transcript variant mCT180443"
FT                   /note="gene_id=mCG3040.2 transcript_id=mCT180443.0 created
FT                   on 14-FEB-2003"
FT   mRNA            complement(join(15421256..15421656,15460542..15460669))
FT                   /locus_tag="mCG_3040"
FT                   /product="mCG3040, transcript variant mCT2368"
FT                   /note="gene_id=mCG3040.2 transcript_id=mCT2368.2 created on
FT                   14-FEB-2003"
FT   CDS             complement(15421407..15421634)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3040"
FT                   /product="mCG3040, isoform CRA_a"
FT                   /note="gene_id=mCG3040.2 transcript_id=mCT180443.0
FT                   protein_id=mCP103365.0 isoform=CRA_a"
FT                   /protein_id="EDL37156.1"
FT                   /translation="MPSSEKMPMTASTLERNTILGEDLLQLNVDVLISVLLDMELLISP
FT                   QELDAGPGCHVALSDAMPILDKVFIAGNVA"
FT   CDS             complement(15421407..15421634)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3040"
FT                   /product="mCG3040, isoform CRA_a"
FT                   /note="gene_id=mCG3040.2 transcript_id=mCT2368.2
FT                   protein_id=mCP3051.0 isoform=CRA_a"
FT                   /protein_id="EDL37157.1"
FT                   /translation="MPSSEKMPMTASTLERNTILGEDLLQLNVDVLISVLLDMELLISP
FT                   QELDAGPGCHVALSDAMPILDKVFIAGNVA"
FT   assembly_gap    15432202..15432221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15436827..15436853
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    15452469..15452488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15459108..15459291
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    15474069..15474319
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    15511888..15511907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15523217..15523236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15534757..15534776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15568516..15568535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15593502..15593521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15614767..15614798
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   gene            complement(15615203..15617799)
FT                   /locus_tag="mCG_148282"
FT                   /note="gene_id=mCG148282.0"
FT   mRNA            complement(join(15615203..15617512,15617760..15617799))
FT                   /locus_tag="mCG_148282"
FT                   /product="mCG148282"
FT                   /note="gene_id=mCG148282.0 transcript_id=mCT188545.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(15616381..15616614)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148282"
FT                   /product="mCG148282"
FT                   /note="gene_id=mCG148282.0 transcript_id=mCT188545.0
FT                   protein_id=mCP108258.0"
FT                   /protein_id="EDL37158.1"
FT                   /translation="MEVASAYQPVSDITFCEVLSFTCDTVGLPSVLNLAALLRIRKHLL
FT                   LYDSRIGIISRIESIPARGKTRNQFLLPYYFQ"
FT   gene            15617825..15691747
FT                   /gene="Tmem161b"
FT                   /locus_tag="mCG_3038"
FT                   /note="gene_id=mCG3038.2"
FT   mRNA            join(15617825..15618056,15646848..15646951,
FT                   15653379..15653462,15655761..15655858,15667789..15667945,
FT                   15678331..15678482,15678924..15678984,15679604..15679744,
FT                   15682285..15682398,15687979..15688153,15688984..15689080,
FT                   15690210..15691747)
FT                   /gene="Tmem161b"
FT                   /locus_tag="mCG_3038"
FT                   /product="transmembrane protein 161B, transcript variant
FT                   mCT2371"
FT                   /note="gene_id=mCG3038.2 transcript_id=mCT2371.3 created on
FT                   19-FEB-2003"
FT   mRNA            join(15617825..15618056,15653379..15653462,
FT                   15655761..15655858,15667789..15667945,15678369..15678482,
FT                   15678924..15678984,15679604..15679744,15682285..15682398,
FT                   15687979..15688153,15688984..15689080,15690210..15691475)
FT                   /gene="Tmem161b"
FT                   /locus_tag="mCG_3038"
FT                   /product="transmembrane protein 161B, transcript variant
FT                   mCT180698"
FT                   /note="gene_id=mCG3038.2 transcript_id=mCT180698.0 created
FT                   on 19-FEB-2003"
FT   mRNA            join(15617825..15618056,15653379..15653462,
FT                   15655761..15655858,15667789..15670107)
FT                   /gene="Tmem161b"
FT                   /locus_tag="mCG_3038"
FT                   /product="transmembrane protein 161B, transcript variant
FT                   mCT180699"
FT                   /note="gene_id=mCG3038.2 transcript_id=mCT180699.0 created
FT                   on 19-FEB-2003"
FT   mRNA            join(15617825..15618056,15646848..15646951,
FT                   15653379..15654580)
FT                   /gene="Tmem161b"
FT                   /locus_tag="mCG_3038"
FT                   /product="transmembrane protein 161B, transcript variant
FT                   mCT180700"
FT                   /note="gene_id=mCG3038.2 transcript_id=mCT180700.0 created
FT                   on 19-FEB-2003"
FT   mRNA            join(<15617936..15618056,15646848..15646951,
FT                   15653379..15653462,15655761..15655858,15667789..15667945,
FT                   15678331..15678482,15678924..15678984,15679604..15679804,
FT                   15682285..15682398,15687979..15688153,15688984..15689080,
FT                   15690210..15691475)
FT                   /gene="Tmem161b"
FT                   /locus_tag="mCG_3038"
FT                   /product="transmembrane protein 161B, transcript variant
FT                   mCT193523"
FT                   /note="gene_id=mCG3038.2 transcript_id=mCT193523.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<15617937..15618056,15646848..15646951,
FT                   15653379..15653462,15655761..15655858,15667789..15667945,
FT                   15678331..15678482,15678924..15678984,15679604..15679748)
FT                   /codon_start=1
FT                   /gene="Tmem161b"
FT                   /locus_tag="mCG_3038"
FT                   /product="transmembrane protein 161B, isoform CRA_c"
FT                   /note="gene_id=mCG3038.2 transcript_id=mCT193523.0
FT                   protein_id=mCP114497.0 isoform=CRA_c"
FT                   /protein_id="EDL37162.1"
FT                   /translation="AGRPFPSRFRELRFAEPEGEILDGPGDSRLSVPRPVLGVMGVIGI
FT                   QLVVTMVMASVMQKIIPHYSLARWLLCNGSLRWYQHPSEEELRILAGKQQKGKSKKDRK
FT                   YNGHIENKPLTIPKDIDLHLETKSVTEVDTLALHYFPEYQWLVDFTVAATIVYLVTEVY
FT                   YSFMKPTQEMNISLVWCLLVLSFAIKVLFSLTTHYFKVEDGGERSVCVTFGFFFFVKAM
FT                   AVLIVTENYLEFGLETGFTNFSDSAMQFLEKQGLESQGPVSKLTFKFFLAVFCSLIGAF
FT                   LTFPGLRLAQMHLDALNMATEKITQ"
FT   CDS             join(15618054..15618056,15646848..15646951,
FT                   15653379..15653462,15655761..15655858,15667789..15667945,
FT                   15678331..15678482,15678924..15678984,15679604..15679744,
FT                   15682285..15682398,15687979..15688153,15688984..15689080,
FT                   15690210..15690487)
FT                   /codon_start=1
FT                   /gene="Tmem161b"
FT                   /locus_tag="mCG_3038"
FT                   /product="transmembrane protein 161B, isoform CRA_d"
FT                   /note="gene_id=mCG3038.2 transcript_id=mCT2371.3
FT                   protein_id=mCP3047.3 isoform=CRA_d"
FT                   /protein_id="EDL37163.1"
FT                   /translation="MGVIGIQLVVTMVMASVMQKIIPHYSLARWLLCNGSLRWYQHPSE
FT                   EELRILAGKQQKGKSKKDRKYNGHIENKPLTIPKDIDLHLETKSVTEVDTLALHYFPEY
FT                   QWLVDFTVAATIVYLVTEVYYSFMKPTQEMNISLVWCLLVLSFAIKVLFSLTTHYFKVE
FT                   DGGERSVCVTFGFFFFVKAMAVLIVTENYLEFGLETGFTNFSDSAMQFLEKQGLESQGP
FT                   VSKLTFKFFLAVFCSLIGAFLTFPGLRLAQMHLDALNMATEKITQTLLHINFLAPLFMV
FT                   LLWVKPITKDYIMNPPLGRESVPLMTEATFDTLRLWLIILLCVLRLAMMRSHLQAYLNL
FT                   AQKCVDQMKKEAGRISTVELQKMVARVFYYLCVIALQYVAPLVMLLHMTLLLKTLGNHS
FT                   WGIYPEAAFPLPVDNNLPANSAYPELPSPDGKMKVTVTQITVALSSLKNIFTPLLFRGL
FT                   LSFLTWWIAACLFSTSLFGLFYHQYLTVA"
FT   CDS             join(15618054..15618056,15646848..15646951,
FT                   15653379..15653466)
FT                   /codon_start=1
FT                   /gene="Tmem161b"
FT                   /locus_tag="mCG_3038"
FT                   /product="transmembrane protein 161B, isoform CRA_b"
FT                   /note="gene_id=mCG3038.2 transcript_id=mCT180700.0
FT                   protein_id=mCP103621.0 isoform=CRA_b"
FT                   /protein_id="EDL37161.1"
FT                   /translation="MGVIGIQLVVTMVMASVMQKIIPHYSLARWLLCNGSLRWYQHPSE
FT                   EELRILAGKQQKGKSKKDR"
FT   CDS             join(15618054..15618056,15653379..15653453)
FT                   /codon_start=1
FT                   /gene="Tmem161b"
FT                   /locus_tag="mCG_3038"
FT                   /product="transmembrane protein 161B, isoform CRA_a"
FT                   /note="gene_id=mCG3038.2 transcript_id=mCT180698.0
FT                   protein_id=mCP103622.0 isoform=CRA_a"
FT                   /protein_id="EDL37159.1"
FT                   /translation="MFEMVSTSFRRRIKNPCREAAERKK"
FT   CDS             join(15618054..15618056,15653379..15653453)
FT                   /codon_start=1
FT                   /gene="Tmem161b"
FT                   /locus_tag="mCG_3038"
FT                   /product="transmembrane protein 161B, isoform CRA_a"
FT                   /note="gene_id=mCG3038.2 transcript_id=mCT180699.0
FT                   protein_id=mCP103620.0 isoform=CRA_a"
FT                   /protein_id="EDL37160.1"
FT                   /translation="MFEMVSTSFRRRIKNPCREAAERKK"
FT   gene            complement(15676455..15677743)
FT                   /pseudo
FT                   /locus_tag="mCG_50701"
FT                   /note="gene_id=mCG50701.2"
FT   mRNA            complement(15676455..15677743)
FT                   /pseudo
FT                   /locus_tag="mCG_50701"
FT                   /note="gene_id=mCG50701.2 transcript_id=mCT50884.2 created
FT                   on 17-OCT-2002"
FT   assembly_gap    15729438..15729462
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            complement(15734686..15735828)
FT                   /pseudo
FT                   /locus_tag="mCG_57499"
FT                   /note="gene_id=mCG57499.2"
FT   mRNA            complement(15734686..15735828)
FT                   /pseudo
FT                   /locus_tag="mCG_57499"
FT                   /note="gene_id=mCG57499.2 transcript_id=mCT57682.2 created
FT                   on 17-OCT-2002"
FT   assembly_gap    15754085..15754949
FT                   /estimated_length=865
FT                   /gap_type="unknown"
FT   assembly_gap    15768522..15768546
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    15807983..15808094
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    15832158..15832177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15833376..15833395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15839110..15839129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15840534..15840553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15846044..15846063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15859015..15859251
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    15866352..15866371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15893850..15894422
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    15904382..15904401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15934212..15934231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15977764..15978095
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    15986310..15986646
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    15995317..15995336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16015508..16015895
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   assembly_gap    16037173..16037192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16038720..16038873
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    16043478..16043569
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    16045080..16046469
FT                   /estimated_length=1390
FT                   /gap_type="unknown"
FT   assembly_gap    16047772..16048108
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    16055883..16055902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16062487..16063270
FT                   /estimated_length=784
FT                   /gap_type="unknown"
FT   assembly_gap    16068491..16068540
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            complement(16082532..16083302)
FT                   /pseudo
FT                   /locus_tag="mCG_3039"
FT                   /note="gene_id=mCG3039.2"
FT   mRNA            complement(16082532..16083302)
FT                   /pseudo
FT                   /locus_tag="mCG_3039"
FT                   /note="gene_id=mCG3039.2 transcript_id=mCT2367.2 created on
FT                   04-FEB-2003"
FT   assembly_gap    16205227..16205246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16211591..16212428
FT                   /estimated_length=838
FT                   /gap_type="unknown"
FT   assembly_gap    16217856..16217875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16232556..16232917
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    16270986..16271005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16272010..16272029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16275058..16275367
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    16283826..16283864
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    16291887..16291906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16293520..16293539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16296043..16300431
FT                   /estimated_length=4389
FT                   /gap_type="unknown"
FT   assembly_gap    16307386..16307405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16311250..16311400
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    16317366..16317385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16328257..16328276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16329434..16329801
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    16339232..16339251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16352000..16352605)
FT                   /pseudo
FT                   /locus_tag="mCG_50076"
FT                   /note="gene_id=mCG50076.2"
FT   mRNA            complement(16352000..16352605)
FT                   /pseudo
FT                   /locus_tag="mCG_50076"
FT                   /note="gene_id=mCG50076.2 transcript_id=mCT50259.2 created
FT                   on 17-OCT-2002"
FT   assembly_gap    16395122..16395141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16417124..16423971
FT                   /estimated_length=6848
FT                   /gap_type="unknown"
FT   assembly_gap    16453386..16453405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16471506..16471525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16491068..16491297
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    16500032..16500051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16508011..16508030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16510442..16510461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16515934..16515953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16518375..16518394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16519610..16519629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16520682..16520701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16521769..16521788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16523083..16523102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16524416..16524435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16526405..16526424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16531840..16535521
FT                   /estimated_length=3682
FT                   /gap_type="unknown"
FT   assembly_gap    16557872..16558676
FT                   /estimated_length=805
FT                   /gap_type="unknown"
FT   gene            16568176..16592581
FT                   /gene="Ccnh"
FT                   /locus_tag="mCG_16907"
FT                   /note="gene_id=mCG16907.2"
FT   mRNA            join(16568176..16568399,16569502..16569624,
FT                   16575111..16575184,16576207..16576417,16581188..16581351,
FT                   16584983..16585053,16587635..16587746,16590711..16590771,
FT                   16591597..16592581)
FT                   /gene="Ccnh"
FT                   /locus_tag="mCG_16907"
FT                   /product="cyclin H, transcript variant mCT14468"
FT                   /note="gene_id=mCG16907.2 transcript_id=mCT14468.1 created
FT                   on 26-JUL-2002"
FT   mRNA            join(<16568224..16568399,16569502..16569624,
FT                   16575111..16575184,16576207..16576417,16581296..16581351,
FT                   16584983..16585053,16587635..16587746,16590711..>16590771)
FT                   /gene="Ccnh"
FT                   /locus_tag="mCG_16907"
FT                   /product="cyclin H, transcript variant mCT193519"
FT                   /note="gene_id=mCG16907.2 transcript_id=mCT193519.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<16568226..16568399,16569502..16569624,
FT                   16575111..16575184,16576207..16576417,16581296..16581351,
FT                   16584983..16585053,16587635..16587746,16590711..>16590771)
FT                   /codon_start=1
FT                   /gene="Ccnh"
FT                   /locus_tag="mCG_16907"
FT                   /product="cyclin H, isoform CRA_b"
FT                   /note="gene_id=mCG16907.2 transcript_id=mCT193519.0
FT                   protein_id=mCP114491.0 isoform=CRA_b"
FT                   /protein_id="EDL37165.1"
FT                   /translation="CLSECRCFCRGPAAREGYSMYHSSSQKRHWTFASEEQLARLRADA
FT                   NRKFKCKAVANGKVLPNDPVFLEPHEELTLCKYYEKRLLEFCSVFKPAMPRSVVGTACM
FT                   YFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQERALEQIL
FT                   EYELLLIQQLNFHLIVHNPYRPFEGFLIDIKIALTAILSSASRAGITMESYLSESLMLK
FT                   ENRTCLSQLLDIMKSMRNLVKKYEPPRSDEVAVLKQKLERCHSSDLALNAVTKKRKGYE
FT                   DDDYVSKKPKQEE"
FT   CDS             join(16568283..16568399,16569502..16569624,
FT                   16575111..16575184,16576207..16576417,16581188..16581351,
FT                   16584983..16585053,16587635..16587746,16590711..16590771,
FT                   16591597..16591635)
FT                   /codon_start=1
FT                   /gene="Ccnh"
FT                   /locus_tag="mCG_16907"
FT                   /product="cyclin H, isoform CRA_a"
FT                   /note="gene_id=mCG16907.2 transcript_id=mCT14468.1
FT                   protein_id=mCP3052.1 isoform=CRA_a"
FT                   /protein_id="EDL37164.1"
FT                   /translation="MYHSSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDP
FT                   VFLEPHEELTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRII
FT                   MLTCAFLACKVDEFNVSSPQFVGNLRESPLGQERALEQILEYELLLIQQLNFHLIVHNP
FT                   YRPFEGFLIDIKTRYPMLENPEILRKTADDFLSRIALTDAYLLYTPSQIALTAILSSAS
FT                   RAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSDEVAVLKQKLERCH
FT                   SSDLALNAVTKKRKGYEDDDYVSKKPKQEEEEWTDDDLVDSL"
FT   gene            complement(16593934..16670114)
FT                   /gene="Rasa1"
FT                   /locus_tag="mCG_2802"
FT                   /note="gene_id=mCG2802.2"
FT   mRNA            complement(join(16593934..16594887,16594970..16595050,
FT                   16595744..16595878,16597049..16597126,16598273..16598361,
FT                   16600332..16600399,16602327..16602413,16603076..16603191,
FT                   16604357..16604499,16605409..16605568,16605839..16606011,
FT                   16607118..16607194,16607495..16607652,16608492..16608569,
FT                   16609276..16609363,16612483..16612639,16613249..16613369,
FT                   16617025..16617103,16623067..16623247,16625468..16625520,
FT                   16629340..16629371,16631736..16631853,16636091..16636161,
FT                   16637046..16637181,16638996..16639148,16669024..16670114))
FT                   /gene="Rasa1"
FT                   /locus_tag="mCG_2802"
FT                   /product="RAS p21 protein activator 1"
FT                   /note="gene_id=mCG2802.2 transcript_id=mCT2386.2 created on
FT                   17-OCT-2002"
FT   CDS             complement(join(16594552..16594887,16594970..16595050,
FT                   16595744..16595878,16597049..16597126,16598273..16598361,
FT                   16600332..16600399,16602327..16602413,16603076..16603191,
FT                   16604357..16604499,16605409..16605568,16605839..16606011,
FT                   16607118..16607194,16607495..16607652,16608492..16608569,
FT                   16609276..16609363,16612483..16612639,16613249..16613369,
FT                   16617025..16617103,16623067..16623247,16625468..16625520,
FT                   16629340..16629371,16631736..16631853,16636091..16636161,
FT                   16637046..16637181,16638996..16639148,16669024..16669535))
FT                   /codon_start=1
FT                   /gene="Rasa1"
FT                   /locus_tag="mCG_2802"
FT                   /product="RAS p21 protein activator 1"
FT                   /note="gene_id=mCG2802.2 transcript_id=mCT2386.2
FT                   protein_id=mCP20462.2"
FT                   /protein_id="EDL37166.1"
FT                   /translation="MMAAEAGSEEGGPATAGPGGGAATGSSAYSAACRVKLPAALPVAA
FT                   APCPGLADADLVAALGGGAASGSGFLGTGPVAGVLGGAALTGSAAAGVAGAAAAGPAGD
FT                   VAFTKGTLSLPAETLGPGGGFPPLPPPPQLPPLGSGLGTVDEGDSLDGPEYEEEEVAIP
FT                   LTAPPTNQWYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQTNVVNHFR
FT                   IIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPY
FT                   TKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGK
FT                   IWFHGKISKQEAYNLLMTEYKTNSLIFTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQR
FT                   FKICPTPNNQFMMGGRYYNSIGDIIDHYRKEQIVEGYYLKEPVPMQDQGQVLNDTVDGK
FT                   EIYNTIRRKTKDAFYKNIVKKGYLLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKP
FT                   KGLIDLSVCSVYVVHDSLFGRPNCFQIVVQHFSEEHYIFYFAGETPEQAEDWMKGLQAF
FT                   CSLRKSSPGTSNKRLRQVSSLVLHIEEAHKLPVKHFTNPYCNIYLNSVQVAKTHAREGQ
FT                   NPVWSEEFVFDDLPPDINRFEITLSNKTKKSKDPDILFMRCQLSRLQKGHATDEWFLLS
FT                   SHIPLKGIEPGSLRVRARYSMEKIMPEEEYSEFKELILQKELHVVYALSHVCGQDRTLL
FT                   ASILLKIFLHEKLESLLLCTLNDREISMEDEATTLFRATTLASTLMEQYMKATATQFVH
FT                   HALKDSILKIMESKQSCELSPSKLEKNEDVNTNLAHLLSILSELVEKIFMASEILPPTL
FT                   RYIYGCLQKSVQHKWPTNNTMRTRVVSGFVFLRLICPAILNPRMFNIISDSPSPIAART
FT                   LTLVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSR
FT                   TDLSRDLAALHEICVAHSDELRTLSNERGVQQHVLKKLLAITELLQQKQNQYTKTNDIR
FT                   KKIEKEKNSTLSHIPVMCELCKQKPKILLKRNCQHLCKLSVQNIAHFFHMESLPNSEPW
FT                   CTLNNNKNAMTDCVLNFENIFSVYPIAKVLLSLGKGTMKSTDKETHSIDNRI"
FT   assembly_gap    16629917..16629936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16634137..16634156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16693147..16693247
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    16708203..16709995
FT                   /estimated_length=1793
FT                   /gap_type="unknown"
FT   assembly_gap    16711321..16711340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16761326..16763178
FT                   /estimated_length=1853
FT                   /gap_type="unknown"
FT   assembly_gap    16780017..16780036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16782307..16782941
FT                   /estimated_length=635
FT                   /gap_type="unknown"
FT   assembly_gap    16789851..16791310
FT                   /estimated_length=1460
FT                   /gap_type="unknown"
FT   assembly_gap    16795166..16795448
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    16797762..16797781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16801436..16801455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16804682..16804701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16805750..16805769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16807060..16807079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16809544..16811226
FT                   /estimated_length=1683
FT                   /gap_type="unknown"
FT   assembly_gap    16814618..16814637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16815745..16815764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16817915..16817934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16819073..16819092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16822388..16822407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16825174..16825193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16838450..16838469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16842095..16842416
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    16844080..16849200
FT                   /estimated_length=5121
FT                   /gap_type="unknown"
FT   assembly_gap    16852597..16852616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16854184..16858716
FT                   /estimated_length=4533
FT                   /gap_type="unknown"
FT   assembly_gap    16866640..16866659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16888287..16890259
FT                   /estimated_length=1973
FT                   /gap_type="unknown"
FT   assembly_gap    16969502..16969521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16971784..16973159)
FT                   /pseudo
FT                   /locus_tag="mCG_51757"
FT                   /note="gene_id=mCG51757.2"
FT   mRNA            complement(16971784..16973159)
FT                   /pseudo
FT                   /locus_tag="mCG_51757"
FT                   /note="gene_id=mCG51757.2 transcript_id=mCT51940.2 created
FT                   on 17-OCT-2002"
FT   assembly_gap    17003971..17003990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17045840..17046006
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    17048682..17048701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17054738..17058111
FT                   /estimated_length=3374
FT                   /gap_type="unknown"
FT   assembly_gap    17124566..17124636
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    17133973..17134017
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    17160845..17160966
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    17184410..17184758
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    17185852..17205902
FT                   /estimated_length=20051
FT                   /gap_type="unknown"
FT   assembly_gap    17248315..17248873
FT                   /estimated_length=559
FT                   /gap_type="unknown"
FT   assembly_gap    17264352..17264371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            17266267..17266756
FT                   /pseudo
FT                   /locus_tag="mCG_49996"
FT                   /note="gene_id=mCG49996.2"
FT   mRNA            17266267..17266756
FT                   /pseudo
FT                   /locus_tag="mCG_49996"
FT                   /note="gene_id=mCG49996.2 transcript_id=mCT50179.2 created
FT                   on 05-FEB-2003"
FT   assembly_gap    17271315..17271334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17273249..17273268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17274548..17279561
FT                   /estimated_length=5014
FT                   /gap_type="unknown"
FT   assembly_gap    17304562..17304602
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    17314685..17315131
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   assembly_gap    17316737..17316756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17328671..17329289
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   assembly_gap    17362540..17362559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17365600..17365619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17390593..17390739
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    17401099..17401118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17405694..17410927
FT                   /estimated_length=5234
FT                   /gap_type="unknown"
FT   assembly_gap    17415697..17415716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17430575..17432667)
FT                   /locus_tag="mCG_1735"
FT                   /note="gene_id=mCG1735.3"
FT   mRNA            complement(join(17430575..17430685,17431504..17431630,
FT                   17432378..17432667))
FT                   /locus_tag="mCG_1735"
FT                   /product="mCG1735, transcript variant mCT180695"
FT                   /note="gene_id=mCG1735.3 transcript_id=mCT180695.0 created
FT                   on 19-FEB-2003"
FT   mRNA            complement(join(17430575..17430685,17431504..17431646,
FT                   17432378..17432667))
FT                   /locus_tag="mCG_1735"
FT                   /product="mCG1735, transcript variant mCT1104"
FT                   /note="gene_id=mCG1735.3 transcript_id=mCT1104.3 created on
FT                   19-FEB-2003"
FT   mRNA            complement(join(17430598..17430685,17431504..17431646,
FT                   17432041..17432232))
FT                   /locus_tag="mCG_1735"
FT                   /product="mCG1735, transcript variant mCT180694"
FT                   /note="gene_id=mCG1735.3 transcript_id=mCT180694.0 created
FT                   on 19-FEB-2003"
FT   CDS             complement(join(17431530..17431646,17432378..17432452))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1735"
FT                   /product="mCG1735, isoform CRA_a"
FT                   /note="gene_id=mCG1735.3 transcript_id=mCT1104.3
FT                   protein_id=mCP15947.1 isoform=CRA_a"
FT                   /protein_id="EDL37167.1"
FT                   /translation="MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWRLLAMMTVYF
FT                   GSGFAAPFFIVRHQLLKK"
FT   CDS             complement(17431530..17431604)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1735"
FT                   /product="mCG1735, isoform CRA_b"
FT                   /note="gene_id=mCG1735.3 transcript_id=mCT180694.0
FT                   protein_id=mCP103617.0 isoform=CRA_b"
FT                   /db_xref="GOA:B8JJB0"
FT                   /db_xref="InterPro:IPR004202"
FT                   /db_xref="MGI:MGI:103226"
FT                   /db_xref="UniProtKB/TrEMBL:B8JJB0"
FT                   /protein_id="EDL37168.1"
FT                   /translation="MMTVYFGSGFAAPFFIVRHQLLKK"
FT   CDS             complement(join(17431601..17431630,17432378..17432452))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1735"
FT                   /product="mCG1735, isoform CRA_c"
FT                   /note="gene_id=mCG1735.3 transcript_id=mCT180695.0
FT                   protein_id=mCP103616.0 isoform=CRA_c"
FT                   /protein_id="EDL37169.1"
FT                   /translation="MLGQSIRRFTTSVVRRSHYEEGPGKWKTSGGCWL"
FT   assembly_gap    17475825..17475844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17483300..17483534
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    17511783..17512317
FT                   /estimated_length=535
FT                   /gap_type="unknown"
FT   assembly_gap    17527663..17527682
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17536893..17537540
FT                   /estimated_length=648
FT                   /gap_type="unknown"
FT   assembly_gap    17572314..17572333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17573519..17573538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17575047..17575066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17578175..17578194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17585662..17585681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17603116..17603655
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   assembly_gap    17604171..17604971
FT                   /estimated_length=801
FT                   /gap_type="unknown"
FT   assembly_gap    17612903..17612922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            17614344..17617883
FT                   /pseudo
FT                   /locus_tag="mCG_1050059"
FT                   /note="gene_id=mCG1050059.0"
FT   mRNA            join(17614344..17614706,17616856..17617030,
FT                   17617461..17617883)
FT                   /pseudo
FT                   /locus_tag="mCG_1050059"
FT                   /note="gene_id=mCG1050059.0 transcript_id=mCT167763.1
FT                   created on 05-FEB-2003"
FT   assembly_gap    17615135..17615154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17616373..17616392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17625573..17625592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17633630..17633649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17642581..17642764
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    17656499..17656650
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    17662974..17664113
FT                   /estimated_length=1140
FT                   /gap_type="unknown"
FT   assembly_gap    17671581..17671846
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    17673338..17674256
FT                   /estimated_length=919
FT                   /gap_type="unknown"
FT   assembly_gap    17677866..17677992
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    17681601..17687538
FT                   /estimated_length=5938
FT                   /gap_type="unknown"
FT   assembly_gap    17705381..17705477
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    17737565..17737664
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    17763149..17764619
FT                   /estimated_length=1471
FT                   /gap_type="unknown"
FT   assembly_gap    17767521..17769395
FT                   /estimated_length=1875
FT                   /gap_type="unknown"
FT   assembly_gap    17797590..17797609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17873725..17879699
FT                   /estimated_length=5975
FT                   /gap_type="unknown"
FT   assembly_gap    17885135..17885154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17886362..17894572
FT                   /estimated_length=8211
FT                   /gap_type="unknown"
FT   assembly_gap    17895972..17895991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17923553..17923779
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    17926833..17927462
FT                   /estimated_length=630
FT                   /gap_type="unknown"
FT   assembly_gap    17939092..17939111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17940601..17940620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17944561..17944918
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    17947374..17949202
FT                   /estimated_length=1829
FT                   /gap_type="unknown"
FT   assembly_gap    17954926..17954945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17958245..17958921
FT                   /estimated_length=677
FT                   /gap_type="unknown"
FT   assembly_gap    17961834..17961853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17963116..17963243
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    17968111..17970499
FT                   /estimated_length=2389
FT                   /gap_type="unknown"
FT   assembly_gap    17971726..17972014
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    17973252..17974682
FT                   /estimated_length=1431
FT                   /gap_type="unknown"
FT   assembly_gap    17976654..17986000
FT                   /estimated_length=9347
FT                   /gap_type="unknown"
FT   assembly_gap    18010000..18010019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18022391..18022410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18023857..18023996
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    18044268..18044624
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   assembly_gap    18048121..18049011
FT                   /estimated_length=891
FT                   /gap_type="unknown"
FT   assembly_gap    18049719..18050161
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    18058358..18058377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18058895..18063345
FT                   /estimated_length=4451
FT                   /gap_type="unknown"
FT   assembly_gap    18073138..18073157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18084491..18084510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18122085..18123129
FT                   /estimated_length=1045
FT                   /gap_type="unknown"
FT   assembly_gap    18125166..18127255
FT                   /estimated_length=2090
FT                   /gap_type="unknown"
FT   assembly_gap    18129712..18130027
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    18138870..18138889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18141514..18141533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18144315..18144334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18145432..18145451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18162746..18162765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18168170..18168716
FT                   /estimated_length=547
FT                   /gap_type="unknown"
FT   assembly_gap    18171670..18171689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18178606..18178649
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    18191636..18191655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18193999..18194018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18196389..18196408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18197426..18197445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18202537..18202556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18366431..18366450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18370611..18370630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18382428..18383421
FT                   /estimated_length=994
FT                   /gap_type="unknown"
FT   assembly_gap    18387435..18387561
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    18390900..18390919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18401015..18401034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18402838..18403012
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    18411089..18411251
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    18415215..18415234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18416327..18416346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18417527..18417546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18420645..18427632
FT                   /estimated_length=6988
FT                   /gap_type="unknown"
FT   assembly_gap    18446888..18446907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18457959..18457978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18459773..18459792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18469810..18469829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18472904..18472923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18474844..18474863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18482243..18482262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18505884..18506008
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    18521890..18522266
FT                   /estimated_length=377
FT                   /gap_type="unknown"
FT   assembly_gap    18540798..18540817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18543452..18543471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18549021..18549666
FT                   /estimated_length=646
FT                   /gap_type="unknown"
FT   assembly_gap    18551516..18551535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18562218..18562237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18563913..18563932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18566916..18567421
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    18573509..18573528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18580086..18580109
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    18589174..18589196
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    18593010..18593295
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    18594003..18595219
FT                   /estimated_length=1217
FT                   /gap_type="unknown"
FT   assembly_gap    18596401..18598285
FT                   /estimated_length=1885
FT                   /gap_type="unknown"
FT   assembly_gap    18601478..18608626
FT                   /estimated_length=7149
FT                   /gap_type="unknown"
XX
CO   join(AAHY01107336.1:1..3554,gap(589),AAHY01107337.1:1..4028,gap(395),
CO   AAHY01107338.1:1..871,gap(3334),AAHY01107339.1:1..5622,gap(1962),
CO   AAHY01107340.1:1..8047,gap(1022),AAHY01107341.1:1..1569,gap(331),
CO   AAHY01107342.1:1..4245,gap(20),complement(AAHY01107343.1:1..1069),gap(20),
CO   complement(AAHY01107344.1:1..3562),gap(326),AAHY01107345.1:1..19676,
CO   gap(1349),AAHY01107346.1:1..3117,gap(704),AAHY01107347.1:1..41437,gap(20),
CO   complement(AAHY01107348.1:1..7422),gap(901),
CO   complement(AAHY01107349.1:1..6665),gap(288),
CO   complement(AAHY01107350.1:1..6136),gap(20),AAHY01107351.1:1..3638,gap(72),
CO   AAHY01107352.1:1..14686,gap(20),AAHY01107353.1:1..52955,gap(3518),
CO   AAHY01107354.1:1..1154,gap(120),AAHY01107355.1:1..5987,gap(20),
CO   AAHY01107356.1:1..1057,gap(20),AAHY01107357.1:1..28165,gap(60),
CO   AAHY01107358.1:1..20790,gap(20),complement(AAHY01107359.1:1..1248),gap(20),
CO   AAHY01107360.1:1..4200,gap(20),complement(AAHY01107361.1:1..4312),gap(20),
CO   AAHY01107362.1:1..1349,gap(579),AAHY01107363.1:1..13152,gap(937),
CO   AAHY01107364.1:1..721,gap(1043),complement(AAHY01107365.1:1..7817),gap(20),
CO   complement(AAHY01107366.1:1..12795),gap(20),
CO   complement(AAHY01107367.1:1..25994),gap(20),
CO   complement(AAHY01107368.1:1..1426),gap(20),AAHY01107369.1:1..1885,gap(20),
CO   complement(AAHY01107370.1:1..1532),gap(20),AAHY01107371.1:1..7335,gap(20),
CO   AAHY01107372.1:1..16473,gap(28),AAHY01107373.1:1..26494,gap(20),
CO   AAHY01107374.1:1..6244,gap(20),AAHY01107375.1:1..1338,gap(20),
CO   AAHY01107376.1:1..29857,gap(2686),AAHY01107377.1:1..78426,gap(161),
CO   AAHY01107378.1:1..13273,gap(20),AAHY01107379.1:1..20098,gap(104),
CO   complement(AAHY01107380.1:1..5071),gap(1049),AAHY01107381.1:1..25899,
CO   gap(20),AAHY01107382.1:1..718,gap(397),AAHY01107383.1:1..4097,gap(500),
CO   AAHY01107384.1:1..8059,gap(1498),complement(AAHY01107385.1:1..4489),
CO   gap(20),AAHY01107386.1:1..2819,gap(114),AAHY01107387.1:1..31571,gap(370),
CO   AAHY01107388.1:1..810,gap(20),AAHY01107389.1:1..2055,gap(20),
CO   AAHY01107390.1:1..7130,gap(167),AAHY01107391.1:1..10313,gap(1919),
CO   complement(AAHY01107392.1:1..1103),gap(20),AAHY01107393.1:1..1251,gap(332),
CO   AAHY01107394.1:1..1671,gap(56),complement(AAHY01107395.1:1..13334),gap(20),
CO   complement(AAHY01107396.1:1..1866),gap(20),
CO   complement(AAHY01107397.1:1..53229),gap(4212),
CO   complement(AAHY01107398.1:1..3032),gap(4787),AAHY01107399.1:1..11037,
CO   gap(135),AAHY01107400.1:1..6395,gap(59),AAHY01107401.1:1..4606,gap(20),
CO   AAHY01107402.1:1..8682,gap(20),AAHY01107403.1:1..19621,gap(492),
CO   AAHY01107404.1:1..17361,gap(208),AAHY01107405.1:1..8313,gap(78),
CO   AAHY01107406.1:1..23732,gap(20),AAHY01107407.1:1..20061,gap(1109),
CO   complement(AAHY01107408.1:1..611),gap(336),AAHY01107409.1:1..3977,
CO   gap(5148),AAHY01107410.1:1..24014,gap(63),AAHY01107411.1:1..12543,gap(20),
CO   AAHY01107412.1:1..1896,gap(20),AAHY01107413.1:1..8683,gap(275),
CO   AAHY01107414.1:1..9710,gap(559),AAHY01107415.1:1..12282,gap(20),
CO   complement(AAHY01107416.1:1..1721),gap(20),
CO   complement(AAHY01107417.1:1..1045),gap(20),AAHY01107418.1:1..5060,gap(289),
CO   AAHY01107419.1:1..10635,gap(20),AAHY01107420.1:1..1379,gap(252),
CO   AAHY01107421.1:1..22680,gap(92),AAHY01107422.1:1..7188,gap(95),
CO   complement(AAHY01107423.1:1..17128),gap(179),AAHY01107424.1:1..19542,
CO   gap(775),AAHY01107425.1:1..2690,gap(1026),AAHY01107426.1:1..15818,gap(112),
CO   AAHY01107427.1:1..12248,gap(291),AAHY01107428.1:1..10284,gap(20),
CO   complement(AAHY01107429.1:1..6450),gap(405),AAHY01107430.1:1..7385,gap(20),
CO   complement(AAHY01107431.1:1..27761),gap(20),
CO   complement(AAHY01107432.1:1..13185),gap(107),
CO   complement(AAHY01107433.1:1..18138),gap(20),AAHY01107434.1:1..18758,
CO   gap(94),AAHY01107435.1:1..21807,gap(270),
CO   complement(AAHY01107436.1:1..23200),gap(20),AAHY01107437.1:1..6778,
CO   gap(129),AAHY01107438.1:1..16404,gap(103),AAHY01107439.1:1..20974,gap(20),
CO   complement(AAHY01107440.1:1..5115),gap(221),AAHY01107441.1:1..6206,gap(40),
CO   AAHY01107442.1:1..574,gap(1047),AAHY01107443.1:1..27915,gap(52),
CO   AAHY01107444.1:1..5272,gap(20),AAHY01107445.1:1..3622,gap(20),
CO   AAHY01107446.1:1..18467,gap(269),AAHY01107447.1:1..3348,gap(594),
CO   AAHY01107448.1:1..3079,gap(170),AAHY01107449.1:1..1197,gap(20),
CO   complement(AAHY01107450.1:1..1345),gap(20),AAHY01107451.1:1..1637,gap(20),
CO   AAHY01107452.1:1..5013,gap(20),AAHY01107453.1:1..10823,gap(15193),
CO   AAHY01107454.1:1..3594,gap(4255),AAHY01107455.1:1..1563,gap(122),
CO   AAHY01107456.1:1..24479,gap(312),AAHY01107457.1:1..10520,gap(20),
CO   AAHY01107458.1:1..1637,gap(20),AAHY01107459.1:1..1706,gap(20),
CO   AAHY01107460.1:1..20847,gap(283),AAHY01107461.1:1..50339,gap(20),
CO   AAHY01107462.1:1..7034,gap(3917),AAHY01107463.1:1..6789,gap(20),
CO   AAHY01107464.1:1..1064,gap(2683),complement(AAHY01107465.1:1..1721),
CO   gap(165),complement(AAHY01107466.1:1..1184),gap(20),AAHY01107467.1:1..1416,
CO   gap(20),AAHY01107468.1:1..1392,gap(20),complement(AAHY01107469.1:1..2019),
CO   gap(1854),complement(AAHY01107470.1:1..8977),gap(227),
CO   complement(AAHY01107471.1:1..19669),gap(20),AAHY01107472.1:1..2917,
CO   gap(309),AAHY01107473.1:1..11656,gap(44),AAHY01107474.1:1..18772,gap(183),
CO   AAHY01107475.1:1..29897,gap(20),AAHY01107476.1:1..5057,gap(20),
CO   complement(AAHY01107477.1:1..1032),gap(20),AAHY01107478.1:1..6018,
CO   gap(3266),AAHY01107479.1:1..1708,gap(20),AAHY01107480.1:1..5332,gap(20),
CO   AAHY01107481.1:1..47729,gap(258),AAHY01107482.1:1..5424,gap(20),
CO   AAHY01107483.1:1..52325,gap(20),AAHY01107484.1:1..56398,gap(279),
CO   AAHY01107485.1:1..4189,gap(160),AAHY01107486.1:1..23016,gap(20),
CO   AAHY01107487.1:1..14252,gap(325),complement(AAHY01107488.1:1..6983),
CO   gap(168),AAHY01107489.1:1..11966,gap(20),
CO   complement(AAHY01107490.1:1..5970),gap(20),AAHY01107491.1:1..17817,
CO   gap(1810),AAHY01107492.1:1..3141,gap(2706),AAHY01107493.1:1..33756,
CO   gap(133),complement(AAHY01107494.1:1..19188),gap(24),
CO   AAHY01107495.1:1..12877,gap(20),AAHY01107496.1:1..22303,gap(20),
CO   AAHY01107497.1:1..3687,gap(20),AAHY01107498.1:1..18864,gap(574),
CO   AAHY01107499.1:1..14956,gap(547),AAHY01107500.1:1..3332,gap(20),
CO   AAHY01107501.1:1..20957,gap(20),AAHY01107502.1:1..29658,gap(20),
CO   complement(AAHY01107503.1:1..4169),gap(63),
CO   complement(AAHY01107504.1:1..18111),gap(67),AAHY01107505.1:1..21154,
CO   gap(45),AAHY01107506.1:1..5988,gap(198),AAHY01107507.1:1..32593,gap(20),
CO   AAHY01107508.1:1..1931,gap(38),AAHY01107509.1:1..3598,gap(150),
CO   AAHY01107510.1:1..5491,gap(20),AAHY01107511.1:1..2828,gap(20),
CO   AAHY01107512.1:1..1340,gap(20),complement(AAHY01107513.1:1..2496),gap(20),
CO   AAHY01107514.1:1..8956,gap(20),AAHY01107515.1:1..6937,gap(20),
CO   AAHY01107516.1:1..9001,gap(20),AAHY01107517.1:1..4021,gap(20),
CO   complement(AAHY01107518.1:1..10827),gap(102),AAHY01107519.1:1..33952,
CO   gap(586),AAHY01107520.1:1..48505,gap(129),AAHY01107521.1:1..1478,gap(307),
CO   AAHY01107522.1:1..34483,gap(40),complement(AAHY01107523.1:1..9764),gap(27),
CO   AAHY01107524.1:1..1671,gap(142),complement(AAHY01107525.1:1..9603),
CO   gap(488),AAHY01107526.1:1..9050,gap(20),AAHY01107527.1:1..29450,gap(20),
CO   complement(AAHY01107528.1:1..3078),gap(20),AAHY01107529.1:1..7887,gap(237),
CO   complement(AAHY01107530.1:1..3261),gap(20),AAHY01107531.1:1..4846,gap(20),
CO   AAHY01107532.1:1..15660,gap(371),AAHY01107533.1:1..1581,gap(20),
CO   AAHY01107534.1:1..23175,gap(126),AAHY01107535.1:1..9808,gap(20),
CO   complement(AAHY01107536.1:1..2131),gap(1465),AAHY01107537.1:1..8520,
CO   gap(216),AAHY01107538.1:1..18452,gap(20),
CO   complement(AAHY01107539.1:1..6114),gap(174),
CO   complement(AAHY01107540.1:1..9623),gap(20),
CO   complement(AAHY01107541.1:1..5686),gap(625),AAHY01107542.1:1..7114,
CO   gap(1939),complement(AAHY01107543.1:1..42279),gap(20),
CO   complement(AAHY01107544.1:1..5300),gap(20),AAHY01107545.1:1..19964,gap(20),
CO   AAHY01107546.1:1..6271,gap(568),AAHY01107547.1:1..22587,gap(20),
CO   AAHY01107548.1:1..6072,gap(79),AAHY01107549.1:1..27172,gap(32),
CO   complement(AAHY01107550.1:1..39966),gap(20),
CO   complement(AAHY01107551.1:1..6860),gap(20),
CO   complement(AAHY01107552.1:1..15755),gap(20),
CO   complement(AAHY01107553.1:1..21237),gap(20),
CO   complement(AAHY01107554.1:1..15795),gap(20),AAHY01107555.1:1..45714,
CO   gap(20),AAHY01107556.1:1..7134,gap(2627),AAHY01107557.1:1..1444,gap(2355),
CO   complement(AAHY01107558.1:1..22680),gap(20),AAHY01107559.1:1..8787,gap(20),
CO   AAHY01107560.1:1..24941,gap(1019),AAHY01107561.1:1..8319,gap(93),
CO   AAHY01107562.1:1..4133,gap(250),AAHY01107563.1:1..10971,gap(72),
CO   AAHY01107564.1:1..1016,gap(36),AAHY01107565.1:1..16485,gap(1269),
CO   AAHY01107566.1:1..5347,gap(37),AAHY01107567.1:1..26813,gap(20),
CO   AAHY01107568.1:1..57523,gap(20),AAHY01107569.1:1..46215,gap(20),
CO   AAHY01107570.1:1..28849,gap(291),AAHY01107571.1:1..24863,gap(278),
CO   AAHY01107572.1:1..79392,gap(20),AAHY01107573.1:1..3266,gap(185),
CO   AAHY01107574.1:1..22417,gap(31),AAHY01107575.1:1..9669,gap(91),
CO   AAHY01107576.1:1..73230,gap(20),AAHY01107577.1:1..19413,gap(32),
CO   AAHY01107578.1:1..2541,gap(33),AAHY01107579.1:1..27779,gap(643),
CO   AAHY01107580.1:1..18869,gap(2121),AAHY01107581.1:1..2957,gap(295),
CO   AAHY01107582.1:1..58617,gap(20),AAHY01107583.1:1..13860,gap(20),
CO   complement(AAHY01107584.1:1..5163),gap(20),AAHY01107585.1:1..44496,
CO   gap(1214),AAHY01107586.1:1..25405,gap(178),AAHY01107587.1:1..4439,
CO   gap(2021),AAHY01107588.1:1..5672,gap(270),AAHY01107589.1:1..32080,gap(20),
CO   AAHY01107590.1:1..7859,gap(20),complement(AAHY01107591.1:1..8350),gap(111),
CO   complement(AAHY01107592.1:1..23490),gap(40),
CO   complement(AAHY01107593.1:1..512),gap(25),
CO   complement(AAHY01107594.1:1..9017),gap(20),
CO   complement(AAHY01107595.1:1..3597),gap(20),
CO   complement(AAHY01107596.1:1..56611),gap(224),AAHY01107597.1:1..9676,
CO   gap(20),AAHY01107598.1:1..5786,gap(20),AAHY01107599.1:1..22108,gap(194),
CO   complement(AAHY01107600.1:1..29350),gap(20),
CO   complement(AAHY01107601.1:1..42188),gap(35),
CO   complement(AAHY01107602.1:1..25791),gap(821),
CO   complement(AAHY01107603.1:1..24485),gap(267),AAHY01107604.1:1..5081,
CO   gap(60),AAHY01107605.1:1..31118,gap(3431),AAHY01107606.1:1..7285,gap(236),
CO   complement(AAHY01107607.1:1..38083),gap(281),AAHY01107608.1:1..11661,
CO   gap(228),complement(AAHY01107609.1:1..4874),gap(208),
CO   complement(AAHY01107610.1:1..1532),gap(412),AAHY01107611.1:1..73271,
CO   gap(1614),AAHY01107612.1:1..58850,gap(20),AAHY01107613.1:1..23092,
CO   gap(1130),AAHY01107614.1:1..7943,gap(9156),
CO   complement(AAHY01107615.1:1..32850),gap(20),AAHY01107616.1:1..17335,
CO   gap(1182),AAHY01107617.1:1..1256,gap(1942),AAHY01107618.1:1..32083,gap(20),
CO   complement(AAHY01107619.1:1..3877),gap(20),
CO   complement(AAHY01107620.1:1..32359),gap(1068),AAHY01107621.1:1..6777,
CO   gap(700),complement(AAHY01107622.1:1..9870),gap(280),
CO   complement(AAHY01107623.1:1..33222),gap(355),
CO   complement(AAHY01107624.1:1..6155),gap(134),
CO   complement(AAHY01107625.1:1..5255),gap(53),
CO   complement(AAHY01107626.1:1..5859),gap(141),
CO   complement(AAHY01107627.1:1..23127),gap(102),
CO   complement(AAHY01107628.1:1..11209),gap(20),
CO   complement(AAHY01107629.1:1..7098),gap(87),
CO   complement(AAHY01107630.1:1..52630),gap(60),
CO   complement(AAHY01107631.1:1..999),gap(76),
CO   complement(AAHY01107632.1:1..9631),gap(20),
CO   complement(AAHY01107633.1:1..42921),gap(20),
CO   complement(AAHY01107634.1:1..2128),gap(89),
CO   complement(AAHY01107635.1:1..12519),gap(231),
CO   complement(AAHY01107636.1:1..761),gap(20),AAHY01107637.1:1..20921,gap(20),
CO   complement(AAHY01107638.1:1..77890),gap(34),AAHY01107639.1:1..3365,
CO   gap(408),AAHY01107640.1:1..36087,gap(4289),AAHY01107641.1:1..11216,gap(96),
CO   AAHY01107642.1:1..13213,gap(39),AAHY01107643.1:1..112728,gap(222),
CO   complement(AAHY01107644.1:1..12285),gap(252),
CO   complement(AAHY01107645.1:1..18538),gap(60),
CO   complement(AAHY01107646.1:1..34579),gap(20),
CO   complement(AAHY01107647.1:1..34507),gap(83),
CO   complement(AAHY01107648.1:1..31199),gap(20),
CO   complement(AAHY01107649.1:1..47643),gap(20),
CO   complement(AAHY01107650.1:1..2640),gap(20),AAHY01107651.1:1..14889,gap(59),
CO   complement(AAHY01107652.1:1..57865),gap(1175),
CO   complement(AAHY01107653.1:1..69122),gap(431),
CO   complement(AAHY01107654.1:1..69270),gap(209),AAHY01107655.1:1..4754,
CO   gap(20),AAHY01107656.1:1..29722,gap(164),AAHY01107657.1:1..3538,gap(394),
CO   complement(AAHY01107658.1:1..3175),gap(90),AAHY01107659.1:1..4804,gap(20),
CO   AAHY01107660.1:1..7335,gap(146),complement(AAHY01107661.1:1..18814),
CO   gap(210),complement(AAHY01107662.1:1..13081),gap(102),
CO   complement(AAHY01107663.1:1..1843),gap(223),
CO   complement(AAHY01107664.1:1..91364),gap(266),
CO   complement(AAHY01107665.1:1..1954),gap(114),
CO   complement(AAHY01107666.1:1..6133),gap(54),
CO   complement(AAHY01107667.1:1..18008),gap(122),AAHY01107668.1:1..29891,
CO   gap(20),AAHY01107669.1:1..71590,gap(321),
CO   complement(AAHY01107670.1:1..16080),gap(133),
CO   complement(AAHY01107671.1:1..74420),gap(20),AAHY01107672.1:1..4517,
CO   gap(221),complement(AAHY01107673.1:1..31034),gap(20),
CO   complement(AAHY01107674.1:1..85116),gap(20),
CO   complement(AAHY01107675.1:1..46962),gap(20),AAHY01107676.1:1..107454,
CO   gap(20),AAHY01107677.1:1..25028,gap(20),AAHY01107678.1:1..1167,gap(20),
CO   complement(AAHY01107679.1:1..61033),gap(1018),AAHY01107680.1:1..4216,
CO   gap(20),AAHY01107681.1:1..22319,gap(47),AAHY01107682.1:1..81240,gap(1026),
CO   AAHY01107683.1:1..8565,gap(2476),complement(AAHY01107684.1:1..1410),
CO   gap(13818),AAHY01107685.1:1..1634,gap(20),AAHY01107686.1:1..6790,gap(20),
CO   AAHY01107687.1:1..1204,gap(20),AAHY01107688.1:1..16202,gap(20),
CO   AAHY01107689.1:1..8239,gap(20),AAHY01107690.1:1..22429,gap(63),
CO   AAHY01107691.1:1..11004,gap(250),AAHY01107692.1:1..9394,gap(2795),
CO   complement(AAHY01107693.1:1..4411),gap(152),AAHY01107694.1:1..20829,
CO   gap(21),AAHY01107695.1:1..23874,gap(4118),AAHY01107696.1:1..15562,gap(102),
CO   complement(AAHY01107697.1:1..11559),gap(20),
CO   complement(AAHY01107698.1:1..27826),gap(309),
CO   complement(AAHY01107699.1:1..18281),gap(20),
CO   complement(AAHY01107700.1:1..3984),gap(20),AAHY01107701.1:1..4643,gap(20),
CO   AAHY01107702.1:1..3208,gap(20),complement(AAHY01107703.1:1..1119),gap(20),
CO   complement(AAHY01107704.1:1..1577),gap(4639),AAHY01107705.1:1..17250,
CO   gap(20),AAHY01107706.1:1..1409,gap(20),complement(AAHY01107707.1:1..1268),
CO   gap(827),complement(AAHY01107708.1:1..1328),gap(58),AAHY01107709.1:1..5523,
CO   gap(112),complement(AAHY01107710.1:1..3328),gap(393),
CO   AAHY01107711.1:1..13747,gap(4877),complement(AAHY01107712.1:1..3090),
CO   gap(20),complement(AAHY01107713.1:1..2015),gap(398),AAHY01107714.1:1..4176,
CO   gap(3001),AAHY01107715.1:1..2060,gap(20),AAHY01107716.1:1..10461,gap(5272),
CO   AAHY01107717.1:1..7830,gap(20),AAHY01107718.1:1..34432,gap(684),
CO   AAHY01107719.1:1..3584,gap(20),AAHY01107720.1:1..1675,gap(60),
CO   AAHY01107721.1:1..28505,gap(311),AAHY01107722.1:1..52826,gap(576),
CO   AAHY01107723.1:1..1226,gap(773),complement(AAHY01107724.1:1..23219),
CO   gap(125),AAHY01107725.1:1..2710,gap(20),AAHY01107726.1:1..55545,gap(20),
CO   AAHY01107727.1:1..36505,gap(23),AAHY01107728.1:1..23749,gap(116),
CO   AAHY01107729.1:1..4106,gap(20),AAHY01107730.1:1..3116,gap(370),
CO   AAHY01107731.1:1..20682,gap(4597),AAHY01107732.1:1..9400,gap(20),
CO   AAHY01107733.1:1..18752,gap(4862),AAHY01107734.1:1..22605,gap(51),
CO   AAHY01107735.1:1..9200,gap(78),AAHY01107736.1:1..22365,gap(29),
CO   AAHY01107737.1:1..73953,gap(74),AAHY01107738.1:1..95143,gap(20),
CO   AAHY01107739.1:1..20419,gap(282),AAHY01107740.1:1..4144,gap(48),
CO   AAHY01107741.1:1..37794,gap(20),complement(AAHY01107742.1:1..12314),
CO   gap(20),AAHY01107743.1:1..3600,gap(417),AAHY01107744.1:1..32543,gap(197),
CO   AAHY01107745.1:1..2546,gap(20),AAHY01107746.1:1..18772,gap(88),
CO   AAHY01107747.1:1..33863,gap(88),AAHY01107748.1:1..80063,gap(20),
CO   AAHY01107749.1:1..18159,gap(233),complement(AAHY01107750.1:1..12584),
CO   gap(29),complement(AAHY01107751.1:1..45498),gap(75),
CO   complement(AAHY01107752.1:1..54374),gap(20),
CO   complement(AAHY01107753.1:1..1785),gap(38),AAHY01107754.1:1..5176,gap(20),
CO   AAHY01107755.1:1..5649,gap(20),AAHY01107756.1:1..34851,gap(821),
CO   AAHY01107757.1:1..1192,gap(20),AAHY01107758.1:1..8394,gap(284),
CO   AAHY01107759.1:1..9156,gap(20),AAHY01107760.1:1..53804,gap(20),
CO   AAHY01107761.1:1..9633,gap(149),AAHY01107762.1:1..4152,gap(97),
CO   AAHY01107763.1:1..1921,gap(20),AAHY01107764.1:1..4792,gap(20),
CO   AAHY01107765.1:1..8648,gap(20),AAHY01107766.1:1..1645,gap(20),
CO   AAHY01107767.1:1..33511,gap(20),AAHY01107768.1:1..1360,gap(20),
CO   AAHY01107769.1:1..11617,gap(209),AAHY01107770.1:1..10997,gap(6461),
CO   complement(AAHY01107771.1:1..1581),gap(1645),AAHY01107772.1:1..4644,
CO   gap(2830),AAHY01107773.1:1..7643,gap(20),
CO   complement(AAHY01107774.1:1..10857),gap(20),
CO   complement(AAHY01107775.1:1..5350),gap(431),
CO   complement(AAHY01107776.1:1..733),gap(20),AAHY01107777.1:1..39989,
CO   gap(2164),AAHY01107778.1:1..755,gap(651),
CO   complement(AAHY01107779.1:1..15885),gap(20),AAHY01107780.1:1..25524,
CO   gap(20),AAHY01107781.1:1..14393,gap(91),AAHY01107782.1:1..15273,gap(20),
CO   AAHY01107783.1:1..1076,gap(20),complement(AAHY01107784.1:1..19370),
CO   gap(160),AAHY01107785.1:1..11343,gap(994),AAHY01107786.1:1..1110,gap(20),
CO   AAHY01107787.1:1..1246,gap(1299),complement(AAHY01107788.1:1..2518),
CO   gap(1795),complement(AAHY01107789.1:1..1639),gap(20),
CO   complement(AAHY01107790.1:1..1519),gap(20),AAHY01107791.1:1..1218,gap(20),
CO   AAHY01107792.1:1..1091,gap(20),AAHY01107793.1:1..1490,gap(103),
CO   AAHY01107794.1:1..2411,gap(20),complement(AAHY01107795.1:1..4068),gap(20),
CO   AAHY01107796.1:1..1106,gap(20),AAHY01107797.1:1..2803,gap(20),
CO   AAHY01107798.1:1..4864,gap(20),complement(AAHY01107799.1:1..1542),gap(20),
CO   AAHY01107800.1:1..1556,gap(20),complement(AAHY01107801.1:1..1338),gap(20),
CO   AAHY01107802.1:1..6394,gap(20),AAHY01107803.1:1..2912,gap(20),
CO   AAHY01107804.1:1..8468,gap(20),AAHY01107805.1:1..27024,gap(20),
CO   complement(AAHY01107806.1:1..18286),gap(20),AAHY01107807.1:1..35774,
CO   gap(20),AAHY01107808.1:1..29611,gap(20),
CO   complement(AAHY01107809.1:1..13618),gap(3213),AAHY01107810.1:1..681,
CO   gap(349),AAHY01107811.1:1..6723,gap(97),complement(AAHY01107812.1:1..4317),
CO   gap(66),AAHY01107813.1:1..24878,gap(20),AAHY01107814.1:1..8832,gap(628),
CO   complement(AAHY01107815.1:1..1927),gap(20),
CO   complement(AAHY01107816.1:1..1710),gap(20),AAHY01107817.1:1..1237,gap(20),
CO   AAHY01107818.1:1..37084,gap(20),complement(AAHY01107819.1:1..4674),gap(20),
CO   complement(AAHY01107820.1:1..2009),gap(20),
CO   complement(AAHY01107821.1:1..3568),gap(5327),AAHY01107822.1:1..6554,
CO   gap(1163),complement(AAHY01107823.1:1..4128),gap(20),
CO   AAHY01107824.1:1..1589,gap(20),complement(AAHY01107825.1:1..1024),gap(20),
CO   AAHY01107826.1:1..24321,gap(22),AAHY01107827.1:1..41315,gap(347),
CO   AAHY01107828.1:1..1542,gap(20),complement(AAHY01107829.1:1..11872),
CO   gap(139),AAHY01107830.1:1..33411,gap(20),
CO   complement(AAHY01107831.1:1..1121),gap(20),
CO   complement(AAHY01107832.1:1..1300),gap(20),AAHY01107833.1:1..48409,gap(34),
CO   AAHY01107834.1:1..36203,gap(406),complement(AAHY01107835.1:1..1194),
CO   gap(872),AAHY01107836.1:1..12835,gap(132),AAHY01107837.1:1..34961,gap(20),
CO   AAHY01107838.1:1..26206,gap(20),AAHY01107839.1:1..17215,gap(1008),
CO   complement(AAHY01107840.1:1..16562),gap(332),AAHY01107841.1:1..8654,
CO   gap(20),AAHY01107842.1:1..18888,gap(73),AAHY01107843.1:1..4176,gap(20),
CO   AAHY01107844.1:1..1443,gap(20),complement(AAHY01107845.1:1..3874),gap(20),
CO   AAHY01107846.1:1..27098,gap(82),AAHY01107847.1:1..33135,gap(20),
CO   AAHY01107848.1:1..9260,gap(8497),AAHY01107849.1:1..4956,gap(20),
CO   AAHY01107850.1:1..1324,gap(133),AAHY01107851.1:1..14830,gap(20),
CO   AAHY01107852.1:1..1160,gap(20),AAHY01107853.1:1..25694,gap(5203),
CO   AAHY01107854.1:1..1200,gap(333),complement(AAHY01107855.1:1..11840),
CO   gap(20),AAHY01107856.1:1..1122,gap(20),AAHY01107857.1:1..11938,gap(20),
CO   AAHY01107858.1:1..37044,gap(20),AAHY01107859.1:1..2208,gap(20),
CO   AAHY01107860.1:1..7721,gap(20),AAHY01107861.1:1..3216,gap(20),
CO   AAHY01107862.1:1..11867,gap(20),complement(AAHY01107863.1:1..9498),gap(20),
CO   AAHY01107864.1:1..47127,gap(20),AAHY01107865.1:1..4138,gap(1360),
CO   AAHY01107866.1:1..1727,gap(1399),complement(AAHY01107867.1:1..3854),
CO   gap(20),complement(AAHY01107868.1:1..1272),gap(9440),
CO   complement(AAHY01107869.1:1..2149),gap(20),
CO   complement(AAHY01107870.1:1..2664),gap(20),
CO   complement(AAHY01107871.1:1..1464),gap(20),
CO   complement(AAHY01107872.1:1..1749),gap(20),
CO   complement(AAHY01107873.1:1..18234),gap(20),AAHY01107874.1:1..5076,gap(20),
CO   AAHY01107875.1:1..5869,gap(1638),complement(AAHY01107876.1:1..1364),
CO   gap(20),AAHY01107877.1:1..1053,gap(20),AAHY01107878.1:1..1135,gap(358),
CO   AAHY01107879.1:1..1022,gap(20),AAHY01107880.1:1..16130,gap(27),
CO   complement(AAHY01107881.1:1..19255),gap(20),AAHY01107882.1:1..1319,gap(20),
CO   AAHY01107883.1:1..2076,gap(20),AAHY01107884.1:1..24985,gap(679),
CO   AAHY01107885.1:1..8630,gap(20),complement(AAHY01107886.1:1..1130),gap(20),
CO   AAHY01107887.1:1..2308,gap(20),AAHY01107888.1:1..2268,gap(230),
CO   AAHY01107889.1:1..2342,gap(20),complement(AAHY01107890.1:1..2503),gap(445),
CO   complement(AAHY01107891.1:1..1387),gap(296),
CO   complement(AAHY01107892.1:1..1501),gap(20),
CO   complement(AAHY01107893.1:1..3454),gap(20),AAHY01107894.1:1..4777,gap(20),
CO   complement(AAHY01107895.1:1..2032),gap(234),
CO   complement(AAHY01107896.1:1..8559),gap(180),AAHY01107897.1:1..47703,
CO   gap(20),AAHY01107898.1:1..3956,gap(20),complement(AAHY01107899.1:1..37003),
CO   gap(20),complement(AAHY01107900.1:1..1253),gap(20),AAHY01107901.1:1..21618,
CO   gap(2660),AAHY01107902.1:1..1171,gap(1725),AAHY01107903.1:1..1091,gap(314),
CO   AAHY01107904.1:1..20916,gap(20),AAHY01107905.1:1..1830,gap(246),
CO   complement(AAHY01107906.1:1..2336),gap(20),AAHY01107907.1:1..2300,
CO   gap(1323),complement(AAHY01107908.1:1..1032),gap(20),
CO   complement(AAHY01107909.1:1..1047),gap(20),AAHY01107910.1:1..1836,gap(620),
CO   complement(AAHY01107911.1:1..2839),gap(20),AAHY01107912.1:1..14534,
CO   gap(230),AAHY01107913.1:1..16788,gap(20),AAHY01107914.1:1..12308,gap(29),
CO   AAHY01107915.1:1..11042,gap(20),AAHY01107916.1:1..14059,gap(34),
CO   AAHY01107917.1:1..23418,gap(4270),AAHY01107918.1:1..12372,gap(20),
CO   AAHY01107919.1:1..5666,gap(6765),AAHY01107920.1:1..58131,gap(1205),
CO   complement(AAHY01107921.1:1..1330),gap(20),AAHY01107922.1:1..6717,
CO   gap(1110),AAHY01107923.1:1..12401,gap(20),AAHY01107924.1:1..20481,
CO   gap(3260),AAHY01107925.1:1..27777,gap(83),AAHY01107926.1:1..22899,
CO   gap(7660),AAHY01107927.1:1..1740,gap(20),AAHY01107928.1:1..9954,gap(20),
CO   complement(AAHY01107929.1:1..1348),gap(20),
CO   complement(AAHY01107930.1:1..2797),gap(20),
CO   complement(AAHY01107931.1:1..63484),gap(37),AAHY01107932.1:1..13140,
CO   gap(20),complement(AAHY01107933.1:1..33352),gap(79),
CO   AAHY01107934.1:1..17550,gap(20),AAHY01107935.1:1..9950,gap(20),
CO   AAHY01107936.1:1..9228,gap(20),AAHY01107937.1:1..6068,gap(51),
CO   complement(AAHY01107938.1:1..9219),gap(20),AAHY01107939.1:1..26759,
CO   gap(197),complement(AAHY01107940.1:1..7503),gap(20),AAHY01107941.1:1..1047,
CO   gap(20),AAHY01107942.1:1..10439,gap(219),AAHY01107943.1:1..29790,gap(20),
CO   AAHY01107944.1:1..11957,gap(3296),AAHY01107945.1:1..76055,gap(1942),
CO   AAHY01107946.1:1..1245,gap(486),AAHY01107947.1:1..10599,gap(20),
CO   AAHY01107948.1:1..21538,gap(20),complement(AAHY01107949.1:1..13742),
CO   gap(20),AAHY01107950.1:1..4312,gap(20),complement(AAHY01107951.1:1..11228),
CO   gap(20),AAHY01107952.1:1..1270,gap(399),AAHY01107953.1:1..1162,gap(824),
CO   AAHY01107954.1:1..22652,gap(20),AAHY01107955.1:1..37026,gap(2154),
CO   AAHY01107956.1:1..6505,gap(20),complement(AAHY01107957.1:1..2522),gap(20),
CO   complement(AAHY01107958.1:1..10307),gap(43),
CO   complement(AAHY01107959.1:1..43475),gap(20),AAHY01107960.1:1..21218,
CO   gap(294),AAHY01107961.1:1..3649,gap(2455),AAHY01107962.1:1..4858,gap(20),
CO   complement(AAHY01107963.1:1..13158),gap(1159),AAHY01107964.1:1..3883,
CO   gap(23),AAHY01107965.1:1..46128,gap(20),complement(AAHY01107966.1:1..3654),
CO   gap(140),complement(AAHY01107967.1:1..9973),gap(20),
CO   complement(AAHY01107968.1:1..9904),gap(71),AAHY01107969.1:1..37475,gap(92),
CO   AAHY01107970.1:1..1149,gap(1305),complement(AAHY01107971.1:1..692),gap(20),
CO   AAHY01107972.1:1..25979,gap(20),AAHY01107973.1:1..51211,gap(5012),
CO   AAHY01107974.1:1..14463,gap(20),AAHY01107975.1:1..14173,gap(177),
CO   AAHY01107976.1:1..3393,gap(2989),complement(AAHY01107977.1:1..1140),
CO   gap(572),AAHY01107978.1:1..7771,gap(76),AAHY01107979.1:1..59948,gap(20),
CO   complement(AAHY01107980.1:1..22700),gap(72),AAHY01107981.1:1..2458,gap(92),
CO   AAHY01107982.1:1..17713,gap(20),AAHY01107983.1:1..12309,gap(20),
CO   complement(AAHY01107984.1:1..1217),gap(243),AAHY01107985.1:1..88161,
CO   gap(75),AAHY01107986.1:1..2176,gap(4185),AAHY01107987.1:1..6554,gap(2244),
CO   AAHY01107988.1:1..4364,gap(20),AAHY01107989.1:1..77068,gap(20),
CO   AAHY01107990.1:1..22217,gap(20),AAHY01107991.1:1..2097,gap(20),
CO   complement(AAHY01107992.1:1..13679),gap(20),
CO   complement(AAHY01107993.1:1..1262),gap(20),
CO   complement(AAHY01107994.1:1..1955),gap(1021),AAHY01107995.1:1..1187,
CO   gap(20),complement(AAHY01107996.1:1..1224),gap(20),AAHY01107997.1:1..2235,
CO   gap(20),complement(AAHY01107998.1:1..1246),gap(20),
CO   complement(AAHY01107999.1:1..3769),gap(1400),AAHY01108000.1:1..27040,
CO   gap(20),AAHY01108001.1:1..76115,gap(20),
CO   complement(AAHY01108002.1:1..29148),gap(266),AAHY01108003.1:1..11221,
CO   gap(758),AAHY01108004.1:1..11249,gap(20),AAHY01108005.1:1..46395,gap(723),
CO   complement(AAHY01108006.1:1..742),gap(539),AAHY01108007.1:1..18875,
CO   gap(102),complement(AAHY01108008.1:1..3118),gap(952),
CO   AAHY01108009.1:1..2849,gap(20),AAHY01108010.1:1..1092,gap(20),
CO   AAHY01108011.1:1..30010,gap(20),complement(AAHY01108012.1:1..1286),
CO   gap(143),complement(AAHY01108013.1:1..11530),gap(20),
CO   AAHY01108014.1:1..66981,gap(55),AAHY01108015.1:1..40222,gap(20),
CO   AAHY01108016.1:1..2517,gap(20),complement(AAHY01108017.1:1..5080),gap(20),
CO   complement(AAHY01108018.1:1..51538),gap(6429),AAHY01108019.1:1..38211,
CO   gap(140),AAHY01108020.1:1..49257,gap(20),AAHY01108021.1:1..11683,gap(80),
CO   AAHY01108022.1:1..11563,gap(86),AAHY01108023.1:1..70626,gap(20),
CO   AAHY01108024.1:1..37461,gap(20),AAHY01108025.1:1..29730,gap(80),
CO   AAHY01108026.1:1..27392,gap(20),complement(AAHY01108027.1:1..3880),
CO   gap(806),AAHY01108028.1:1..19689,gap(36),AAHY01108029.1:1..14820,gap(20),
CO   AAHY01108030.1:1..3889,gap(489),AAHY01108031.1:1..3356,gap(20),
CO   AAHY01108032.1:1..16343,gap(20),AAHY01108033.1:1..10851,gap(20),
CO   AAHY01108034.1:1..16148,gap(905),AAHY01108035.1:1..2289,gap(20),
CO   AAHY01108036.1:1..52728,gap(20),complement(AAHY01108037.1:1..2402),
CO   gap(111),AAHY01108038.1:1..10444,gap(20),AAHY01108039.1:1..28161,gap(20),
CO   AAHY01108040.1:1..900,gap(837),complement(AAHY01108041.1:1..1494),gap(20),
CO   AAHY01108042.1:1..1105,gap(20),AAHY01108043.1:1..15716,gap(20),
CO   AAHY01108044.1:1..7299,gap(20),AAHY01108045.1:1..7692,gap(20),
CO   AAHY01108046.1:1..73200,gap(20),AAHY01108047.1:1..4947,gap(20),
CO   AAHY01108048.1:1..14119,gap(4177),AAHY01108049.1:1..15712,gap(148),
CO   AAHY01108050.1:1..3835,gap(20),AAHY01108051.1:1..57693,gap(20),
CO   AAHY01108052.1:1..34925,gap(337),AAHY01108053.1:1..23097,gap(102),
CO   AAHY01108054.1:1..34212,gap(286),AAHY01108055.1:1..3574,gap(20),
CO   AAHY01108056.1:1..48751,gap(20),AAHY01108057.1:1..54834,gap(41),
CO   AAHY01108058.1:1..16917,gap(321),complement(AAHY01108059.1:1..24249),
CO   gap(20),AAHY01108060.1:1..5840,gap(536),AAHY01108061.1:1..16543,gap(20),
CO   AAHY01108062.1:1..50503,gap(20),AAHY01108063.1:1..40334,gap(992),
CO   AAHY01108064.1:1..19005,gap(77),AAHY01108065.1:1..39708,gap(20),
CO   AAHY01108066.1:1..23430,gap(85),AAHY01108067.1:1..5605,gap(20),
CO   AAHY01108068.1:1..2189,gap(573),AAHY01108069.1:1..3677,gap(661),
CO   AAHY01108070.1:1..4206,gap(195),AAHY01108071.1:1..19648,gap(109),
CO   AAHY01108072.1:1..8108,gap(152),AAHY01108073.1:1..2680,gap(3309),
CO   AAHY01108074.1:1..22068,gap(276),AAHY01108075.1:1..1418,gap(71),
CO   AAHY01108076.1:1..41052,gap(42),complement(AAHY01108077.1:1..15296),
CO   gap(20),AAHY01108078.1:1..1135,gap(20),AAHY01108079.1:1..18985,gap(39),
CO   AAHY01108080.1:1..31673,gap(266),AAHY01108081.1:1..14266,gap(20),
CO   complement(AAHY01108082.1:1..28927),gap(190),AAHY01108083.1:1..50337,
CO   gap(20),complement(AAHY01108084.1:1..1332),gap(544),AAHY01108085.1:1..3602,
CO   gap(240),AAHY01108086.1:1..6640,gap(20),AAHY01108087.1:1..6872,gap(671),
CO   AAHY01108088.1:1..17726,gap(20),AAHY01108089.1:1..17050,gap(20),
CO   AAHY01108090.1:1..35589,gap(225),AAHY01108091.1:1..7458,gap(20),
CO   AAHY01108092.1:1..17492,gap(20),AAHY01108093.1:1..3622,gap(4325),
CO   AAHY01108094.1:1..65249,gap(167),AAHY01108095.1:1..32238,gap(333),
CO   AAHY01108096.1:1..15851,gap(20),AAHY01108097.1:1..15618,gap(20),
CO   AAHY01108098.1:1..11956,gap(20),AAHY01108099.1:1..49626,gap(20),
CO   AAHY01108100.1:1..19764,gap(20),AAHY01108101.1:1..1899,gap(20),
CO   AAHY01108102.1:1..31611,gap(20),AAHY01108103.1:1..2674,gap(20),
CO   AAHY01108104.1:1..39877,gap(52),AAHY01108105.1:1..15873,gap(20),
CO   AAHY01108106.1:1..43124,gap(20),AAHY01108107.1:1..24349,gap(224),
CO   AAHY01108108.1:1..3647,gap(20),AAHY01108109.1:1..28454,gap(20),
CO   AAHY01108110.1:1..19795,gap(339),complement(AAHY01108111.1:1..3532),
CO   gap(20),AAHY01108112.1:1..7704,gap(338),AAHY01108113.1:1..65074,gap(18697),
CO   AAHY01108114.1:1..21306,gap(74),AAHY01108115.1:1..19724,gap(20),
CO   complement(AAHY01108116.1:1..15711),gap(203),
CO   complement(AAHY01108117.1:1..51833),gap(55),AAHY01108118.1:1..3130,
CO   gap(1528),AAHY01108119.1:1..999,gap(1484),AAHY01108120.1:1..1261,gap(227),
CO   AAHY01108121.1:1..3636,gap(20),AAHY01108122.1:1..20874,gap(20),
CO   complement(AAHY01108123.1:1..11696),gap(61),
CO   complement(AAHY01108124.1:1..9981),gap(20),
CO   complement(AAHY01108125.1:1..11855),gap(831),AAHY01108126.1:1..66271,
CO   gap(20),complement(AAHY01108127.1:1..318),gap(20),AAHY01108128.1:1..2450,
CO   gap(20),AAHY01108129.1:1..34303,gap(867),AAHY01108130.1:1..2184,gap(20),
CO   complement(AAHY01108131.1:1..3744),gap(218),AAHY01108132.1:1..8152,gap(34),
CO   AAHY01108133.1:1..45487,gap(527),AAHY01108134.1:1..13237,gap(20),
CO   complement(AAHY01108135.1:1..36984),gap(20),AAHY01108136.1:1..15072,
CO   gap(20),AAHY01108137.1:1..7433,gap(20),AAHY01108138.1:1..1698,gap(20),
CO   AAHY01108139.1:1..4305,gap(203),complement(AAHY01108140.1:1..9451),gap(20),
CO   AAHY01108141.1:1..4131,gap(896),AAHY01108142.1:1..1298,gap(46),
CO   complement(AAHY01108143.1:1..14595),gap(228),
CO   complement(AAHY01108144.1:1..32603),gap(89),AAHY01108145.1:1..14375,
CO   gap(21),complement(AAHY01108146.1:1..3528),gap(407),
CO   AAHY01108147.1:1..33853,gap(20),AAHY01108148.1:1..3590,gap(20),
CO   AAHY01108149.1:1..23816,gap(20),complement(AAHY01108150.1:1..5088),
CO   gap(369),AAHY01108151.1:1..10555,gap(20),AAHY01108152.1:1..70196,gap(304),
CO   AAHY01108153.1:1..8328,gap(175),AAHY01108154.1:1..11342,gap(20),
CO   complement(AAHY01108155.1:1..29746),gap(20),AAHY01108156.1:1..66924,
CO   gap(128),AAHY01108157.1:1..1993,gap(86),
CO   complement(AAHY01108158.1:1..40697),gap(33),AAHY01108159.1:1..29610,
CO   gap(134),AAHY01108160.1:1..7315,gap(397),AAHY01108161.1:1..8892,gap(611),
CO   AAHY01108162.1:1..3523,gap(20),AAHY01108163.1:1..16656,gap(20),
CO   AAHY01108164.1:1..17875,gap(20),AAHY01108165.1:1..73240,gap(20),
CO   AAHY01108166.1:1..27393,gap(20),AAHY01108167.1:1..35670,gap(20),
CO   AAHY01108168.1:1..15222,gap(101),AAHY01108169.1:1..11197,gap(247),
CO   AAHY01108170.1:1..8343,gap(128),complement(AAHY01108171.1:1..2253),gap(20),
CO   AAHY01108172.1:1..7871,gap(46),complement(AAHY01108173.1:1..2702),gap(791),
CO   complement(AAHY01108174.1:1..13501),gap(20),
CO   complement(AAHY01108175.1:1..16280),gap(20),
CO   complement(AAHY01108176.1:1..24799),gap(20),AAHY01108177.1:1..24413,
CO   gap(20),complement(AAHY01108178.1:1..7090),gap(20),AAHY01108179.1:1..68378,
CO   gap(20),complement(AAHY01108180.1:1..3830),gap(264),
CO   AAHY01108181.1:1..15139,gap(181),AAHY01108182.1:1..13690,gap(77),
CO   AAHY01108183.1:1..11164,gap(20),AAHY01108184.1:1..28142,gap(378),
CO   AAHY01108185.1:1..35515,gap(67),AAHY01108186.1:1..4063,gap(789),
CO   AAHY01108187.1:1..9121,gap(99),complement(AAHY01108188.1:1..5454),gap(232),
CO   AAHY01108189.1:1..83545,gap(20),complement(AAHY01108190.1:1..9081),gap(20),
CO   AAHY01108191.1:1..41283,gap(20),AAHY01108192.1:1..18327,gap(451),
CO   AAHY01108193.1:1..2896,gap(860),AAHY01108194.1:1..27170,gap(20),
CO   AAHY01108195.1:1..13824,gap(275),AAHY01108196.1:1..1243,gap(20),
CO   AAHY01108197.1:1..10794,gap(181),AAHY01108198.1:1..1644,gap(210),
CO   AAHY01108199.1:1..3735,gap(113),AAHY01108200.1:1..42476,gap(839),
CO   AAHY01108201.1:1..4474,gap(20),complement(AAHY01108202.1:1..2604),gap(20),
CO   AAHY01108203.1:1..1130,gap(20),AAHY01108204.1:1..2999,gap(206),
CO   complement(AAHY01108205.1:1..39203),gap(61),
CO   complement(AAHY01108206.1:1..669),gap(232),AAHY01108207.1:1..29367,
CO   gap(5224),AAHY01108208.1:1..12172,gap(20),AAHY01108209.1:1..51445,gap(20),
CO   complement(AAHY01108210.1:1..7215),gap(615),
CO   complement(AAHY01108211.1:1..760),gap(1355),AAHY01108212.1:1..2773,
CO   gap(174),complement(AAHY01108213.1:1..2193),gap(20),
CO   AAHY01108214.1:1..13411,gap(20),complement(AAHY01108215.1:1..15328),
CO   gap(359),AAHY01108216.1:1..98609,gap(72),AAHY01108217.1:1..48109,gap(2803),
CO   AAHY01108218.1:1..15359,gap(20),complement(AAHY01108219.1:1..11081),
CO   gap(105),AAHY01108220.1:1..113109,gap(20),AAHY01108221.1:1..108230,
CO   gap(167),AAHY01108222.1:1..8820,gap(920),AAHY01108223.1:1..3986,gap(20),
CO   AAHY01108224.1:1..13197,gap(20),AAHY01108225.1:1..6940,gap(879),
CO   complement(AAHY01108226.1:1..2031),gap(415),AAHY01108227.1:1..12659,
CO   gap(20),AAHY01108228.1:1..14314,gap(77),complement(AAHY01108229.1:1..350),
CO   gap(86),AAHY01108230.1:1..34714,gap(351),AAHY01108231.1:1..8961,gap(1002),
CO   AAHY01108232.1:1..10329,gap(20),AAHY01108233.1:1..14993,gap(20),
CO   AAHY01108234.1:1..11345,gap(20),AAHY01108235.1:1..5449,gap(106),
CO   complement(AAHY01108236.1:1..7315),gap(20),AAHY01108237.1:1..64315,
CO   gap(545),complement(AAHY01108238.1:1..12739),gap(20),
CO   AAHY01108239.1:1..1923,gap(20),AAHY01108240.1:1..3685,gap(142),
CO   AAHY01108241.1:1..52757,gap(48),AAHY01108242.1:1..1138,gap(133),
CO   complement(AAHY01108243.1:1..5054),gap(20),AAHY01108244.1:1..35014,gap(20),
CO   AAHY01108245.1:1..4605,gap(27),AAHY01108246.1:1..15615,gap(20),
CO   AAHY01108247.1:1..6619,gap(184),complement(AAHY01108248.1:1..14777),
CO   gap(251),AAHY01108249.1:1..37568,gap(20),AAHY01108250.1:1..11309,gap(20),
CO   AAHY01108251.1:1..11520,gap(20),AAHY01108252.1:1..33739,gap(20),
CO   AAHY01108253.1:1..24966,gap(20),AAHY01108254.1:1..21245,gap(32),
CO   AAHY01108255.1:1..114639,gap(25),AAHY01108256.1:1..24622,gap(865),
CO   complement(AAHY01108257.1:1..13572),gap(25),
CO   complement(AAHY01108258.1:1..39436),gap(112),AAHY01108259.1:1..24063,
CO   gap(20),AAHY01108260.1:1..1198,gap(20),AAHY01108261.1:1..5714,gap(20),
CO   complement(AAHY01108262.1:1..1404),gap(20),AAHY01108263.1:1..5490,gap(20),
CO   AAHY01108264.1:1..12951,gap(237),AAHY01108265.1:1..7100,gap(20),
CO   AAHY01108266.1:1..27478,gap(573),AAHY01108267.1:1..9959,gap(20),
CO   AAHY01108268.1:1..29810,gap(20),AAHY01108269.1:1..43532,gap(332),
CO   AAHY01108270.1:1..8214,gap(337),AAHY01108271.1:1..8670,gap(20),
CO   AAHY01108272.1:1..20171,gap(388),AAHY01108273.1:1..21277,gap(20),
CO   complement(AAHY01108274.1:1..1527),gap(154),AAHY01108275.1:1..4604,gap(92),
CO   complement(AAHY01108276.1:1..1510),gap(1390),
CO   complement(AAHY01108277.1:1..1302),gap(337),AAHY01108278.1:1..7774,gap(20),
CO   AAHY01108279.1:1..6584,gap(784),AAHY01108280.1:1..5220,gap(50),
CO   AAHY01108281.1:1..136686,gap(20),AAHY01108282.1:1..6344,gap(838),
CO   AAHY01108283.1:1..5427,gap(20),AAHY01108284.1:1..14680,gap(362),
CO   AAHY01108285.1:1..38068,gap(20),AAHY01108286.1:1..1004,gap(20),
CO   AAHY01108287.1:1..3028,gap(310),AAHY01108288.1:1..8458,gap(39),
CO   AAHY01108289.1:1..8022,gap(20),AAHY01108290.1:1..1613,gap(20),
CO   complement(AAHY01108291.1:1..2503),gap(4389),AAHY01108292.1:1..6954,
CO   gap(20),complement(AAHY01108293.1:1..3844),gap(151),AAHY01108294.1:1..5965,
CO   gap(20),AAHY01108295.1:1..10871,gap(20),AAHY01108296.1:1..1157,gap(368),
CO   AAHY01108297.1:1..9430,gap(20),AAHY01108298.1:1..55870,gap(20),
CO   AAHY01108299.1:1..21982,gap(6848),complement(AAHY01108300.1:1..29414),
CO   gap(20),complement(AAHY01108301.1:1..18100),gap(20),
CO   AAHY01108302.1:1..19542,gap(230),complement(AAHY01108303.1:1..8734),
CO   gap(20),AAHY01108304.1:1..7959,gap(20),AAHY01108305.1:1..2411,gap(20),
CO   AAHY01108306.1:1..5472,gap(20),complement(AAHY01108307.1:1..2421),gap(20),
CO   complement(AAHY01108308.1:1..1215),gap(20),
CO   complement(AAHY01108309.1:1..1052),gap(20),AAHY01108310.1:1..1067,gap(20),
CO   AAHY01108311.1:1..1294,gap(20),AAHY01108312.1:1..1313,gap(20),
CO   AAHY01108313.1:1..1969,gap(20),AAHY01108314.1:1..5415,gap(3682),
CO   complement(AAHY01108315.1:1..22350),gap(805),AAHY01108316.1:1..71240,
CO   gap(20),AAHY01108317.1:1..4200,gap(20),AAHY01108318.1:1..58990,gap(101),
CO   AAHY01108319.1:1..14955,gap(1793),AAHY01108320.1:1..1325,gap(20),
CO   AAHY01108321.1:1..49985,gap(1853),AAHY01108322.1:1..16838,gap(20),
CO   complement(AAHY01108323.1:1..2270),gap(635),AAHY01108324.1:1..6909,
CO   gap(1460),AAHY01108325.1:1..3855,gap(283),
CO   complement(AAHY01108326.1:1..2313),gap(20),AAHY01108327.1:1..3654,gap(20),
CO   AAHY01108328.1:1..3226,gap(20),AAHY01108329.1:1..1048,gap(20),
CO   complement(AAHY01108330.1:1..1290),gap(20),
CO   complement(AAHY01108331.1:1..2464),gap(1683),AAHY01108332.1:1..3391,
CO   gap(20),AAHY01108333.1:1..1107,gap(20),complement(AAHY01108334.1:1..2150),
CO   gap(20),complement(AAHY01108335.1:1..1138),gap(20),AAHY01108336.1:1..3295,
CO   gap(20),AAHY01108337.1:1..2766,gap(20),complement(AAHY01108338.1:1..13256),
CO   gap(20),AAHY01108339.1:1..3625,gap(322),complement(AAHY01108340.1:1..1663),
CO   gap(5121),AAHY01108341.1:1..3396,gap(20),
CO   complement(AAHY01108342.1:1..1567),gap(4533),AAHY01108343.1:1..7923,
CO   gap(20),AAHY01108344.1:1..21627,gap(1973),AAHY01108345.1:1..79242,gap(20),
CO   AAHY01108346.1:1..34449,gap(20),AAHY01108347.1:1..41849,gap(167),
CO   complement(AAHY01108348.1:1..2675),gap(20),AAHY01108349.1:1..6036,
CO   gap(3374),AAHY01108350.1:1..66454,gap(71),AAHY01108351.1:1..9336,gap(45),
CO   AAHY01108352.1:1..26827,gap(122),AAHY01108353.1:1..23443,gap(349),
CO   complement(AAHY01108354.1:1..1093),gap(20051),AAHY01108355.1:1..42412,
CO   gap(559),AAHY01108356.1:1..15478,gap(20),AAHY01108357.1:1..6943,gap(20),
CO   AAHY01108358.1:1..1914,gap(20),AAHY01108359.1:1..1279,gap(5014),
CO   AAHY01108360.1:1..25000,gap(41),AAHY01108361.1:1..10082,gap(447),
CO   AAHY01108362.1:1..1605,gap(20),AAHY01108363.1:1..11914,gap(619),
CO   complement(AAHY01108364.1:1..33250),gap(20),AAHY01108365.1:1..3040,gap(20),
CO   AAHY01108366.1:1..24973,gap(147),AAHY01108367.1:1..10359,gap(20),
CO   AAHY01108368.1:1..4575,gap(5234),complement(AAHY01108369.1:1..4769),
CO   gap(20),AAHY01108370.1:1..60108,gap(20),complement(AAHY01108371.1:1..7455),
CO   gap(235),AAHY01108372.1:1..28248,gap(535),AAHY01108373.1:1..15345,gap(20),
CO   AAHY01108374.1:1..9210,gap(648),AAHY01108375.1:1..34773,gap(20),
CO   AAHY01108376.1:1..1185,gap(20),AAHY01108377.1:1..1508,gap(20),
CO   AAHY01108378.1:1..3108,gap(20),AAHY01108379.1:1..7467,gap(20),
CO   AAHY01108380.1:1..17434,gap(540),AAHY01108381.1:1..515,gap(801),
CO   AAHY01108382.1:1..7931,gap(20),AAHY01108383.1:1..2212,gap(20),
CO   complement(AAHY01108384.1:1..1218),gap(20),AAHY01108385.1:1..9180,gap(20),
CO   AAHY01108386.1:1..8037,gap(20),complement(AAHY01108387.1:1..8931),gap(184),
CO   AAHY01108388.1:1..13734,gap(152),complement(AAHY01108389.1:1..6323),
CO   gap(1140),AAHY01108390.1:1..7467,gap(266),
CO   complement(AAHY01108391.1:1..1491),gap(919),AAHY01108392.1:1..3609,
CO   gap(127),AAHY01108393.1:1..3608,gap(5938),AAHY01108394.1:1..17842,gap(97),
CO   AAHY01108395.1:1..32087,gap(100),AAHY01108396.1:1..25484,gap(1471),
CO   AAHY01108397.1:1..2901,gap(1875),AAHY01108398.1:1..28194,gap(20),
CO   AAHY01108399.1:1..76115,gap(5975),complement(AAHY01108400.1:1..5435),
CO   gap(20),AAHY01108401.1:1..1207,gap(8211),AAHY01108402.1:1..1399,gap(20),
CO   AAHY01108403.1:1..27561,gap(227),AAHY01108404.1:1..3053,gap(630),
CO   AAHY01108405.1:1..11629,gap(20),complement(AAHY01108406.1:1..1489),gap(20),
CO   complement(AAHY01108407.1:1..3940),gap(358),AAHY01108408.1:1..2455,
CO   gap(1829),AAHY01108409.1:1..5723,gap(20),
CO   complement(AAHY01108410.1:1..3299),gap(677),
CO   complement(AAHY01108411.1:1..2912),gap(20),AAHY01108412.1:1..1262,gap(128),
CO   complement(AAHY01108413.1:1..4867),gap(2389),
CO   complement(AAHY01108414.1:1..1226),gap(289),AAHY01108415.1:1..1237,
CO   gap(1431),AAHY01108416.1:1..1971,gap(9347),
CO   complement(AAHY01108417.1:1..23999),gap(20),AAHY01108418.1:1..12371,
CO   gap(20),AAHY01108419.1:1..1446,gap(140),AAHY01108420.1:1..20271,gap(357),
CO   complement(AAHY01108421.1:1..3496),gap(891),
CO   complement(AAHY01108422.1:1..707),gap(443),AAHY01108423.1:1..8196,gap(20),
CO   complement(AAHY01108424.1:1..517),gap(4451),AAHY01108425.1:1..9792,gap(20),
CO   AAHY01108426.1:1..11333,gap(20),AAHY01108427.1:1..37574,gap(1045),
CO   AAHY01108428.1:1..2036,gap(2090),complement(AAHY01108429.1:1..2456),
CO   gap(316),complement(AAHY01108430.1:1..8842),gap(20),AAHY01108431.1:1..2624,
CO   gap(20),complement(AAHY01108432.1:1..2781),gap(20),
CO   complement(AAHY01108433.1:1..1097),gap(20),AAHY01108434.1:1..17294,gap(20),
CO   AAHY01108435.1:1..5404,gap(547),AAHY01108436.1:1..2953,gap(20),
CO   AAHY01108437.1:1..6916,gap(44),AAHY01108438.1:1..12986,gap(20),
CO   AAHY01108439.1:1..2343,gap(20),complement(AAHY01108440.1:1..2370),gap(20),
CO   AAHY01108441.1:1..1017,gap(20),AAHY01108442.1:1..5091,gap(20),
CO   AAHY01108443.1:1..163874,gap(20),AAHY01108444.1:1..4160,gap(20),
CO   AAHY01108445.1:1..11797,gap(994),complement(AAHY01108446.1:1..4013),
CO   gap(127),AAHY01108447.1:1..3338,gap(20),AAHY01108448.1:1..10095,gap(20),
CO   AAHY01108449.1:1..1803,gap(175),AAHY01108450.1:1..8076,gap(163),
CO   AAHY01108451.1:1..3963,gap(20),AAHY01108452.1:1..1092,gap(20),
CO   AAHY01108453.1:1..1180,gap(20),AAHY01108454.1:1..3098,gap(6988),
CO   AAHY01108455.1:1..19255,gap(20),AAHY01108456.1:1..11051,gap(20),
CO   AAHY01108457.1:1..1794,gap(20),AAHY01108458.1:1..10017,gap(20),
CO   complement(AAHY01108459.1:1..3074),gap(20),AAHY01108460.1:1..1920,gap(20),
CO   complement(AAHY01108461.1:1..7379),gap(20),AAHY01108462.1:1..23621,
CO   gap(125),AAHY01108463.1:1..15881,gap(377),AAHY01108464.1:1..18531,gap(20),
CO   AAHY01108465.1:1..2634,gap(20),complement(AAHY01108466.1:1..5549),gap(646),
CO   AAHY01108467.1:1..1849,gap(20),AAHY01108468.1:1..10682,gap(20),
CO   AAHY01108469.1:1..1675,gap(20),AAHY01108470.1:1..2983,gap(506),
CO   AAHY01108471.1:1..6087,gap(20),AAHY01108472.1:1..6557,gap(24),
CO   AAHY01108473.1:1..9064,gap(23),AAHY01108474.1:1..3813,gap(286),
CO   complement(AAHY01108475.1:1..707),gap(1217),
CO   complement(AAHY01108476.1:1..1181),gap(1885),AAHY01108477.1:1..3192,
CO   gap(7149),complement(AAHY01108478.1:1..2127))
//