Dbfetch

ID   CH466560; SV 1; linear; genomic DNA; CON; MUS; 19989287 BP.
XX
AC   CH466560;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009787569 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-19989287
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-19989287
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 7ae42861c106c1ad24b50577f7c677d1.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000217.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000006673; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006675; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006676; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007815; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010044; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010045; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010047; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010048; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010054; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010067; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020257; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025647; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025651; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032356; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032359; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032368; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032372; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032412; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032413; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032454; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032456; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032462; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032463; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032468; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032470; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032475; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032531; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032548; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032549; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032557; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032563; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032564; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032570; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032575; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032577; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032590; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032591; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032596; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032598; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032599; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032601; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032607; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032611; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032612; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032839; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036972; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037784; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037953; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037977; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039313; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039461; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039952; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043154; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046402; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047606; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048758; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049314; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049493; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050641; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052911; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053747; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061701; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062270; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062867; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063058; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064145; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066357; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066368; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070287; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074139; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079334; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091080; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091129; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091537; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096316; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000107055; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000107235; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035115; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035117; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035118; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035119; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035123; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035124; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035127; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035137; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035138; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035143; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035145; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035152; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035154; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035155; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035163; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035165; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035166; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035169; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035170; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035172; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035173; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035175; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035177; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035178; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035182; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035189; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035204; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035207; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035209; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035210; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035215; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035221; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035240; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035245; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035248; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035251; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035253; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035256; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035257; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035258; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035259; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035261; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035263; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035273; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035285; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035286; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035288; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035291; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035292; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035294; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035295; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035297; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035300; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035301; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035303; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035304; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035307; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035308; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035309; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035311; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035312; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035313; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035317; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035321; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035325; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035329; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035096; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035098; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035099; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035100; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035104; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035105; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035108; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035118; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035119; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035124; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035127; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035134; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035136; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035137; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035144; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035146; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035147; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035150; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035151; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035153; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035154; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035156; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035158; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035159; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035163; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035169; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035184; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035187; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035189; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035190; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035195; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035201; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035219; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035224; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035227; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035230; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035232; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035235; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035236; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035237; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035238; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035240; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035242; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035252; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035264; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035265; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035267; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035270; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035273; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035274; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035276; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035279; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035280; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035282; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035283; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035286; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035287; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035288; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035290; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035291; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035292; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035296; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035300; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035304; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035308; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035028; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035030; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035031; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035032; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035036; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035037; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035040; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035050; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035051; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035056; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035058; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035065; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035067; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035068; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035072; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035076; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035078; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035079; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035082; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035083; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035085; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035086; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035088; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035090; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035091; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035095; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035101; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035116; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035119; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035121; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035122; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035127; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035133; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035151; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035156; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035159; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035162; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035164; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035167; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035168; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035169; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035170; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035172; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035174; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035184; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035196; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035197; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035199; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035202; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035205; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035206; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035208; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035211; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035212; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035214; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035215; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035218; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035219; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035220; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035222; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035223; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035224; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035228; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035232; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035236; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035088; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035090; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035091; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035092; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035093; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035097; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035098; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035101; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035111; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035112; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035117; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035119; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035126; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035128; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035129; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035137; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035139; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035140; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035143; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035144; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035146; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035147; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035149; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035151; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035152; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035156; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035162; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035177; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035180; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035182; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035183; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035188; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035194; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035213; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035218; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035224; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035226; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035229; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035230; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035231; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035232; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035234; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035236; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035246; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035258; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035259; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035261; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035264; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035267; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035268; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035270; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035273; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035274; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035276; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035277; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035280; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035281; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035282; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035284; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035285; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035286; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035290; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035294; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035298; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035303; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034799; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034801; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034803; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034807; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034808; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034811; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034821; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034822; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034827; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034829; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034836; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034838; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034839; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034843; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034847; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034849; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034850; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034853; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034854; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034856; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034857; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034859; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034861; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034862; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034866; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034872; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034887; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034890; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034892; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034893; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034898; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034904; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034923; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034928; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034931; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034934; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034936; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034939; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034940; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034941; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034942; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034944; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034946; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034956; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034968; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034969; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034971; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034974; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034977; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034978; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034980; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034983; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034984; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034986; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034987; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034990; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034991; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034992; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034994; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034995; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035000; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035004; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035008; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035012; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035609; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035611; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035612; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035613; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035614; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035617; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035618; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035621; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035631; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035632; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035637; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035639; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035646; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035648; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035649; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035652; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035657; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035659; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035660; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035663; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035664; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035666; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035667; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035669; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035671; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035672; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035676; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035682; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035697; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035700; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035702; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035703; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035708; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035714; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035733; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035738; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035741; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035744; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035746; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035749; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035750; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035751; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035752; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035754; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035756; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035766; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035778; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035779; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035781; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035784; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035787; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035788; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035790; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035793; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035794; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035796; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035800; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035801; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035802; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035804; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035805; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035806; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035810; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035814; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035818; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035822; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035823; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034111; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034113; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034114; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034115; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034119; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034120; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034123; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034133; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034134; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034139; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034141; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034148; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034149; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034150; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034158; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034160; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034161; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034164; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034165; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034167; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034168; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034170; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034172; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034173; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034177; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034184; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034199; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034204; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034205; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034210; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034216; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034234; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034239; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034242; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034245; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034247; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034250; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034251; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034252; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034253; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034255; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034257; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034267; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034279; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034280; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034282; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034285; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034288; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034289; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034291; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034294; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034295; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034297; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034298; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034301; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034302; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034303; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034305; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034306; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034307; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034311; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034315; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034319; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034323; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034767; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034769; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034770; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034771; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034775; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034776; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034779; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034789; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034790; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034795; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034797; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034804; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034806; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034807; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034810; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034815; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034817; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034818; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034821; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034822; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034824; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034825; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034827; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034829; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034830; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034834; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034841; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034856; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034859; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034861; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034862; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034867; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034873; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034891; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034896; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034899; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034902; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034904; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034907; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034908; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034909; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034910; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034912; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034914; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034924; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034936; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034937; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034939; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034942; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034945; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034946; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034948; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034951; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034952; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034954; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034955; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034958; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034959; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034960; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034962; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034963; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034964; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034968; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034972; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034976; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034980; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034929; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034931; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034932; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034933; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034934; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034937; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034938; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034941; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034951; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034952; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034957; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034959; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034966; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034968; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034969; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034977; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034979; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034980; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034983; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034984; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034986; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034987; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034989; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034991; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034992; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034996; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035002; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035017; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035020; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035022; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035023; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035028; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035034; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035052; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035057; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035063; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035065; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035068; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035069; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035070; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035071; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035073; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035075; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035085; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035097; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035098; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035100; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035103; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035106; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035107; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035109; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035112; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035113; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035115; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035116; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035119; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035120; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035123; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035124; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035125; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035129; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035133; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035141; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034875; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034877; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034878; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034879; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034885; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034886; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034889; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034899; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034900; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034905; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034907; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034914; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034916; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034917; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034920; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034925; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034927; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034928; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034931; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034932; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034934; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034935; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034937; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034939; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034940; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034944; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034950; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034965; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034968; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034970; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034971; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034976; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034982; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035000; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035005; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035008; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035011; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035013; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035016; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035017; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035018; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035019; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035021; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035023; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035033; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035045; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035046; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035048; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035051; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035054; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035055; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035057; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035060; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035061; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035063; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035067; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035068; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035069; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035071; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035072; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035073; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035077; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035081; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035085; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035089; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035008; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035010; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035011; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035012; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035016; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035017; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035020; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035030; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035031; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035036; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035038; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035045; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035047; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035048; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035053; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035055; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035056; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035059; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035060; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035062; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035063; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035065; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035067; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035068; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035072; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035078; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035093; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035096; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035098; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035099; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035104; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035110; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035128; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035133; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035136; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035139; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035141; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035144; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035145; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035146; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035147; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035149; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035151; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035161; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035173; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035174; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035176; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035179; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035180; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035182; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035183; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035185; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035188; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035189; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035191; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035192; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035195; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035196; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035197; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035199; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035200; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035201; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035205; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035209; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035217; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034916; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034918; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034919; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034920; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034924; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034925; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034938; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034939; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034944; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034946; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034953; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034955; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034956; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034959; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034964; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034966; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034967; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034970; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034971; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034973; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034974; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034976; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034978; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034979; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034983; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034989; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035004; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035007; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035009; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035010; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035015; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035021; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035039; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035044; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035047; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035050; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035052; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035055; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035056; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035057; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035058; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035060; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035062; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035072; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035084; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035085; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035087; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035090; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035093; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035094; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035096; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035099; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035100; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035102; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035106; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035107; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035110; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035111; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035112; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035116; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035120; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035128; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035629; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035631; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035632; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035633; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035637; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035638; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035641; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035653; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035654; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035659; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035661; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035668; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035670; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035671; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035674; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035679; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035681; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035682; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035685; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035686; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035688; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035689; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035691; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035693; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035694; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035698; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035704; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035719; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035722; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035724; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035725; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035730; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035736; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035754; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035759; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035762; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035765; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035767; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035770; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035771; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035772; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035773; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035775; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035777; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035787; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035799; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035800; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035802; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035805; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035808; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035809; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035811; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035814; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035815; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035817; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035818; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035821; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035822; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035823; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035825; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035826; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035827; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035831; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035835; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035839; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035843; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035845; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033818; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033820; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033821; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033826; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033827; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033830; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033840; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033841; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033846; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033848; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033855; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033856; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033857; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033865; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033867; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033868; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033871; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033872; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033874; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033875; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033877; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033880; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033884; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033891; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033906; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033909; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033911; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033912; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033917; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033923; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033941; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033946; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033949; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033952; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033954; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033957; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033958; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033959; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033960; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033962; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033964; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033974; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033986; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033987; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033989; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033992; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033995; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033996; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033998; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034001; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034002; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034004; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034005; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034008; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034009; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034010; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034012; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034013; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034014; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034018; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034022; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034026; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034231; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034233; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034234; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034235; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034239; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034240; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034243; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034253; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034254; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034259; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034261; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034268; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034269; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034270; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034278; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034280; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034281; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034284; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034285; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034287; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034288; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034290; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034292; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034293; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034297; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034304; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034319; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034322; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034324; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034325; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034330; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034336; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034355; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034360; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034363; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034366; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034368; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034371; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034372; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034373; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034374; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034376; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034378; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034388; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034400; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034401; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034403; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034406; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034409; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034410; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034412; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034415; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034416; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034418; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034419; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034422; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034423; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034424; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034426; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034427; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034428; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034432; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034436; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034444; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000006851; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006853; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007959; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010188; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010189; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010192; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010198; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013338; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020490; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026743; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034909; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034927; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034983; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035029; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035037; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035045; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035121; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035166; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035170; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035194; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035211; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035216; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035218; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035220; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035230; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035237; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042553; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042581; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044491; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052068; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054819; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057265; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060700; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065014; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065360; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066773; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068700; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071302; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075941; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078367; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079548; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080435; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085073; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085133; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093786; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093800; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098443; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112874; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112885; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112911; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112938; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116522; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119472; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122384; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149243; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159283; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166905; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167504; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169860; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171091; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171412; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172646; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173933; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178051; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180154; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185470; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000187905; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188555; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189137; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189446; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000191465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000191899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000192054; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000192307; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000192886; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000193254; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194959; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000195752; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196954; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197483; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198708; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202637; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202750; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093562; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093566; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093568; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093572; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093603; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093606; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093622; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093656; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093663; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093703; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093709; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093756; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093762; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093763; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093780; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093785; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093789; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093805; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093811; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093820; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093821; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093832; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093840; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093844; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093871; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093899; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093971; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093984; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094003; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094007; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094033; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094078; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094167; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094187; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094209; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094229; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094241; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094252; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094257; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094267; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094270; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094281; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094292; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094399; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094482; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094486; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094496; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094511; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094514; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094523; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094533; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094536; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094556; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094563; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094596; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094609; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094628; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094630; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094636; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094652; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094658; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094670; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094696; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094724; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094754; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0094769; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0093645; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093649; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093651; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093655; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093689; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093692; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093707; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093741; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093748; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093790; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093796; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093843; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093849; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093850; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093866; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093871; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093874; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093890; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093896; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093905; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093906; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093917; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093925; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093929; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093956; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0093983; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094057; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094070; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094089; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094093; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094119; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094163; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094256; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094276; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094298; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094318; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094331; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094342; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094347; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094357; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094360; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094371; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094382; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094490; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094573; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094577; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094587; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094602; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094613; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094623; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094626; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094646; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094653; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094686; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094700; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094719; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094721; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094727; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094743; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094749; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094761; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094787; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094815; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094845; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0094859; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093600; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093604; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093606; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093610; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093643; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093646; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093660; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093694; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093701; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093744; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093749; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093795; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093801; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093802; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093815; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093819; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093824; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093827; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093843; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093849; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093858; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093859; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093870; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093878; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093882; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093909; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0093936; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094010; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094023; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094042; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094046; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094070; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094116; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094209; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094229; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094252; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094272; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094284; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094295; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094300; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094310; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094313; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094324; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094335; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094443; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094527; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094532; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094542; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094557; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094568; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094578; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094581; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094601; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094608; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094641; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094655; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094674; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094676; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094682; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094698; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094704; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094716; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094742; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094770; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094800; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0094813; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093574; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093578; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093580; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093584; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093595; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093618; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093621; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093636; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093670; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093677; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093718; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093723; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093767; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093773; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093774; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093791; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093796; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093799; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093815; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093821; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093830; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093831; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093842; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093850; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093854; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093881; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093909; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093984; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093997; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094016; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094020; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094046; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094090; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094183; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094203; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094245; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094257; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094268; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094273; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094283; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094286; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094297; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094308; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094416; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094499; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094504; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094514; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094529; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094540; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094550; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094553; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094573; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094580; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094613; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094627; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094646; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094648; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094654; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094670; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094676; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094688; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094714; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094742; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094772; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0094786; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093153; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093157; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093163; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093195; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093198; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093212; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093246; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093253; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093294; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093298; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093345; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093351; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093352; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093365; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093369; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093374; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093377; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093393; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093399; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093408; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093409; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093420; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093428; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093432; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093459; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093486; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093560; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093573; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093593; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093597; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093623; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093668; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093761; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093782; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093804; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093824; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093836; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093847; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093852; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093862; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093865; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093876; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093887; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093990; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094073; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094078; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094088; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094103; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094114; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094124; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094127; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094147; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094154; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094187; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094200; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094217; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094219; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094225; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094240; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094246; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094284; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094312; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094341; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094355; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094085; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094089; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094091; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094095; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094106; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094129; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094132; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094149; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094182; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094189; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094230; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094235; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094282; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094288; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094289; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094301; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094306; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094311; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094314; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094330; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094336; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094345; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094346; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094357; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094365; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094369; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094396; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094423; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094497; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094510; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094529; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094533; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094559; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094605; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094698; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094718; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094740; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094759; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094771; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094782; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094787; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094797; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094800; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094811; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094822; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094926; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095010; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095014; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095024; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095039; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095050; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095060; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095063; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095083; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095090; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095123; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095155; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095157; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095163; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095177; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095183; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095195; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095221; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095248; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095278; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095291; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095294; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093744; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093748; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093750; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093754; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093788; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093791; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093807; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093841; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093848; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093889; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093894; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093941; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093946; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093947; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093964; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093970; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093973; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093989; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093995; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094005; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094006; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094017; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094025; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094029; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094056; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094084; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094157; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094191; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094195; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094221; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094268; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094360; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094380; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094402; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094422; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094434; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094445; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094450; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094460; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094463; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094474; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094485; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094589; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094672; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094676; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094686; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094701; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094712; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094722; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094725; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094745; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094752; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094785; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094799; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094818; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094820; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094826; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094842; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094848; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094860; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094886; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094914; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094944; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094958; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0093073; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093077; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093079; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093083; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093115; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093118; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093132; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093166; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093173; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093213; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093218; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093262; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093268; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093269; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093281; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093286; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093291; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093295; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093311; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093317; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093326; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093327; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093338; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093346; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093350; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093377; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093405; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093479; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093492; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093512; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093516; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093542; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093587; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093677; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093697; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093719; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093739; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093752; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093763; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093768; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093778; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093781; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093792; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093803; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093911; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093994; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0093999; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094009; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094024; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094033; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094043; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094046; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094066; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094073; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094106; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094120; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094139; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094141; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094147; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094163; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094169; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094181; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094207; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094235; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094265; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0094279; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093279; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093283; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093285; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093289; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093300; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093323; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093326; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093340; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093374; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093381; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093421; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093426; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093473; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093479; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093480; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093497; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093502; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093505; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093521; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093527; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093536; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093537; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093548; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093556; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093560; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093587; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093615; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093688; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093701; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093721; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093725; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093751; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093795; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093887; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093907; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093949; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093961; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093972; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093977; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093987; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0093990; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094001; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094012; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094120; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094203; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094208; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094218; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094233; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094244; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094254; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094257; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094277; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094284; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094317; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094330; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094349; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094351; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094371; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094377; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094389; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094415; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094443; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0094485; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0093135; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093139; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093141; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093145; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093180; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093183; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093198; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093233; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093240; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093282; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093286; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093328; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093334; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093335; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093347; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093352; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093357; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093360; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093376; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093382; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093391; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093392; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093403; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093411; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093415; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093442; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093469; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093543; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093556; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093575; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093579; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093652; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093740; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093761; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093783; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093803; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093815; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093826; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093831; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093841; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093844; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093855; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093866; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0093973; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094057; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094062; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094072; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094087; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094098; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094108; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094111; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094131; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094138; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094173; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094206; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094208; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094214; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094228; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094234; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094246; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094272; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094300; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094330; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094343; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093289; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093293; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093295; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093299; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093333; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093336; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093352; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093386; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093393; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093434; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093439; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093485; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093491; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093492; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093506; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093511; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093514; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093530; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093536; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093545; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093546; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093557; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093565; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093569; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093596; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093623; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093698; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093711; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093730; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093734; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093760; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093804; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093897; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093917; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093939; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093959; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093971; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093982; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093987; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0093997; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094000; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094011; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094022; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094129; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094211; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094215; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094225; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094240; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094243; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094251; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094261; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094264; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094284; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094291; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094324; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094338; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094357; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094359; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094365; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094381; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094387; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094399; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094425; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094453; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0094497; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093119; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093123; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093125; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093129; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093161; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093164; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093211; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093218; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093257; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093261; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093304; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093310; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093311; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093323; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093328; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093333; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093336; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093352; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093358; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093368; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093369; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093380; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093388; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093392; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093418; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093445; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093518; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093531; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093551; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093555; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093581; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093626; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093716; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093736; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093758; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093779; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093791; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093802; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093807; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093817; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093820; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093831; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093842; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093950; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094035; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094039; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094049; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094064; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094075; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094085; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094088; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094108; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094115; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094148; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094181; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094183; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094199; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094205; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094217; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094243; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094271; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094313; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094410; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094414; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094416; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094420; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094453; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094456; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094472; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094510; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094517; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094556; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094561; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094608; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094614; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094615; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094627; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094632; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094637; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094640; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094656; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094662; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094672; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094673; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094684; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094692; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094696; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094723; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094750; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094824; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094837; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094856; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094860; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094886; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094931; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095023; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095043; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095065; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095086; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095099; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095110; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095115; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095125; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095128; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095139; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095150; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095259; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095343; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095347; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095357; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095372; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095383; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095393; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095396; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095416; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095423; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095456; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095469; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095488; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095490; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095496; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095512; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095518; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095530; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095556; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095583; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095613; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095626; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0095630; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093179; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093183; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093185; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093223; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093226; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093242; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093277; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093285; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093324; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093330; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093377; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093382; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093383; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093400; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093406; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093409; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093426; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093432; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093442; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093443; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093454; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093463; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093490; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093520; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093595; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093610; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093630; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093634; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093660; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093706; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093797; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093817; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093839; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093860; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093872; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093883; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093888; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093898; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093901; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093912; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093923; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094026; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094109; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094113; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094123; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094138; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094148; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094158; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094161; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094181; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094188; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094221; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094234; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094254; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094256; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094262; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094277; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094283; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094295; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094321; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094349; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094379; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092150; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092154; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092156; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092160; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092193; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092196; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092211; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092245; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092252; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092291; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092295; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092342; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092347; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092348; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092365; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092370; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092373; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092389; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092395; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092404; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092405; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092416; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092424; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092428; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092455; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092483; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092556; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092570; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092590; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092594; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092620; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092665; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092757; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092777; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092799; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092820; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092832; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092843; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092848; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092858; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092861; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092872; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092883; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092985; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093068; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093072; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093082; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093097; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093107; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093117; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093120; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093140; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093147; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093180; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093194; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093213; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093215; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093221; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093237; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093243; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093255; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093281; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093309; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093351; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..19989287
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            2330..150820
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /note="gene_id=mCG66388.3"
FT   mRNA            join(2330..2475,6852..6935)
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   transcript variant mCT169839"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT169839.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(2438..2475,6852..6855)
FT                   /codon_start=1
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT169839.0
FT                   protein_id=mCP92505.1 isoform=CRA_c"
FT                   /protein_id="EDL20889.1"
FT                   /translation="MFYIDQEEPRAFR"
FT   mRNA            join(2842..2965,6852..>6935)
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   transcript variant mCT66571"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT66571.2 created
FT                   on 12-JUN-2003"
FT   CDS             join(2849..2965,6852..>6935)
FT                   /codon_start=1
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT66571.2
FT                   protein_id=mCP33365.2 isoform=CRA_d"
FT                   /protein_id="EDL20890.1"
FT                   /translation="MAAVTVNSAKRGLRAELKQRLRALSAEERLRQSLLLTQKVIAHNQ
FT                   YQNSKRISIFLSMQDEVETEVI"
FT   mRNA            join(3037..3135,112817..112944,135477..135708,
FT                   147294..150820)
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   transcript variant mCT185608"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT185608.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(<3037..3135,6852..6935,17801..18481)
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   transcript variant mCT169838"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT169838.1 created
FT                   on 12-JUN-2003"
FT   CDS             join(<6923..6935,17801..17973)
FT                   /codon_start=1
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT169838.1
FT                   protein_id=mCP92509.1 isoform=CRA_a"
FT                   /protein_id="EDL20887.1"
FT                   /translation="DGSNRFLKEVCKLDFSRLCWMNCIPFSKPSRCQCFTDVQTKAVPS
FT                   STISTCVCPLVIYISH"
FT   assembly_gap    6936..7419
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   assembly_gap    18482..19247
FT                   /estimated_length=766
FT                   /gap_type="unknown"
FT   assembly_gap    25048..25067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(58478..>59231)
FT                   /locus_tag="mCG_1032811"
FT                   /note="gene_id=mCG1032811.1"
FT   mRNA            complement(58478..>59231)
FT                   /locus_tag="mCG_1032811"
FT                   /product="mCG1032811"
FT                   /note="gene_id=mCG1032811.1 transcript_id=mCT150515.1
FT                   created on 06-JUN-2002"
FT   CDS             complement(58987..>59229)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032811"
FT                   /product="mCG1032811"
FT                   /note="gene_id=mCG1032811.1 transcript_id=mCT150515.1
FT                   protein_id=mCP68542.1"
FT                   /protein_id="EDL20891.1"
FT                   /translation="KLRILYLHGARFYIYHLFKAFAPSLGRSNCSHSTNRGNKRRKERK
FT                   SERERERKRERKTLNPKSLHSGTQQKPNITVRSSF"
FT   assembly_gap    102324..102343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    117290..123537
FT                   /estimated_length=6248
FT                   /gap_type="unknown"
FT   assembly_gap    125891..125910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    131361..132558
FT                   /estimated_length=1198
FT                   /gap_type="unknown"
FT   assembly_gap    133601..133620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    134735..134754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    139463..139482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             149136..149384
FT                   /codon_start=1
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT185608.0
FT                   protein_id=mCP106866.0 isoform=CRA_b"
FT                   /protein_id="EDL20888.1"
FT                   /translation="MIYFYLAAVARILCQDLLAGEFTSEGASWVHFRFPAPFLASYWNQ
FT                   NFRLVLRNLPSPEEHKNHTPMSAMCALIPLRRVSICL"
FT   assembly_gap    163188..163207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    168518..168537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    181966..183254
FT                   /estimated_length=1289
FT                   /gap_type="unknown"
FT   assembly_gap    191195..191752
FT                   /estimated_length=558
FT                   /gap_type="unknown"
FT   assembly_gap    192748..192980
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    206758..206777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    207906..207925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    216682..216701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    219408..219427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    220636..220655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    222096..222115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    227477..227683
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    250635..255785
FT                   /estimated_length=5151
FT                   /gap_type="unknown"
FT   assembly_gap    273964..274083
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    284520..284539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    301401..301420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    360592..360611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(369093..401415)
FT                   /gene="AF529169"
FT                   /locus_tag="mCG_7769"
FT                   /note="gene_id=mCG7769.2"
FT   mRNA            complement(join(369093..369669,374724..374978,
FT                   379348..381700,400924..401415))
FT                   /gene="AF529169"
FT                   /locus_tag="mCG_7769"
FT                   /product="cDNA sequence AF529169, transcript variant
FT                   mCT6962"
FT                   /note="gene_id=mCG7769.2 transcript_id=mCT6962.2 created on
FT                   06-JUN-2002"
FT   mRNA            complement(join(369093..369669,374298..374363,
FT                   374724..374978,379348..381700,400924..401415))
FT                   /gene="AF529169"
FT                   /locus_tag="mCG_7769"
FT                   /product="cDNA sequence AF529169, transcript variant
FT                   mCT169841"
FT                   /note="gene_id=mCG7769.2 transcript_id=mCT169841.0 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(369472..369669,374724..374978,
FT                   379348..381648))
FT                   /codon_start=1
FT                   /gene="AF529169"
FT                   /locus_tag="mCG_7769"
FT                   /product="cDNA sequence AF529169, isoform CRA_b"
FT                   /note="gene_id=mCG7769.2 transcript_id=mCT6962.2
FT                   protein_id=mCP11578.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q14CG5"
FT                   /db_xref="InterPro:IPR009626"
FT                   /db_xref="MGI:MGI:2667167"
FT                   /db_xref="UniProtKB/TrEMBL:Q14CG5"
FT                   /protein_id="EDL20893.1"
FT                   /translation="MEANQEASLFLVKILEELDSKQNTVSYQDLCKSLCAQFDLSQLAK
FT                   LRSVLFYTACLDPNFPATLFKDKMKCSVNNQQSKKIMVAADIVTIFNLIQMNGGTAKEK
FT                   LPMSCHKVRKKEASFESCRSDTEVCSPTVCEPLNCELSERPFSRGYPTRQSSKCRKMDC
FT                   KECPQFVPASEPNFLLGVSKEVKNRAASLDRLQALSPYSVASPQPCEMQRTYFPMNIEN
FT                   EPMSDQDSLPISQGIKETFISSEEPFVVQSCVQKRNIFKEDFHNLMTVSPSLVGTTNKA
FT                   EEGHGEPQSQKELHKPPFFNHSFEMPYHNQYLNPVYSPIPDKRRAKHESLDDLQASTYF
FT                   GPTPVMGTQDTRRCPGRSSKQTPWPAKSWSLNTEEVPDFERSFFNRNPSEEKLRYPNSG
FT                   SQTPNFSGPDRHPVYLVPKDQQKVLPAGYAVKPNGLKSKEISSPVDLEKHEAVKKFKDK
FT                   SISCTSGQHSSDTSSVGTQTEQHVLDPPKCKDLCTSGQAKYGDRHAMKQSDDDSEIVSD
FT                   DISDIFRFLDDMSISGSTGVIQSSCYNSTGSLSQLHKSDCDSSPEHHLAKITNGVSSGK
FT                   GDKCNRPENVHHSEEELKSSVCKLVLRIGEIERKLESLSGVREEISQVLGKLNKLDQKI
FT                   QQPEKVNVQIDLNSLTSEAPSDDSASPRVFRAHSGSHGPKLENSPDWCCSDASGSNSES
FT                   LRVKALKKSLFTRPSSRSLTEENSATESKIASISNSPRDWRTITYTNRMSLNEEEIKDA
FT                   GPANNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPTSLKGHMKSNPL
FT                   YTDMRLTELAEVKRGQPSWTIEEYARNSGDKGKLTALDLQTQESLNPNNLEYWMEDIYT
FT                   PGYDSLLKRKEAEFRRAKVCKIAALITAAACTVILVIVVPICTMKS"
FT   assembly_gap    369729..369823
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    373356..373537
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   CDS             complement(join(374352..374363,374724..374978,
FT                   379348..381648))
FT                   /codon_start=1
FT                   /gene="AF529169"
FT                   /locus_tag="mCG_7769"
FT                   /product="cDNA sequence AF529169, isoform CRA_a"
FT                   /note="gene_id=mCG7769.2 transcript_id=mCT169841.0
FT                   protein_id=mCP92500.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR009626"
FT                   /db_xref="MGI:MGI:2667167"
FT                   /db_xref="UniProtKB/TrEMBL:A0A087WS88"
FT                   /protein_id="EDL20892.1"
FT                   /translation="MEANQEASLFLVKILEELDSKQNTVSYQDLCKSLCAQFDLSQLAK
FT                   LRSVLFYTACLDPNFPATLFKDKMKCSVNNQQSKKIMVAADIVTIFNLIQMNGGTAKEK
FT                   LPMSCHKVRKKEASFESCRSDTEVCSPTVCEPLNCELSERPFSRGYPTRQSSKCRKMDC
FT                   KECPQFVPASEPNFLLGVSKEVKNRAASLDRLQALSPYSVASPQPCEMQRTYFPMNIEN
FT                   EPMSDQDSLPISQGIKETFISSEEPFVVQSCVQKRNIFKEDFHNLMTVSPSLVGTTNKA
FT                   EEGHGEPQSQKELHKPPFFNHSFEMPYHNQYLNPVYSPIPDKRRAKHESLDDLQASTYF
FT                   GPTPVMGTQDTRRCPGRSSKQTPWPAKSWSLNTEEVPDFERSFFNRNPSEEKLRYPNSG
FT                   SQTPNFSGPDRHPVYLVPKDQQKVLPAGYAVKPNGLKSKEISSPVDLEKHEAVKKFKDK
FT                   SISCTSGQHSSDTSSVGTQTEQHVLDPPKCKDLCTSGQAKYGDRHAMKQSDDDSEIVSD
FT                   DISDIFRFLDDMSISGSTGVIQSSCYNSTGSLSQLHKSDCDSSPEHHLAKITNGVSSGK
FT                   GDKCNRPENVHHSEEELKSSVCKLVLRIGEIERKLESLSGVREEISQVLGKLNKLDQKI
FT                   QQPEKVNVQIDLNSLTSEAPSDDSASPRVFRAHSGSHGPKLENSPDWCCSDASGSNSES
FT                   LRVKALKKSLFTRPSSRSLTEENSATESKIASISNSPRDWRTITYTNRMSLNEEEIKDA
FT                   GPANNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPTSLKGHMKSNPL
FT                   YTDMRLTELAEVKRGQPSWTIEEYARNSGDKGKLTALDLQHVG"
FT   assembly_gap    402249..402269
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   gene            complement(445659..446775)
FT                   /pseudo
FT                   /locus_tag="mCG_1032780"
FT                   /note="gene_id=mCG1032780.1"
FT   mRNA            complement(445659..446775)
FT                   /pseudo
FT                   /locus_tag="mCG_1032780"
FT                   /note="gene_id=mCG1032780.1 transcript_id=mCT150484.1
FT                   created on 06-JUN-2002"
FT   assembly_gap    454307..454326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    458199..464902
FT                   /estimated_length=6704
FT                   /gap_type="unknown"
FT   assembly_gap    475874..475893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(480451..486257)
FT                   /gene="Tmed3"
FT                   /locus_tag="mCG_8113"
FT                   /note="gene_id=mCG8113.2"
FT   mRNA            complement(join(480451..481228,484019..484267,
FT                   485993..486257))
FT                   /gene="Tmed3"
FT                   /locus_tag="mCG_8113"
FT                   /product="transmembrane emp24 domain containing 3"
FT                   /note="gene_id=mCG8113.2 transcript_id=mCT6967.1 created on
FT                   06-JUN-2002"
FT   CDS             complement(join(480992..481228,484019..484267,
FT                   485993..486172))
FT                   /codon_start=1
FT                   /gene="Tmed3"
FT                   /locus_tag="mCG_8113"
FT                   /product="transmembrane emp24 domain containing 3"
FT                   /note="gene_id=mCG8113.2 transcript_id=mCT6967.1
FT                   protein_id=mCP11572.1"
FT                   /protein_id="EDL20894.1"
FT                   /translation="MVHEAPHASSFQMLLQLLLLLLLRAEPLRSAELTFELPDNAKQCF
FT                   HEEVEQGVKFSLDYQVITGGHYDVDCYVEDPRGNVIYRETKKQYDSFTYKTEAKGVYRF
FT                   CFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQT
FT                   HYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPVNRAVHS"
FT   assembly_gap    487543..487631
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    493003..493022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    499799..499818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(509726..519950)
FT                   /gene="B230218L05Rik"
FT                   /locus_tag="mCG_57578"
FT                   /note="gene_id=mCG57578.2"
FT   mRNA            complement(join(509726..511807,519560..519950))
FT                   /gene="B230218L05Rik"
FT                   /locus_tag="mCG_57578"
FT                   /product="RIKEN cDNA B230218L05"
FT                   /note="gene_id=mCG57578.2 transcript_id=mCT57761.2 created
FT                   on 06-JUN-2002"
FT   CDS             complement(510159..511763)
FT                   /codon_start=1
FT                   /gene="B230218L05Rik"
FT                   /locus_tag="mCG_57578"
FT                   /product="RIKEN cDNA B230218L05"
FT                   /note="gene_id=mCG57578.2 transcript_id=mCT57761.2
FT                   protein_id=mCP33366.2"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2685617"
FT                   /db_xref="UniProtKB/TrEMBL:B2RPW9"
FT                   /protein_id="EDL20895.1"
FT                   /translation="MMDDDTELRTDGNSLLKAVWLGRLRLTRLLLEGGAYINESNDKGE
FT                   TALMVACITKHVDQQSISKSKMVKYLLDNRADPNIQDKSGKTALIHACIRRAGGEVVSL
FT                   LLENGADPSLEDRTGASALVYAINADDKDALKHLLDACKAKGKEVIIITTDKSSSGTKT
FT                   TKQYLNVPPSPKVEDRQSPPLCTTPSDVELKTSGLASPPSEKDDDFFILQTGHQSGCST
FT                   SKVLNEPGSPTRKVSSLKRARLPQLKRLQSEPWGLIAPSVLAAATRQDETHGTSTDNEV
FT                   IRSINDVTFPKRGPLSRTNSIDSKDPTLFPTVQEQVLKVSASTPASWKAAYEKGQAPHP
FT                   RLARRGTLPLDQEKSGMCPPGPSTLKDPASLKLLENDLYDLDIQPVGDPPNSMSLESGK
FT                   GPLDRKKLNSSHLSLFHGSRESLEVVPSTSPTSVRRRPPHLLERRGSGTLLLDRIAHTR
FT                   PGFLPPLNVNLNPPIPDIRASSKPASPLASGLKSMAPVAPNSPKRVDLRSKKKLLRRHS
FT                   MQIEQMKQLSDFEEIMA"
FT   assembly_gap    523664..524450
FT                   /estimated_length=787
FT                   /gap_type="unknown"
FT   gene            <584111..587374
FT                   /locus_tag="mCG_56928"
FT                   /note="gene_id=mCG56928.2"
FT   mRNA            join(<584111..584237,586977..587374)
FT                   /locus_tag="mCG_56928"
FT                   /product="mCG56928"
FT                   /note="gene_id=mCG56928.2 transcript_id=mCT57111.2 created
FT                   on 06-JUN-2002"
FT   CDS             join(<584111..584237,586977..587086)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56928"
FT                   /product="mCG56928"
FT                   /note="gene_id=mCG56928.2 transcript_id=mCT57111.2
FT                   protein_id=mCP33369.2"
FT                   /protein_id="EDL20896.1"
FT                   /translation="DWSSREAGLSPGPINGKSAPTGCVRPAAQPLGDYAGVEFWSNDAE
FT                   ETRGAVFDVRQSHAEVWRFYTGDRKHSSLPMSV"
FT   assembly_gap    599921..599940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            607080..644623
FT                   /locus_tag="mCG_7771"
FT                   /note="gene_id=mCG7771.2"
FT   mRNA            join(607080..607800,610979..611183,614172..614292,
FT                   636990..637099,638984..639059,644404..644623)
FT                   /locus_tag="mCG_7771"
FT                   /product="mCG7771"
FT                   /note="gene_id=mCG7771.2 transcript_id=mCT6963.1 created on
FT                   06-JUN-2002"
FT   CDS             join(607627..607800,610979..611089)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7771"
FT                   /product="mCG7771"
FT                   /note="gene_id=mCG7771.2 transcript_id=mCT6963.1
FT                   protein_id=mCP11573.1"
FT                   /protein_id="EDL20897.1"
FT                   /translation="MRINQEKRLTSRQSTKSSRKQEGLSWASICVNLQTPSTPPTAKAF
FT                   SDHKGAPASCFNITHGTYVCTCIWKPRLNGLLHCSRLSIFKTNSVTEPV"
FT   assembly_gap    665692..665711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            689569..805984
FT                   /gene="Rasgrf1"
FT                   /locus_tag="mCG_122247"
FT                   /note="gene_id=mCG122247.1"
FT   mRNA            join(689569..690067,703838..703947,724464..724617,
FT                   730651..730746,733544..733797,747091..747170,
FT                   749584..749777,750209..750318,753989..754107,
FT                   755908..756068,759987..760050,760841..760977,
FT                   763508..763590,770715..770963,773932..774308,
FT                   777934..778056,779982..780155,781073..781179,
FT                   781620..781732,783951..784011,788381..788484,
FT                   789503..789587,791868..792065,796144..796223,
FT                   799421..799538,800473..800541,805681..805984)
FT                   /gene="Rasgrf1"
FT                   /locus_tag="mCG_122247"
FT                   /product="RAS protein-specific guanine nucleotide-releasing
FT                   factor 1, transcript variant mCT123463"
FT                   /note="gene_id=mCG122247.1 transcript_id=mCT123463.1
FT                   created on 06-JUN-2002"
FT   mRNA            join(689569..690067,691243..691387,695300..696083)
FT                   /gene="Rasgrf1"
FT                   /locus_tag="mCG_122247"
FT                   /product="RAS protein-specific guanine nucleotide-releasing
FT                   factor 1, transcript variant mCT169837"
FT                   /note="gene_id=mCG122247.1 transcript_id=mCT169837.0
FT                   created on 06-JUN-2002"
FT   CDS             join(689792..690067,703838..703947,724464..724617,
FT                   730651..730746,733544..733797,747091..747170,
FT                   749584..749777,750209..750318,753989..754107,
FT                   755908..756068,759987..760050,760841..760977,
FT                   763508..763590,770715..770963,773932..774308,
FT                   777934..778056,779982..780155,781073..781179,
FT                   781620..781732,783951..784011,788381..788484,
FT                   789503..789587,791868..792065,796144..796223,
FT                   799421..799538,800473..800541,805681..805773)
FT                   /codon_start=1
FT                   /gene="Rasgrf1"
FT                   /locus_tag="mCG_122247"
FT                   /product="RAS protein-specific guanine nucleotide-releasing
FT                   factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG122247.1 transcript_id=mCT123463.1
FT                   protein_id=mCP68723.1 isoform=CRA_a"
FT                   /db_xref="GOA:B2RS27"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001331"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR019804"
FT                   /db_xref="InterPro:IPR023578"
FT                   /db_xref="InterPro:IPR030745"
FT                   /db_xref="MGI:MGI:99694"
FT                   /db_xref="UniProtKB/TrEMBL:B2RS27"
FT                   /protein_id="EDL20898.1"
FT                   /translation="MQKAIRLNDGHVVTLGLLAQKDGTRKGYLSKRSADNPKWQTKWFA
FT                   LLQNLLFYFESDSSPRPSGLYLLEGSICKRAPSPKRGTSSKESGEKQQHYFTVNFSNDS
FT                   QKTLELRTEDAKDCDEWVAAIARASYKILATEHEALMQKYLHLLQVVETEKTVAKQLRQ
FT                   QLEDGEVEIERLKTEVTITNLIKDNDRIQSSNKAGSADDEDSDIKKIKKVQSFLRGWLC
FT                   RRKWKNIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSK
FT                   KPPITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEF
FT                   VRNHQYSLQILAHCKQNRDFDKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHEL
FT                   LAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMITEGCEILLDTS
FT                   QTFVRQGSLMQMSLSEKSKSSRGRLGSLSTKKEGERQCFLFSKHLIICTRGSGGKLHLT
FT                   KNGVISLIDCTLLDEPENLDDEAKGAGPEIEHLEFKIGVEPKDSLPFTVILVASTRQEK
FT                   AAWTSDIIQCVDNIRCNGLMMNAFEENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCK
FT                   VLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTNAMVVLDKLINIYRKPMSAIP
FT                   ARSLELLFSSSHNAKLLYGDAPKSPRASRKFSSPPPLAIGTSSPSRRRKLSLNIPIITG
FT                   GKALELASLGCSSDSYANIHSPISPFGKTTLDTGKLCMASSLPKTPEEIDVPATIPEKP
FT                   GELSASRKHSSDVLKEESEDDQNHSDEDNTEVSPVKSPPTPKSFLNRTITEFPFFNYNN
FT                   GILMTTCRDLVDNNRSTLSATSAFAIATAGANEGPSNKEVFRRMSLANTGFSSDQRNID
FT                   KEFVIRRAATNRVLNVLRHWVTKHTQDFDTDDTLKYRVICFLEEVMHDPDLLTQERKAA
FT                   ANIIRTLTLEETTEQHSMLEEVILMTEGVKTEPFENHPALEIAEQLTLLDHLVFKSIPY
FT                   EEFFGQGWMKAEKYERTPYIMKTTKHFNHVSNFIASEIIRNEDISARASAIEKWVAVAD
FT                   ICRCLHNYNAVLEITSSINRSAIFRLKKTWLKVSKQTKSLLDKLQKLVSSDGRFKNLRE
FT                   SLRNCDPPCVPYLGMYLTDLVFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTTY
FT                   KIDPQPKVIQYLLDESFMLDEESLYESSLLIEPKLPT"
FT   CDS             join(689792..690067,691243..691387,695300..695415)
FT                   /codon_start=1
FT                   /gene="Rasgrf1"
FT                   /locus_tag="mCG_122247"
FT                   /product="RAS protein-specific guanine nucleotide-releasing
FT                   factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG122247.1 transcript_id=mCT169837.0
FT                   protein_id=mCP92507.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9QZR7"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR030745"
FT                   /db_xref="MGI:MGI:99694"
FT                   /db_xref="UniProtKB/TrEMBL:Q9QZR7"
FT                   /protein_id="EDL20899.1"
FT                   /translation="MQKAIRLNDGHVVTLGLLAQKDGTRKGYLSKRSADNPKWQTKWFA
FT                   LLQNLLFYFESDSSPRPSGLYLLEGSICKRAPSPKRGTSSKESGEKQRHSRSRRRRNVL
FT                   RRQPTRISKTFRLVAIELTGMTATLEVSFSIIRTEIGTVAPAPQTWMGKPEDLTTLRDR
FT                   VESKRLFHHPCRLII"
FT   assembly_gap    708948..708974
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    733032..733092
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    738478..738638
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    782913..782999
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    806230..806268
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   gene            812279..812883
FT                   /pseudo
FT                   /locus_tag="mCG_1032818"
FT                   /note="gene_id=mCG1032818.1"
FT   mRNA            812279..812883
FT                   /pseudo
FT                   /locus_tag="mCG_1032818"
FT                   /note="gene_id=mCG1032818.1 transcript_id=mCT150522.1
FT                   created on 06-JUN-2002"
FT   assembly_gap    818859..818902
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   gene            833352..855369
FT                   /gene="Ctsh"
FT                   /locus_tag="mCG_7939"
FT                   /note="gene_id=mCG7939.2"
FT   mRNA            join(833352..833684,839773..839804,840813..840918,
FT                   842011..842081,843445..843549,843799..843885,
FT                   844684..844739,846317..846398,847695..847763,
FT                   851109..851215,854148..854273,854962..855369)
FT                   /gene="Ctsh"
FT                   /locus_tag="mCG_7939"
FT                   /product="cathepsin H, transcript variant mCT6964"
FT                   /note="gene_id=mCG7939.2 transcript_id=mCT6964.2 created on
FT                   06-JUN-2002"
FT   CDS             join(833600..833684,839773..839804,840813..840918,
FT                   842011..842081,843445..843549,843799..843885,
FT                   844684..844739,846317..846398,847695..847763,
FT                   851109..851215,854148..854273,854962..855037)
FT                   /codon_start=1
FT                   /gene="Ctsh"
FT                   /locus_tag="mCG_7939"
FT                   /product="cathepsin H, isoform CRA_b"
FT                   /note="gene_id=mCG7939.2 transcript_id=mCT6964.2
FT                   protein_id=mCP11577.2 isoform=CRA_b"
FT                   /db_xref="GOA:P49935"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR013201"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR025661"
FT                   /db_xref="MGI:MGI:107285"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49935"
FT                   /protein_id="EDL20901.1"
FT                   /translation="MWAALPLLCAGAWLLSTGATAELTVNAIEKFHFKSWMKQHQKTYS
FT                   SVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATK
FT                   SNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACGSCWTFSTTGALESAVAIASGKMLSLA
FT                   EQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAF
FT                   VKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAV
FT                   LAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV"
FT   mRNA            join(<833609..833684,839773..839804,840813..840918,
FT                   842011..842081,843799..843885,844684..844739,
FT                   846317..846398,847695..847763,851109..851215,
FT                   854148..854273,854962..>855021)
FT                   /gene="Ctsh"
FT                   /locus_tag="mCG_7939"
FT                   /product="cathepsin H, transcript variant mCT191544"
FT                   /note="gene_id=mCG7939.2 transcript_id=mCT191544.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<833609..833684,839773..839804,840813..840918,
FT                   842011..842081,843799..843885,844684..844739,
FT                   846317..846398,847695..847763,851109..851215,
FT                   854148..854273,854962..>855021)
FT                   /codon_start=1
FT                   /gene="Ctsh"
FT                   /locus_tag="mCG_7939"
FT                   /product="cathepsin H, isoform CRA_a"
FT                   /note="gene_id=mCG7939.2 transcript_id=mCT191544.0
FT                   protein_id=mCP112513.0 isoform=CRA_a"
FT                   /protein_id="EDL20900.1"
FT                   /translation="ALPLLCAGAWLLSTGATAELTVNAIEKFHFKSWMKQHQKTYSSVE
FT                   YNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQGACGSCWTF
FT                   STTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEED
FT                   SYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMY
FT                   KSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNM
FT                   CGLAACASYP"
FT   assembly_gap    862610..862761
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            complement(870932..893921)
FT                   /locus_tag="mCG_7766"
FT                   /note="gene_id=mCG7766.2"
FT   mRNA            complement(join(870932..871663,872995..873079,
FT                   873616..873788,874365..874453,875747..875848,
FT                   876613..876701,877105..877130,879684..879764,
FT                   881541..881627,886470..886537,889361..889407,
FT                   893761..893921))
FT                   /locus_tag="mCG_7766"
FT                   /product="mCG7766, transcript variant mCT6960"
FT                   /note="gene_id=mCG7766.2 transcript_id=mCT6960.2 created on
FT                   06-JUN-2002"
FT   mRNA            complement(join(870932..871663,872995..873079,
FT                   873616..873788,874365..874453,875747..875848,
FT                   876613..876701,877105..877130,879684..879764,
FT                   881541..881627,882896..883012,886470..886537,
FT                   889361..889407,893761..893921))
FT                   /locus_tag="mCG_7766"
FT                   /product="mCG7766, transcript variant mCT169840"
FT                   /note="gene_id=mCG7766.2 transcript_id=mCT169840.0 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(871579..871663,872995..873079,
FT                   873616..873788,874365..874453,875747..875848,
FT                   876613..876701,877105..877130,879684..879764,
FT                   881541..881627,886470..886537,889361..889407,
FT                   893761..893800))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7766"
FT                   /product="mCG7766, isoform CRA_c"
FT                   /note="gene_id=mCG7766.2 transcript_id=mCT6960.2
FT                   protein_id=mCP11579.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q569V4"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR008676"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR025995"
FT                   /db_xref="InterPro:IPR026541"
FT                   /db_xref="MGI:MGI:1096551"
FT                   /db_xref="UniProtKB/TrEMBL:Q569V4"
FT                   /protein_id="EDL20904.1"
FT                   /translation="MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIH
FT                   YSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQK
FT                   NVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEE
FT                   LKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIK
FT                   EYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDE
FT                   KSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV"
FT   CDS             complement(join(871579..871663,872995..873079,
FT                   873616..873788,874365..874453,875747..875848,
FT                   876613..876701,877105..877130,879684..879764,
FT                   881541..881627,882896..883012,886470..886537,
FT                   889361..889407,893761..893800))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7766"
FT                   /product="mCG7766, isoform CRA_a"
FT                   /note="gene_id=mCG7766.2 transcript_id=mCT169840.0
FT                   protein_id=mCP92506.0 isoform=CRA_a"
FT                   /protein_id="EDL20902.1"
FT                   /translation="MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIH
FT                   YSGWNKKSAVRPRRSEKSLKTREDIVALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKY
FT                   VDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGG
FT                   STSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFY
FT                   LPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQY
FT                   AEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKN
FT                   SATLFSASDYEVAPPEYHRKAV"
FT   mRNA            complement(join(<874400..874453,875747..875848,
FT                   876613..876701,877105..877130,879684..879764,
FT                   881541..881627,893439..>893514))
FT                   /locus_tag="mCG_7766"
FT                   /product="mCG7766, transcript variant mCT191504"
FT                   /note="gene_id=mCG7766.2 transcript_id=mCT191504.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<874400..874453,875747..875848,
FT                   876613..876701,877105..877130,879684..879764,
FT                   881541..881627,893439..>893512))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7766"
FT                   /product="mCG7766, isoform CRA_b"
FT                   /note="gene_id=mCG7766.2 transcript_id=mCT191504.0
FT                   protein_id=mCP112512.0 isoform=CRA_b"
FT                   /protein_id="EDL20903.1"
FT                   /translation="RASALVCLFFRERRKSIEGRCPAGGWDEWVPESRVLKYVDTNLQK
FT                   QRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQ
FT                   PPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNV
FT                   DSILEDYA"
FT   assembly_gap    894494..894569
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   gene            898205..900110
FT                   /locus_tag="mCG_1032781"
FT                   /note="gene_id=mCG1032781.1"
FT   mRNA            join(898205..899540,899648..900110)
FT                   /locus_tag="mCG_1032781"
FT                   /product="mCG1032781"
FT                   /note="gene_id=mCG1032781.1 transcript_id=mCT150485.1
FT                   created on 14-AUG-2002"
FT   CDS             898263..899138
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032781"
FT                   /product="mCG1032781"
FT                   /note="gene_id=mCG1032781.1 transcript_id=mCT150485.1
FT                   protein_id=mCP68899.1"
FT                   /protein_id="EDL20905.1"
FT                   /translation="MAKGRVADRSPTEMLHSTPAGDRAVRTQGSAAPGSKDHLNEKPCA
FT                   EAGSARTSLLILVSIFSCAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSK
FT                   YKDTFYVQILVAYFATYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFC
FT                   YMLSYLVGRPVVYKYLTEKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVI
FT                   NVPLKVFFIGTFLGVAPPSFVAIKAGTTLYQLTTAGEAVSWSSVFILMVLTLLSILPAI
FT                   FQKKLKQKFE"
FT   assembly_gap    899545..899635
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    904707..904726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    907599..907822
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    908950..908969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    910411..910430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    915498..915572
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    925972..926158
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   gene            complement(934421..>937777)
FT                   /locus_tag="mCG_144694"
FT                   /note="gene_id=mCG144694.0"
FT   mRNA            complement(934421..>937777)
FT                   /locus_tag="mCG_144694"
FT                   /product="mCG144694"
FT                   /note="gene_id=mCG144694.0 transcript_id=mCT184118.1
FT                   created on 25-AUG-2003"
FT   CDS             complement(935915..>936241)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144694"
FT                   /product="mCG144694"
FT                   /note="gene_id=mCG144694.0 transcript_id=mCT184118.1
FT                   protein_id=mCP105885.0"
FT                   /protein_id="EDL20906.1"
FT                   /translation="SQHLGGRGRRISEFEASLVYKVSSRTARAIQRNPVSKRQKKKTKQ
FT                   KGDSIIYPLFYYSFNIPISPFFFSTPLSLHKKESVEHRFLIPGSWFCAPRWVTDIKVTF
FT                   IHLK"
FT   assembly_gap    940317..940854
FT                   /estimated_length=538
FT                   /gap_type="unknown"
FT   assembly_gap    947510..947669
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   gene            <949503..978144
FT                   /gene="Adamts7"
FT                   /locus_tag="mCG_7768"
FT                   /note="gene_id=mCG7768.2"
FT   mRNA            join(<949503..949858,951693..951858,952615..952721,
FT                   955855..955938,956225..956349,957405..957554,
FT                   958706..958852,963789..963933,964512..964604,
FT                   964974..965119,966321..966490,966711..966844,
FT                   967671..967791,968899..969143,969416..969551,
FT                   969887..970013,970432..970645,970950..972320,
FT                   973209..973361,973728..973901,973982..974128,
FT                   975051..975213,977764..978144)
FT                   /gene="Adamts7"
FT                   /locus_tag="mCG_7768"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 7"
FT                   /note="gene_id=mCG7768.2 transcript_id=mCT6961.2 created on
FT                   06-JUN-2002"
FT   CDS             join(<949505..949858,951693..951858,952615..952721,
FT                   955855..955938,956225..956349,957405..957554,
FT                   958706..958852,963789..963933,964512..964604,
FT                   964974..965119,966321..966490,966711..966844,
FT                   967671..967791,968899..969143,969416..969551,
FT                   969887..970013,970432..970645,970950..972320,
FT                   973209..973361,973728..973901,973982..974128,
FT                   975051..975213,977764..977921)
FT                   /codon_start=1
FT                   /gene="Adamts7"
FT                   /locus_tag="mCG_7768"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 7"
FT                   /note="gene_id=mCG7768.2 transcript_id=mCT6961.2
FT                   protein_id=mCP11576.2"
FT                   /protein_id="EDL20907.1"
FT                   /translation="LVTEGRAGLDIVHPVRVDAGGSFLSYELWPRVLRKRDVSTTQASS
FT                   AFYQLQYQGRELLFNLTTNPYLMAPGFVSEIRRHSTLGHAHIQTSVPTCHLLGDVQDPE
FT                   LEGGFAAISACDGLRGVFQLSNEDYFIEPLDGVSAQPGHAQPHVVYKHQGSRKQAQQGD
FT                   SRPSGTCGMQVSKEKWVETLVVADSKMVEYHGQPQVESYVLTIMNMVAGLFHDPSIGNP
FT                   IHISIVRLIILEDEEKDLKITHHAEETLKNFCRWQKNINIKGDDHPQHHDTAILLTRKD
FT                   LCASMNQPCETLGLSHVSGLCHPQLSCSVSEDTGMPLAFTVAHELGHSFGIQHDGTGND
FT                   CESIGKRPFIMSPQLLYDRGIPLTWSRCSREYITRFLDRGWGLCLDDRPSKDVIALPSV
FT                   LPGVLYDVNHQCRLQYGSHSAYCEDMDDVCHTLWCSVGTTCHSKLDAAVDGTSCGKNKW
FT                   CLKGECVPEGFQPEAVDGGWSGWSAWSDCSRSCGVGVRSSERQCTQPVPKNRGKYCVGE
FT                   RKRSQLCNLPACPPDRPSFRHTQCSQFDGMLYKGKLHKWVPVPNDDNPCELHCRPSNSS
FT                   NTEKLRDAVVDGTPCYQSRISRDICLNGICKNVGCDFVIDSGAEEDRCGVCRGDGSTCQ
FT                   TVSRTFKETEGQGYVDIGLIPAGAREILIEEVAEAANFLALRSEDPDKYFLNGGWTIQW
FT                   NGDYRVAGTTFTYARKGNWENLTSPGPTSEPVWIQLLFQEKNPGVHYQYTIQRDSHDQV
FT                   RPPEFSWHYGPWSKCTVTCGTGVQRQSLYCMERQAGVVAEEYCNTLNRPDERQRKCSEE
FT                   PCPPRWWAGEWQPCSRSCGPEGLSRRAVFCIRSMGLDEQRALELSACEHLPRPLAETPC
FT                   NRHVICPSTWGVGNWSQCSVTCGAGIRQRSVLCINNTDVPCDEAERPITETFCFLQPCQ
FT                   YPMYIVDTGASGSGSSSPELFNEVDFIPNQLAPRPSPASSPKPVSISNAIDEEELDPPG
FT                   PVFVDDFYYDYNFINFHEDLSYGSFEEPHPDLVDNGGWTAPPHIRPTESPSDTPVPTAG
FT                   ALGAEAEDIQGSWSPSPLLSEASYSPPVLEQTSINPLANFLTEEDTPMGAPELGFPSLP
FT                   WPPASVDDMMTPVGPGNPDELLVKEDEQSPPSTPWSDRNKLSTDGNPLGHTSPALPQSP
FT                   IPTQPSPPSISPTQASPSPDVVEVSTGWNVAWDPVLEADLKPGHGELPSTVEVASPPLL
FT                   PMATVPGIWGRDSPLEPGTPTFSSPELSSQHLKTLTMPGTLLLTVPTDLRSPGPSGQPQ
FT                   TPNLEGTQSPGLLPTPARETQTNSSKDPEVQPLQPSLEEDGDPADPLPARNASWQVGNW
FT                   SQCSTTCGLGAIWRLVSCSSGNDEDCTLASRPQPARHCHLRPCAAWRTGNWSKCSRNCG
FT                   GGSSTRDVQCVDTRDLRPLRPFHCQPGPTKPPNRQLCGTQPCLPWYTSSWRECSEACGG
FT                   GEQQRLVTCPEPGLCEESLRPNNSRPCNTHPCTQWVVGPWGQCSAPCGGGVQRRLVRCV
FT                   NTQTGLAEEDSDLCSHEAWPESSRPCATEDCELVEPPRCERDRLSFNFCETLRLLGRCQ
FT                   LPTIRAQCCRSCPPLSRGVPSRGHQRVARR"
FT   gene            complement(980112..1048967)
FT                   /gene="Tbc1d2b"
FT                   /locus_tag="mCG_140508"
FT                   /note="gene_id=mCG140508.1"
FT   mRNA            complement(join(980112..983272,985823..985944,
FT                   987718..987903,993531..993648,996713..997207,
FT                   1000360..1000553,1001492..1001602,1004073..1004456,
FT                   1005382..1005626,1006995..1007158,1019088..1019256,
FT                   1027870..1028023,1048437..1048527,1048844..1048967))
FT                   /gene="Tbc1d2b"
FT                   /locus_tag="mCG_140508"
FT                   /product="TBC1 domain family, member 2B"
FT                   /note="gene_id=mCG140508.1 transcript_id=mCT169836.1
FT                   created on 04-JUN-2003"
FT   CDS             complement(join(983077..983272,985823..985944,
FT                   987718..987903,993531..993648,996713..997207,
FT                   1000360..1000553,1001492..1001602,1004073..1004456,
FT                   1005382..1005626,1006995..1007158,1019088..1019256,
FT                   1027870..1028005))
FT                   /codon_start=1
FT                   /gene="Tbc1d2b"
FT                   /locus_tag="mCG_140508"
FT                   /product="TBC1 domain family, member 2B"
FT                   /note="gene_id=mCG140508.1 transcript_id=mCT169836.1
FT                   protein_id=mCP92503.1"
FT                   /protein_id="EDL20908.1"
FT                   /translation="MTYWLQELQQKRWEYCNSLDMMKWDSRTSPTPGDFPKGLVARDTT
FT                   DIISQHPNPSAEKARTVLAVEAAPGELVGDRAAHQPAPGHPNPINFYSLKQWGNELKNS
FT                   MSSFRPGRGHSESRRTVFYTNEEWELLDPPPKDLEESLVPEERKKPMPEGSKGVASSGF
FT                   PFEFGRNPYKGKRPLKDIIGSYKNRHSSSDPLLEGTATSSGSSGGPTKPVPEMQLQIQS
FT                   QQEELEQLKKDLSSQKELIRLLQQTVRSSQYDKYFTNPQISQGVPGDTLELLHQKDEQI
FT                   LGLSGQLERFGLEKESLQQEVRTLKSKVGELNERLGMLMETIQAKDEVIIKLSACEGSV
FT                   SSPTLGPSSPLAIPASKDQLELDRLKDSLQGYKSQNKFLNKEILELSALRRNAERRERD
FT                   LMAKYSSLEAKLCQVESKYLILLQEMKTPVCSEEQGPARDVIAQLLEDALQVESQEQPE
FT                   QAFVKPHLVSEFDIYGFRTVPDDDEEEKLVAKVRALDLKTLYLTDNQEVSTGVKWENYF
FT                   ASTMNREMACSPELKNLIRAGIPHEHRSKVWKWCVDRHTRKFKDSMEPDYFQTLLQKAL
FT                   EKQNPASKQIELDLLRTLPNNKHYSSPTSEGIQKLRSVLLAFSWRNPDIGYCQGLNRLV
FT                   AVALLYLDQEDAFWCLVTIVEVFMPRDYYTKTLLGSQVDQRVFRDLLSEKLPRLHTHFE
FT                   QYKVDYTLITFNWFLVVFVDSVVSDILFKIWDSFLYEGPKVIFRFALALFKYKEEEILK
FT                   LQDSMSIFKYLRYFTRTILDARKLISISFGDLNPFPLRQIRNRRAYHLEKVRLELTELE
FT                   AIREDFLRERDTSPDKGELVSDEEEDT"
FT   gene            complement(999303..999723)
FT                   /pseudo
FT                   /locus_tag="mCG_7767"
FT                   /note="gene_id=mCG7767.1"
FT   mRNA            complement(999303..999723)
FT                   /pseudo
FT                   /locus_tag="mCG_7767"
FT                   /note="gene_id=mCG7767.1 transcript_id=mCT6969.1 created on
FT                   06-JUN-2002"
FT   assembly_gap    1009471..1009490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1046874..1046893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1048546..1048843
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    1051888..1051907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1060328..1060347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1062919..1063087
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    1072600..1072619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1075849..1076411
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    1112121..1112292
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    1118184..1118203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1119445..1119464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1122533..1124077
FT                   /estimated_length=1545
FT                   /gap_type="unknown"
FT   assembly_gap    1126224..1128173
FT                   /estimated_length=1950
FT                   /gap_type="unknown"
FT   assembly_gap    1145301..1145320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1152953..1153136
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    1195248..1195267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1236783..1236831
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    1292826..1292845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1314361..1316020
FT                   /estimated_length=1660
FT                   /gap_type="unknown"
FT   assembly_gap    1328335..1330216
FT                   /estimated_length=1882
FT                   /gap_type="unknown"
FT   assembly_gap    1360747..1360888
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    1434005..1434024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1450729..1450927
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   gene            complement(1511524..1512113)
FT                   /pseudo
FT                   /locus_tag="mCG_50289"
FT                   /note="gene_id=mCG50289.2"
FT   mRNA            complement(1511524..1512113)
FT                   /pseudo
FT                   /locus_tag="mCG_50289"
FT                   /note="gene_id=mCG50289.2 transcript_id=mCT50472.2 created
FT                   on 07-JUN-2002"
FT   gene            complement(1512713..1512963)
FT                   /pseudo
FT                   /locus_tag="mCG_1032782"
FT                   /note="gene_id=mCG1032782.1"
FT   mRNA            complement(1512713..1512963)
FT                   /pseudo
FT                   /locus_tag="mCG_1032782"
FT                   /note="gene_id=mCG1032782.1 transcript_id=mCT150486.1
FT                   created on 07-JUN-2002"
FT   assembly_gap    1514661..1514680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1524823..1524933
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   gene            complement(1525809..1526105)
FT                   /pseudo
FT                   /locus_tag="mCG_1032823"
FT                   /note="gene_id=mCG1032823.1"
FT   mRNA            complement(1525809..1526105)
FT                   /pseudo
FT                   /locus_tag="mCG_1032823"
FT                   /note="gene_id=mCG1032823.1 transcript_id=mCT150527.1
FT                   created on 07-JUN-2002"
FT   gene            complement(1526900..1527108)
FT                   /pseudo
FT                   /locus_tag="mCG_1032824"
FT                   /note="gene_id=mCG1032824.1"
FT   mRNA            complement(1526900..1527108)
FT                   /pseudo
FT                   /locus_tag="mCG_1032824"
FT                   /note="gene_id=mCG1032824.1 transcript_id=mCT150528.1
FT                   created on 07-JUN-2002"
FT   assembly_gap    1549741..1552460
FT                   /estimated_length=2720
FT                   /gap_type="unknown"
FT   assembly_gap    1553996..1554015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1574169..1574188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1578254..1578346
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    1585055..1585074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1597459..>1603114)
FT                   /locus_tag="mCG_145339"
FT                   /note="gene_id=mCG145339.0"
FT   mRNA            complement(join(1597459..1598272,1601708..1601944,
FT                   1603007..>1603114))
FT                   /locus_tag="mCG_145339"
FT                   /product="mCG145339"
FT                   /note="gene_id=mCG145339.0 transcript_id=mCT184763.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(1597794..>1598096)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145339"
FT                   /product="mCG145339"
FT                   /note="gene_id=mCG145339.0 transcript_id=mCT184763.0
FT                   protein_id=mCP105887.0"
FT                   /protein_id="EDL20909.1"
FT                   /translation="DFTVSHWTLYHSKCVNVKISPPSLSILARISTSVLSGMIPSGVNL
FT                   RFLEFFEIKHLRNVASEQWKFFSGSIVWTFFFQDFCFLPCKVFLKTTEMQQIRGV"
FT   assembly_gap    1598508..1598668
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    1600125..1600144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1609536..1609555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1613925..1614951
FT                   /estimated_length=1027
FT                   /gap_type="unknown"
FT   assembly_gap    1631189..1631208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1658662..1658814
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    1665495..1665514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1673897..1674278)
FT                   /pseudo
FT                   /locus_tag="mCG_1032783"
FT                   /note="gene_id=mCG1032783.1"
FT   mRNA            complement(1673897..1674278)
FT                   /pseudo
FT                   /locus_tag="mCG_1032783"
FT                   /note="gene_id=mCG1032783.1 transcript_id=mCT150487.1
FT                   created on 07-JUN-2002"
FT   assembly_gap    1695493..1696436
FT                   /estimated_length=944
FT                   /gap_type="unknown"
FT   assembly_gap    1699446..1699465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1701351..1701831
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    1707027..1707389
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    1716886..1716905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1738956..1740443
FT                   /estimated_length=1488
FT                   /gap_type="unknown"
FT   assembly_gap    1792770..1792889
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    1806718..1806737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1808890..1808909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1810632..1810651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1856878..1858478
FT                   /pseudo
FT                   /locus_tag="mCG_4263"
FT                   /note="gene_id=mCG4263.1"
FT   mRNA            1856878..1858478
FT                   /pseudo
FT                   /locus_tag="mCG_4263"
FT                   /note="gene_id=mCG4263.1 transcript_id=mCT3059.1 created on
FT                   07-JUN-2002"
FT   assembly_gap    1859115..1859700
FT                   /estimated_length=586
FT                   /gap_type="unknown"
FT   assembly_gap    1925140..1925729
FT                   /estimated_length=590
FT                   /gap_type="unknown"
FT   assembly_gap    1930273..1930317
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    1969181..1969241
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    1974477..1974717
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   gene            1975845..1976378
FT                   /pseudo
FT                   /locus_tag="mCG_1032763"
FT                   /note="gene_id=mCG1032763.1"
FT   mRNA            1975845..1976378
FT                   /pseudo
FT                   /locus_tag="mCG_1032763"
FT                   /note="gene_id=mCG1032763.1 transcript_id=mCT150467.1
FT                   created on 07-JUN-2002"
FT   assembly_gap    1977936..1984617
FT                   /estimated_length=6682
FT                   /gap_type="unknown"
FT   assembly_gap    1986434..1991880
FT                   /estimated_length=5447
FT                   /gap_type="unknown"
FT   assembly_gap    2021241..2024236
FT                   /estimated_length=2996
FT                   /gap_type="unknown"
FT   assembly_gap    2027368..2027387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2028757..2028776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2032140..2032159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2039341..2039360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2040599..2040618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2047538..2047557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2048980..2048999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2050297..2050316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2053568..2053587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2055263..2055282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2056353..2056372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2064033..2064490
FT                   /estimated_length=458
FT                   /gap_type="unknown"
FT   assembly_gap    2065987..2066006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2067094..2067426
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    2084903..2084922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2100040..2100113
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    2102904..2108335
FT                   /estimated_length=5432
FT                   /gap_type="unknown"
FT   assembly_gap    2110766..2110785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2115331..2122643)
FT                   /gene="Zic1"
FT                   /locus_tag="mCG_68156"
FT                   /note="gene_id=mCG68156.2"
FT   mRNA            complement(join(2115331..2116619,2117312..2117475,
FT                   2118884..2120335,2122587..2122643))
FT                   /gene="Zic1"
FT                   /locus_tag="mCG_68156"
FT                   /product="zinc finger protein of the cerebellum 1"
FT                   /note="gene_id=mCG68156.2 transcript_id=mCT68342.2 created
FT                   on 11-JUN-2002"
FT   assembly_gap    2115843..2115862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(2116422..2116619,2117312..2117475,
FT                   2118884..2119865))
FT                   /codon_start=1
FT                   /gene="Zic1"
FT                   /locus_tag="mCG_68156"
FT                   /product="zinc finger protein of the cerebellum 1"
FT                   /note="gene_id=mCG68156.2 transcript_id=mCT68342.2
FT                   protein_id=mCP43350.2 partial"
FT                   /db_xref="GOA:P46684"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:106683"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46684"
FT                   /protein_id="EDL20910.1"
FT                   /translation="MLLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMG
FT                   AFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFNSTRDFLFRN
FT                   RGFGDAAAAASAQHSLFAASAGGFGGPHGHTDAAGHLLFSGLHEQAAGHASPNVVNGQM
FT                   RLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGAGAFFRYMRQPIK
FT                   QELICKWIEPEQLANPKKSCNKTFSTMHELVTHVTVEHVGGPEQSNHICFWEECPREGK
FT                   PFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCD
FT                   RRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSSQGSQPSPAASS
FT                   GYESSTPPTIVSPTTDNPTTSSMSPSSSAVHHTAGHSALSSNFNEWYV"
FT   assembly_gap    2120341..2120608
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    2121017..2121242
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   gene            2123457..2142820
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /note="gene_id=mCG4264.2"
FT   mRNA            join(2123457..2123525,2127237..2127321,2133495..2134112,
FT                   2138660..2138975,2141197..2142820)
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4,
FT                   transcript variant mCT170017"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170017.0 created
FT                   on 12-JUN-2002"
FT   mRNA            join(2123601..2123857,2127237..2127321,2133495..2134112,
FT                   2138660..2138975,2141197..2142820)
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4,
FT                   transcript variant mCT170016"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170016.0 created
FT                   on 12-JUN-2002"
FT   mRNA            join(2124802..2125455,2127237..2127321,2133495..2134112,
FT                   2138660..2138975,2141197..2142820)
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4,
FT                   transcript variant mCT170019"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170019.0 created
FT                   on 12-JUN-2002"
FT   mRNA            join(2125633..2125738,2127237..2127321,2133495..2134112,
FT                   2138660..2138975,2141197..2142820)
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4,
FT                   transcript variant mCT170020"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170020.0 created
FT                   on 12-JUN-2002"
FT   CDS             join(2127252..2127321,2133495..2134112,2138660..2138975,
FT                   2141197)
FT                   /codon_start=1
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170016.0
FT                   protein_id=mCP92501.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3UYE7"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:107201"
FT                   /db_xref="UniProtKB/TrEMBL:G3UYE7"
FT                   /protein_id="EDL20911.1"
FT                   /translation="MKYKTSLVMRKRLRLYRNTLKESSSSCGHHGPQLAASSNPSVLPG
FT                   LHEQPPQASHSRPLNGLLRLGIPGDMYARSEPFAPGPMARSDTLATATALHGYGGMNLT
FT                   MNLTAPHGPGAFFRYMRQPIKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHV
FT                   GGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLK
FT                   IHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSL
FT                   RKHMKVHGRSPPPSSGYDSAITSALASPSLESGREPSVACSAAVVVRGTDVSE"
FT   CDS             join(2127252..2127321,2133495..2134112,2138660..2138975,
FT                   2141197)
FT                   /codon_start=1
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170017.0
FT                   protein_id=mCP92504.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3UYE7"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:107201"
FT                   /db_xref="UniProtKB/TrEMBL:G3UYE7"
FT                   /protein_id="EDL20912.1"
FT                   /translation="MKYKTSLVMRKRLRLYRNTLKESSSSCGHHGPQLAASSNPSVLPG
FT                   LHEQPPQASHSRPLNGLLRLGIPGDMYARSEPFAPGPMARSDTLATATALHGYGGMNLT
FT                   MNLTAPHGPGAFFRYMRQPIKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHV
FT                   GGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLK
FT                   IHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSL
FT                   RKHMKVHGRSPPPSSGYDSAITSALASPSLESGREPSVACSAAVVVRGTDVSE"
FT   CDS             join(2127252..2127321,2133495..2134112,2138660..2138975,
FT                   2141197)
FT                   /codon_start=1
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170019.0
FT                   protein_id=mCP92508.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3UYE7"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:107201"
FT                   /db_xref="UniProtKB/TrEMBL:G3UYE7"
FT                   /protein_id="EDL20914.1"
FT                   /translation="MKYKTSLVMRKRLRLYRNTLKESSSSCGHHGPQLAASSNPSVLPG
FT                   LHEQPPQASHSRPLNGLLRLGIPGDMYARSEPFAPGPMARSDTLATATALHGYGGMNLT
FT                   MNLTAPHGPGAFFRYMRQPIKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHV
FT                   GGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLK
FT                   IHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSL
FT                   RKHMKVHGRSPPPSSGYDSAITSALASPSLESGREPSVACSAAVVVRGTDVSE"
FT   CDS             join(2127252..2127321,2133495..2134112,2138660..2138975,
FT                   2141197)
FT                   /codon_start=1
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170020.0
FT                   protein_id=mCP92502.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3UYE7"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:107201"
FT                   /db_xref="UniProtKB/TrEMBL:G3UYE7"
FT                   /protein_id="EDL20915.1"
FT                   /translation="MKYKTSLVMRKRLRLYRNTLKESSSSCGHHGPQLAASSNPSVLPG
FT                   LHEQPPQASHSRPLNGLLRLGIPGDMYARSEPFAPGPMARSDTLATATALHGYGGMNLT
FT                   MNLTAPHGPGAFFRYMRQPIKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHV
FT                   GGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLK
FT                   IHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSL
FT                   RKHMKVHGRSPPPSSGYDSAITSALASPSLESGREPSVACSAAVVVRGTDVSE"
FT   assembly_gap    2132555..2132961
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   mRNA            join(2132962..2134112,2138660..2139044)
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4,
FT                   transcript variant mCT3060"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT3060.1 created on
FT                   12-JUN-2002"
FT   CDS             join(2133404..2134112,2138660..2139012)
FT                   /codon_start=1
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT3060.1
FT                   protein_id=mCP18364.1 isoform=CRA_c"
FT                   /protein_id="EDL20916.1"
FT                   /translation="MRLGRVCPRGPGKVRSPRHRFSCTLFVSTTGSSCGHHGPQLAASS
FT                   NPSVLPGLHEQPPQASHSRPLNGLLRLGIPGDMYARSEPFAPGPMARSDTLATATALHG
FT                   YGGMNLTMNLTAPHGPGAFFRYMRQPIKQELICKWLGDDSPMSPRPCSKTFSTMHELVT
FT                   HVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVF
FT                   ARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKC
FT                   YTHPSSLRKHMKVHGRSPPPSSGYDSAITSALASPSLESGREPSVACSAAVVVRGTDVS
FT                   EWYVCSGAWTSGG"
FT   assembly_gap    2136596..2136615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(2137054..2137129,2138660..2138975,2141197..2142820)
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4,
FT                   transcript variant mCT170018"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170018.0 created
FT                   on 12-JUN-2002"
FT   CDS             join(2137072..2137129,2138660..2138975,2141197)
FT                   /codon_start=1
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170018.0
FT                   protein_id=mCP92510.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C5L0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C5L0"
FT                   /protein_id="EDL20913.1"
FT                   /translation="MAAGNIFQRTLVYQLYYREGEKPFRCEFEGCERRFANSSDRKKHS
FT                   HVHTSDKPYMCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSAITSALASPSLESG
FT                   REPSVACSAAVVVRGTDVSE"
FT   assembly_gap    2149058..2149338
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    2150017..2150190
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    2188676..2188842
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    2191337..2191739
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    2213573..2213784
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    2233862..2234024
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    2247222..2247241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2252423..2252442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2255172..2255191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2304623..2304857
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    2320760..2320779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2336634..2336653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2349713..2349907
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    2351278..2351297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2362669..2362824
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    2374492..2385162
FT                   /estimated_length=10671
FT                   /gap_type="unknown"
FT   assembly_gap    2388272..2392193
FT                   /estimated_length=3922
FT                   /gap_type="unknown"
FT   assembly_gap    2455816..2455905
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    2461960..2461990
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   gene            2470559..2470895
FT                   /pseudo
FT                   /locus_tag="mCG_1032784"
FT                   /note="gene_id=mCG1032784.1"
FT   mRNA            2470559..2470895
FT                   /pseudo
FT                   /locus_tag="mCG_1032784"
FT                   /note="gene_id=mCG1032784.1 transcript_id=mCT150488.1
FT                   created on 12-JUN-2002"
FT   assembly_gap    2483513..2483532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2492236..2493009
FT                   /estimated_length=774
FT                   /gap_type="unknown"
FT   assembly_gap    2494330..2494349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2496504..2496523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2503310..2503515
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    2534210..2535265
FT                   /estimated_length=1056
FT                   /gap_type="unknown"
FT   assembly_gap    2552414..2552433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2555188..2555207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2557095..2557540
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    2597369..2597388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2643903..2644196
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    2669220..2669624
FT                   /estimated_length=405
FT                   /gap_type="unknown"
FT   assembly_gap    2701962..2701981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2741636..2741655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2742716..2742735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2749899..2749918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2750995..2751014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2752508..2752527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2753405..2753424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2754460..2754479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2756753..2756772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2768577..2768800
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    2789809..2789969
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    2823801..2823820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2844321..2844467
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    2863452..2864477
FT                   /estimated_length=1026
FT                   /gap_type="unknown"
FT   assembly_gap    2895418..2895437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2907010..2907029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2924869..2924888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2951814..2952012
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   gene            2954668..2959350
FT                   /pseudo
FT                   /locus_tag="mCG_17677"
FT                   /note="gene_id=mCG17677.1"
FT   mRNA            join(2954668..2954728,2955612..2955836,2956839..2956996,
FT                   2959189..2959350)
FT                   /pseudo
FT                   /locus_tag="mCG_17677"
FT                   /note="gene_id=mCG17677.1 transcript_id=mCT14798.1 created
FT                   on 12-JUN-2002"
FT   assembly_gap    2964303..2964322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2974647..2974918
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   gene            3000990..3023768
FT                   /locus_tag="mCG_17676"
FT                   /note="gene_id=mCG17676.2"
FT   mRNA            join(3000990..3001600,3009259..3009285,3010485..3010565,
FT                   3014244..3014488,3015857..3015899,3017602..3017822,
FT                   3017923..3018084,3021026..3021187,3022736..3023768)
FT                   /locus_tag="mCG_17676"
FT                   /product="mCG17676"
FT                   /note="gene_id=mCG17676.2 transcript_id=mCT14797.1 created
FT                   on 12-JUN-2002"
FT   CDS             join(3009273..3009285,3010485..3010565,3014244..3014488,
FT                   3015857..3015899,3017602..3017822,3017923..3018084,
FT                   3021026..3021187,3022736..3022795)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17676"
FT                   /product="mCG17676"
FT                   /note="gene_id=mCG17676.2 transcript_id=mCT14797.1
FT                   protein_id=mCP21276.1"
FT                   /protein_id="EDL20917.1"
FT                   /translation="MENHSKQTEAPHPGTYMPAGYPPPYPPAAFQGPSDHAAYPIPQAG
FT                   YQGPPGPYPGPQPGYPVPPGGYAGGGPSGFPVQNQPAYNHPGGPGGTPWMPAPPPPLNC
FT                   PPGLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCC
FT                   GASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVPVGYVTQTWHPC
FT                   LPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFELKSLDEESVVGKISKQWSGFVREAFT
FT                   DADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGAWQ"
FT   gene            3026902..3049312
FT                   /gene="Plscr2"
FT                   /locus_tag="mCG_17683"
FT                   /note="gene_id=mCG17683.2"
FT   mRNA            join(3026902..3027236,3033698..3033778,3039152..3039384,
FT                   3041243..3041285,3042219..3042439,3042557..3042718,
FT                   3047100..3047261,3048757..3049312)
FT                   /gene="Plscr2"
FT                   /locus_tag="mCG_17683"
FT                   /product="phospholipid scramblase 2"
FT                   /note="gene_id=mCG17683.2 transcript_id=mCT14803.2 created
FT                   on 17-JUN-2002"
FT   assembly_gap    3031384..3031403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(3033706..3033778,3039152..3039384,3041243..3041285,
FT                   3042219..3042439,3042557..3042718,3047100..3047261,
FT                   3048757..3048786)
FT                   /codon_start=1
FT                   /gene="Plscr2"
FT                   /locus_tag="mCG_17683"
FT                   /product="phospholipid scramblase 2"
FT                   /note="gene_id=mCG17683.2 transcript_id=mCT14803.2
FT                   protein_id=mCP21356.2"
FT                   /db_xref="GOA:Q9DCW2"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="MGI:MGI:1270860"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCW2"
FT                   /protein_id="EDL20918.1"
FT                   /translation="MEAPRSGTYLPAGYAPQYPPAAVQGPPEHTGRPTFQTNYQVPQSG
FT                   YPGPQASYTVSTSGHEGYAATRLPIQNNQTIVLANTQWMPAPPPILNCPPGLEYLNQID
FT                   QLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRIL
FT                   DHLGQEVMTLERPLKCSSCCFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKR
FT                   ENVLKVVGPCVACTCCSDIDFEIKSLDEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPL
FT                   DLEVKMKAVTLGACFLIDYMFFEGCE"
FT   assembly_gap    3058740..3058759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3060983..3116631
FT                   /locus_tag="mCG_17678"
FT                   /note="gene_id=mCG17678.2"
FT   mRNA            join(3060983..3061038,3096444..3096676,3100805..3100847,
FT                   3108230..3108450,3111299..3111460,3113305..3113466,
FT                   3116457..3116631)
FT                   /locus_tag="mCG_17678"
FT                   /product="mCG17678, transcript variant mCT14799"
FT                   /note="gene_id=mCG17678.2 transcript_id=mCT14799.2 created
FT                   on 17-JUN-2002"
FT   mRNA            join(3060983..3061038,3077985..3078093,3078178..3078745)
FT                   /locus_tag="mCG_17678"
FT                   /product="mCG17678, transcript variant mCT170121"
FT                   /note="gene_id=mCG17678.2 transcript_id=mCT170121.0 created
FT                   on 17-JUN-2002"
FT   CDS             join(3061006..3061038,3077985..3078093,3078178..3078335)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17678"
FT                   /product="mCG17678, isoform CRA_b"
FT                   /note="gene_id=mCG17678.2 transcript_id=mCT170121.0
FT                   protein_id=mCP93086.0 isoform=CRA_b"
FT                   /protein_id="EDL20920.1"
FT                   /translation="MKASLPSITSKILRISLLNLSESSARTPFQLRLYHTWQPFACCFS
FT                   CSGPAWDSNLLRPASGSHVWVRAWKASWNLEEKTESRRREKGWNQDNSLIRVQF"
FT   assembly_gap    3085440..3086171
FT                   /estimated_length=732
FT                   /gap_type="unknown"
FT   CDS             join(3096620..3096676,3100805..3100847,3108230..3108450,
FT                   3111299..3111460,3113305..3113466,3116457..3116510)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17678"
FT                   /product="mCG17678, isoform CRA_a"
FT                   /note="gene_id=mCG17678.2 transcript_id=mCT14799.2
FT                   protein_id=mCP21296.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V0U0"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="MGI:MGI:1925709"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V0U0"
FT                   /protein_id="EDL20919.1"
FT                   /translation="MAINTTSYGVPPGLEYLLHIDHIMIQQQFEFVEAVLGFETANRYK
FT                   INDKLGQKVYYAAEDFNFLTLNCCGAIRPFTMRIFDNSGREVITLRRPLRCDCCCCPCC
FT                   LQQIEIQAPPGVPVGYVIQTWHPCRPKFTVQNEEKQDVLKIIGPICVCNIGGSIDFEIK
FT                   SLDEEFVVGRISKHWSGILKEILTDVDTFGIQFPLDLDVKMKAVMLGACFLIDFMFFES
FT                   GGGQRPKLFW"
FT   assembly_gap    3103191..3103210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3104415..3104434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3108741..3108760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3172475..3172563
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    3178298..3178317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3183928..3183947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3190409..3190428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3205445..3240715
FT                   /gene="Plscr4"
FT                   /locus_tag="mCG_17679"
FT                   /note="gene_id=mCG17679.2"
FT   mRNA            join(3205445..3205992,3219721..3219748,3220902..3221012,
FT                   3230612..3230835,3231749..3231791,3232648..3232874,
FT                   3236793..3236954,3238152..3238310,3238960..3240715)
FT                   /gene="Plscr4"
FT                   /locus_tag="mCG_17679"
FT                   /product="phospholipid scramblase 4"
FT                   /note="gene_id=mCG17679.2 transcript_id=mCT14800.2 created
FT                   on 20-JUN-2002"
FT   assembly_gap    3210944..3211039
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    3217616..3217762
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   CDS             join(3219742..3219748,3220902..3221012,3230612..3230835,
FT                   3231749..3231791,3232648..3232874,3236793..3236954,
FT                   3238152..3238310,3238960..3239007)
FT                   /codon_start=1
FT                   /gene="Plscr4"
FT                   /locus_tag="mCG_17679"
FT                   /product="phospholipid scramblase 4"
FT                   /note="gene_id=mCG17679.2 transcript_id=mCT14800.2
FT                   protein_id=mCP21334.1"
FT                   /protein_id="EDL20921.1"
FT                   /translation="MSGLVPTAPEQPTEEMENQIKSPTAVPDAPPDYNSHFAPGPAGPV
FT                   ASPSAGLPMGYYIPQQPGAIPLYHPTGGTHPIQYQPGKYPVTNQPAPIMWMAGPAPVPN
FT                   CPPGLEYLAQLDNIHVLQHVEPLELMTRFETNNRYDIKNNIDQMVYIVTEDTDDFTRNA
FT                   YRNLRPFVLRVTDCLGREIMTMQRPFRCTCCCFCCPCARQELEVQCPPGVTIGFVAEHW
FT                   NLCRASYSIQNEKKESMMRVRGPCATYGCGSDSVFEINSLDGVSNIGSIIRKWNGFLST
FT                   MVNADHFEIRFPLALDVKMKAMIFGSCFLIDFMYFERPPPRRMSR"
FT   assembly_gap    3231130..3231149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3261334..3261353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3289365..3356472
FT                   /gene="Plod2"
FT                   /locus_tag="mCG_17682"
FT                   /note="gene_id=mCG17682.2"
FT   mRNA            join(3289365..3290757,3319421..3319512,3321637..3321773,
FT                   3329209..3329372,3332498..3332610,3334857..3334920,
FT                   3336619..3336716,3339318..3339419,3341763..3341888,
FT                   3343280..3343401,3344354..3344458,3346606..3346731,
FT                   3348759..3348900,3350003..3350065,3350966..3351079,
FT                   3352827..3352892,3353421..3353525,3354556..3354702,
FT                   3354812..3354937,3355123..3356472)
FT                   /gene="Plod2"
FT                   /locus_tag="mCG_17682"
FT                   /product="procollagen lysine, 2-oxoglutarate 5-dioxygenase
FT                   2, transcript variant mCT170122"
FT                   /note="gene_id=mCG17682.2 transcript_id=mCT170122.0 created
FT                   on 20-JUN-2002"
FT   mRNA            join(3289365..3290757,3319421..3319512,3321637..3321773,
FT                   3329209..3329372,3332498..3332610,3334857..3334920,
FT                   3336619..3336716,3339318..3339419,3341763..3341888,
FT                   3343280..3343401,3344354..3344458,3346606..3346731,
FT                   3348759..3348900,3350966..3351079,3352827..3352892,
FT                   3353421..3353525,3354556..3354702,3354812..3354937,
FT                   3355123..3356472)
FT                   /gene="Plod2"
FT                   /locus_tag="mCG_17682"
FT                   /product="procollagen lysine, 2-oxoglutarate 5-dioxygenase
FT                   2, transcript variant mCT14804"
FT                   /note="gene_id=mCG17682.2 transcript_id=mCT14804.2 created
FT                   on 20-JUN-2002"
FT   CDS             join(3290649..3290757,3319421..3319512,3321637..3321773,
FT                   3329209..3329372,3332498..3332610,3334857..3334920,
FT                   3336619..3336716,3339318..3339419,3341763..3341888,
FT                   3343280..3343401,3344354..3344458,3346606..3346731,
FT                   3348759..3348900,3350003..3350065,3350966..3351079,
FT                   3352827..3352892,3353421..3353525,3354556..3354702,
FT                   3354812..3354937,3355123..3355278)
FT                   /codon_start=1
FT                   /gene="Plod2"
FT                   /locus_tag="mCG_17682"
FT                   /product="procollagen lysine, 2-oxoglutarate 5-dioxygenase
FT                   2, isoform CRA_b"
FT                   /note="gene_id=mCG17682.2 transcript_id=mCT170122.0
FT                   protein_id=mCP93089.0 isoform=CRA_b"
FT                   /protein_id="EDL20923.1"
FT                   /translation="MGDRGARPGRLMPMLALLSWAAGLGVAEETPGRIPADKLLVITVA
FT                   TKENDGFHRFMNSAKYFNYTVKVLGQGQEWRGGDGMNSIGGGQKVRLLKEAMEHYASQE
FT                   DLVILFTECFDVVFAGGPEEVLKKFQKTNHKIVFAADGLLWPDKRLADKYPVVHIGKRY
FT                   LNSGGFIGYAPYISRLVQQWNLQDNDDDQLFYTKVYIDPLKREAFNITLDHKCKIFQAL
FT                   NGATDEVVLKFENGKSRVKNTFYETLPVAINGNGPTKILLNYFGNYVPNSWTQENGCAL
FT                   CDVDTIDLSTVDVPPKVTLGVFIEQPTPFLPRFLNLLLTLDYPKEALQLFIHNKEVYHE
FT                   KDIKVFVDKAKHDISSIKIVGPEENLSQAEARNMGMDFCRQDEKCDYYFSVDADVVLTN
FT                   PRTLKILIEQNRKIIAPLVTRHGKLWSNFWGALSPDGYYARSEDYVDIVQGNRVGIWNV
FT                   PYMANVYLIQGKTLRSEMNERNYFVRDKLDPDMALCRNARDMTLQREKDSPTPETFQML
FT                   SPPKGVFMYISNRHEFGRLISTANYNTSHLNNDFWQIFENPVDWKEKYINRDYSKIFTE
FT                   NIVEQPCPDVFWFPIFSERACDELVEEMEHYGKWSGGKHHDSRISGGYENVPTDDIHMK
FT                   QIGLENVWLHFIREFIAPVTLKVFAGYYTKGFALLNFVVKYSPERQRSLRPHHDASTFT
FT                   INIALNNVGEDFQGGGCKFLRYNCSIESPRKGWSFMHPGRLTHLHEGLPVKNGTRYIAV
FT                   SFIDP"
FT   CDS             join(3290649..3290757,3319421..3319512,3321637..3321773,
FT                   3329209..3329372,3332498..3332610,3334857..3334920,
FT                   3336619..3336716,3339318..3339419,3341763..3341888,
FT                   3343280..3343401,3344354..3344458,3346606..3346731,
FT                   3348759..3348900,3350966..3351079,3352827..3352892,
FT                   3353421..3353525,3354556..3354702,3354812..3354937,
FT                   3355123..3355278)
FT                   /codon_start=1
FT                   /gene="Plod2"
FT                   /locus_tag="mCG_17682"
FT                   /product="procollagen lysine, 2-oxoglutarate 5-dioxygenase
FT                   2, isoform CRA_a"
FT                   /note="gene_id=mCG17682.2 transcript_id=mCT14804.2
FT                   protein_id=mCP21326.1 isoform=CRA_a"
FT                   /protein_id="EDL20922.1"
FT                   /translation="MGDRGARPGRLMPMLALLSWAAGLGVAEETPGRIPADKLLVITVA
FT                   TKENDGFHRFMNSAKYFNYTVKVLGQGQEWRGGDGMNSIGGGQKVRLLKEAMEHYASQE
FT                   DLVILFTECFDVVFAGGPEEVLKKFQKTNHKIVFAADGLLWPDKRLADKYPVVHIGKRY
FT                   LNSGGFIGYAPYISRLVQQWNLQDNDDDQLFYTKVYIDPLKREAFNITLDHKCKIFQAL
FT                   NGATDEVVLKFENGKSRVKNTFYETLPVAINGNGPTKILLNYFGNYVPNSWTQENGCAL
FT                   CDVDTIDLSTVDVPPKVTLGVFIEQPTPFLPRFLNLLLTLDYPKEALQLFIHNKEVYHE
FT                   KDIKVFVDKAKHDISSIKIVGPEENLSQAEARNMGMDFCRQDEKCDYYFSVDADVVLTN
FT                   PRTLKILIEQNRKIIAPLVTRHGKLWSNFWGALSPDGYYARSEDYVDIVQGNRVGIWNV
FT                   PYMANVYLIQGKTLRSEMNERNYFVRDKLDPDMALCRNARDMGVFMYISNRHEFGRLIS
FT                   TANYNTSHLNNDFWQIFENPVDWKEKYINRDYSKIFTENIVEQPCPDVFWFPIFSERAC
FT                   DELVEEMEHYGKWSGGKHHDSRISGGYENVPTDDIHMKQIGLENVWLHFIREFIAPVTL
FT                   KVFAGYYTKGFALLNFVVKYSPERQRSLRPHHDASTFTINIALNNVGEDFQGGGCKFLR
FT                   YNCSIESPRKGWSFMHPGRLTHLHEGLPVKNGTRYIAVSFIDP"
FT   assembly_gap    3309305..3309324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3360549..3361015)
FT                   /pseudo
FT                   /locus_tag="mCG_140572"
FT                   /note="gene_id=mCG140572.0"
FT   mRNA            complement(3360549..3361015)
FT                   /pseudo
FT                   /locus_tag="mCG_140572"
FT                   /note="gene_id=mCG140572.0 transcript_id=mCT170123.0
FT                   created on 20-JUN-2002"
FT   assembly_gap    3368199..3368218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3387836..3387855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3388915..3388934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3394664..3396240
FT                   /estimated_length=1577
FT                   /gap_type="unknown"
FT   assembly_gap    3432841..3432860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3434836..3435701
FT                   /pseudo
FT                   /locus_tag="mCG_65277"
FT                   /note="gene_id=mCG65277.2"
FT   mRNA            3434836..3435701
FT                   /pseudo
FT                   /locus_tag="mCG_65277"
FT                   /note="gene_id=mCG65277.2 transcript_id=mCT65460.2 created
FT                   on 20-JUN-2002"
FT   gene            3460315..3534557
FT                   /locus_tag="mCG_117698"
FT                   /note="gene_id=mCG117698.1"
FT   mRNA            join(3460315..3460540,3461640..3461938,3487973..3488084)
FT                   /locus_tag="mCG_117698"
FT                   /product="mCG117698, transcript variant mCT118842"
FT                   /note="gene_id=mCG117698.1 transcript_id=mCT118842.1
FT                   created on 20-JUN-2002"
FT   mRNA            join(3461574..3461938,3512290..3512354,3520471..3520546,
FT                   3522596..3522691,3533450..3534557)
FT                   /locus_tag="mCG_117698"
FT                   /product="mCG117698, transcript variant mCT170120"
FT                   /note="gene_id=mCG117698.1 transcript_id=mCT170120.0
FT                   created on 20-JUN-2002"
FT   mRNA            join(3461574..3461938,3487973..3488228)
FT                   /locus_tag="mCG_117698"
FT                   /product="mCG117698, transcript variant mCT170119"
FT                   /note="gene_id=mCG117698.1 transcript_id=mCT170119.0
FT                   created on 20-JUN-2002"
FT   CDS             join(3461832..3461938,3512290..3512354,3520471..3520538)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117698"
FT                   /product="mCG117698, isoform CRA_b"
FT                   /note="gene_id=mCG117698.1 transcript_id=mCT170120.0
FT                   protein_id=mCP93088.0 isoform=CRA_b"
FT                   /protein_id="EDL20926.1"
FT                   /translation="MCLSEVKWSSTLGKTWRNEENKWLKQNALQWRDKKRLFLLCEAVH
FT                   SVLLKDHVSMLSGLPRRHCSEFRLYPAESAELSC"
FT   CDS             join(3461832..3461938,3487973..3488063)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117698"
FT                   /product="mCG117698, isoform CRA_a"
FT                   /note="gene_id=mCG117698.1 transcript_id=mCT118842.1
FT                   protein_id=mCP68512.1 isoform=CRA_a"
FT                   /protein_id="EDL20924.1"
FT                   /translation="MCLSEVKWSSTLGKTWRNEENKWLKQNALQWRDKKRRKGDQKRAT
FT                   DALLREQPQIVPVLSQRRMS"
FT   CDS             join(3461832..3461938,3487973..3488063)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117698"
FT                   /product="mCG117698, isoform CRA_a"
FT                   /note="gene_id=mCG117698.1 transcript_id=mCT170119.0
FT                   protein_id=mCP93081.0 isoform=CRA_a"
FT                   /protein_id="EDL20925.1"
FT                   /translation="MCLSEVKWSSTLGKTWRNEENKWLKQNALQWRDKKRRKGDQKRAT
FT                   DALLREQPQIVPVLSQRRMS"
FT   assembly_gap    3465765..3466571
FT                   /estimated_length=807
FT                   /gap_type="unknown"
FT   assembly_gap    3480264..3480283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3483475..3483591
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    3487555..3487668
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    3564138..3564157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3587918..3588576
FT                   /estimated_length=659
FT                   /gap_type="unknown"
FT   assembly_gap    3597525..3597544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3634787..3654722
FT                   /locus_tag="mCG_1032846"
FT                   /note="gene_id=mCG1032846.1"
FT   mRNA            join(3634787..3635465,3654530..3654722)
FT                   /locus_tag="mCG_1032846"
FT                   /product="mCG1032846"
FT                   /note="gene_id=mCG1032846.1 transcript_id=mCT150550.1
FT                   created on 20-JUN-2002"
FT   CDS             3654608..3654709
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032846"
FT                   /product="mCG1032846"
FT                   /note="gene_id=mCG1032846.1 transcript_id=mCT150550.1
FT                   protein_id=mCP68790.1"
FT                   /protein_id="EDL20927.1"
FT                   /translation="MFMDKYSHTNTPSLLHPHRYSCTFTIHIERMNK"
FT   assembly_gap    3663375..3663394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3692125..3692427
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    3693782..3693801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3695006..3695025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3716934..3716953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3716954..3717269
FT                   /pseudo
FT                   /locus_tag="mCG_1032787"
FT                   /note="gene_id=mCG1032787.1"
FT   mRNA            3716954..3717269
FT                   /pseudo
FT                   /locus_tag="mCG_1032787"
FT                   /note="gene_id=mCG1032787.1 transcript_id=mCT150491.1
FT                   created on 20-JUN-2002"
FT   gene            complement(3720630..3747564)
FT                   /locus_tag="mCG_140570"
FT                   /note="gene_id=mCG140570.0"
FT   mRNA            complement(join(3720630..3720969,3721440..3721567,
FT                   3745624..3745722,3747515..3747564))
FT                   /locus_tag="mCG_140570"
FT                   /product="mCG140570"
FT                   /note="gene_id=mCG140570.0 transcript_id=mCT170113.0
FT                   created on 20-JUN-2002"
FT   CDS             complement(join(3721536..3721567,3745624..3745722,
FT                   3747515..3747539))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140570"
FT                   /product="mCG140570"
FT                   /note="gene_id=mCG140570.0 transcript_id=mCT170113.0
FT                   protein_id=mCP93078.0"
FT                   /protein_id="EDL20928.1"
FT                   /translation="MLTQFPTQVVDGLLLPRLDRLPSCCCAQEPLLIHLLVTAHRAHKP
FT                   DERPTK"
FT   assembly_gap    3727795..3727814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3729094..3729113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3746861..3747013
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    3765319..3766591
FT                   /estimated_length=1273
FT                   /gap_type="unknown"
FT   assembly_gap    3780725..3780913
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    3871496..3871664
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   gene            complement(3906706..3907534)
FT                   /pseudo
FT                   /locus_tag="mCG_140573"
FT                   /note="gene_id=mCG140573.0"
FT   mRNA            complement(3906706..3907534)
FT                   /pseudo
FT                   /locus_tag="mCG_140573"
FT                   /note="gene_id=mCG140573.0 transcript_id=mCT170125.0
FT                   created on 20-JUN-2002"
FT   gene            complement(3907574..3908135)
FT                   /pseudo
FT                   /locus_tag="mCG_140574"
FT                   /note="gene_id=mCG140574.0"
FT   mRNA            complement(3907574..3908135)
FT                   /pseudo
FT                   /locus_tag="mCG_140574"
FT                   /note="gene_id=mCG140574.0 transcript_id=mCT170126.0
FT                   created on 20-JUN-2002"
FT   assembly_gap    3908137..3908156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3908385..3909050)
FT                   /pseudo
FT                   /locus_tag="mCG_140575"
FT                   /note="gene_id=mCG140575.0"
FT   mRNA            complement(3908385..3909050)
FT                   /pseudo
FT                   /locus_tag="mCG_140575"
FT                   /note="gene_id=mCG140575.0 transcript_id=mCT170127.0
FT                   created on 20-JUN-2002"
FT   gene            complement(3909379..3909877)
FT                   /pseudo
FT                   /locus_tag="mCG_140576"
FT                   /note="gene_id=mCG140576.0"
FT   mRNA            complement(3909379..3909877)
FT                   /pseudo
FT                   /locus_tag="mCG_140576"
FT                   /note="gene_id=mCG140576.0 transcript_id=mCT170124.0
FT                   created on 20-JUN-2002"
FT   assembly_gap    3952816..3952853
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    4021072..4023679
FT                   /estimated_length=2608
FT                   /gap_type="unknown"
FT   assembly_gap    4024678..4024697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4041534..4041870
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    4052292..4052682
FT                   /estimated_length=391
FT                   /gap_type="unknown"
FT   assembly_gap    4054210..4054537
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    4069884..4070403
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    4071580..4071599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4089531..4090239
FT                   /estimated_length=709
FT                   /gap_type="unknown"
FT   assembly_gap    4091228..4091297
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    4097026..4097536
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   assembly_gap    4105617..4106799
FT                   /estimated_length=1183
FT                   /gap_type="unknown"
FT   assembly_gap    4107911..4113290
FT                   /estimated_length=5380
FT                   /gap_type="unknown"
FT   assembly_gap    4120044..4120063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4122217..4123209)
FT                   /pseudo
FT                   /locus_tag="mCG_49401"
FT                   /note="gene_id=mCG49401.1"
FT   mRNA            complement(4122217..4123209)
FT                   /pseudo
FT                   /locus_tag="mCG_49401"
FT                   /note="gene_id=mCG49401.1 transcript_id=mCT49584.1 created
FT                   on 20-JUN-2002"
FT   assembly_gap    4125568..4130250
FT                   /estimated_length=4683
FT                   /gap_type="unknown"
FT   assembly_gap    4136545..4136629
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    4177304..4177323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4227864..4227956
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    4235809..4236002
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    4342465..4344918
FT                   /estimated_length=2454
FT                   /gap_type="unknown"
FT   assembly_gap    4360298..4362043
FT                   /estimated_length=1746
FT                   /gap_type="unknown"
FT   assembly_gap    4374401..4374420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4377099..4381521
FT                   /estimated_length=4423
FT                   /gap_type="unknown"
FT   assembly_gap    4478395..4478414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4490032..4490051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4493204..4493723
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    4521572..4521704
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    4525408..4525432
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    4550201..4550299
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    4556862..4556881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4585610..4585629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4592812..4592831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4595570..4595752
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    4596975..4597480
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    4625474..4629833
FT                   /estimated_length=4360
FT                   /gap_type="unknown"
FT   assembly_gap    4648097..4648116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4681029..4681048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4686108..4686705
FT                   /estimated_length=598
FT                   /gap_type="unknown"
FT   assembly_gap    4716832..4717131
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    4772399..4772418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4806580..4806599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4852640..4852659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4882655..4882674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4894392..4894731
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    5018214..5018233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5019868..5019887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5029335..5030115
FT                   /estimated_length=781
FT                   /gap_type="unknown"
FT   assembly_gap    5035471..5035490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5061811..5062181
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    5092814..5092833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5106246..5107623
FT                   /estimated_length=1378
FT                   /gap_type="unknown"
FT   gene            complement(5123646..5124185)
FT                   /pseudo
FT                   /locus_tag="mCG_57755"
FT                   /note="gene_id=mCG57755.2"
FT   mRNA            complement(5123646..5124185)
FT                   /pseudo
FT                   /locus_tag="mCG_57755"
FT                   /note="gene_id=mCG57755.2 transcript_id=mCT57938.2 created
FT                   on 01-JUL-2002"
FT   assembly_gap    5144903..5144922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5157082..5157224
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    5165551..5165575
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    5166546..5166565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5214949..5214968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5216179..5216687
FT                   /estimated_length=509
FT                   /gap_type="unknown"
FT   assembly_gap    5218012..5218031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5222965..5222984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5227627..5227646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5232027..5252002)
FT                   /locus_tag="mCG_21613"
FT                   /note="gene_id=mCG21613.2"
FT   mRNA            complement(join(5232027..5234805,5238570..5238873,
FT                   5251365..5252002))
FT                   /locus_tag="mCG_21613"
FT                   /product="mCG21613"
FT                   /note="gene_id=mCG21613.2 transcript_id=mCT19626.2 created
FT                   on 01-JUL-2002"
FT   CDS             complement(join(5234474..5234805,5238570..5238873,
FT                   5251365..5251940))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21613"
FT                   /product="mCG21613"
FT                   /note="gene_id=mCG21613.2 transcript_id=mCT19626.2
FT                   protein_id=mCP21383.2"
FT                   /protein_id="EDL20929.1"
FT                   /translation="MLLHSPSLLASWQRNELADRRFLQLNKCPACFGTSWCRRFLNGQV
FT                   GFETWGRLRLLDFLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATG
FT                   RPRCDLLQAMPRTEFARLNGDVRLLTPEAVEGWSDLVHCPSQRLLDRLVRRYAETKDSG
FT                   SFLLRNLKDSERMQLLLTLAFNPEPLVLQSFPSDEGWPFAKYLGACGRMVAVNYVGEEL
FT                   WSYFNAPWEKRVDLAWQLMEIAEQLTNNDFEFALYLLDVSFDNFAVGPRDGKVIIVDAE
FT                   NVLVADKRLIRQNKPENWDVWYESKFDDCDKEACLSFSKEILCARVTVDHNYYAVCQNL
FT                   LSRHATWRGTSGGLLHDPPSEIAKDGRLEALLDECTNPKKRYGRFQAAKELRGYLAQLS
FT                   HNVR"
FT   assembly_gap    5252003..5252100
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    5253499..5254914
FT                   /estimated_length=1416
FT                   /gap_type="unknown"
FT   assembly_gap    5280526..5280545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5285552..5285571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5311179..5311249
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    5348523..5348623
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    5351450..5354248
FT                   /estimated_length=2799
FT                   /gap_type="unknown"
FT   assembly_gap    5376357..5376523
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   gene            5383375..5945963
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /note="gene_id=mCG10249.2"
FT   mRNA            join(5383375..5383719,5398526..5398728,5433241..5433318,
FT                   5434792..5434868,5531005..5531120,5576532..5576637,
FT                   5652394..5652503,5655519..5655653,5676464..5676552,
FT                   5735027..5735140,5736523..5736634,5769901..5770054,
FT                   5838341..5838363,5853248..5853356,5942712..5942817,
FT                   5944360..5945963)
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, transcript variant mCT10470"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT10470.2 created
FT                   on 01-JUL-2002"
FT   mRNA            join(5383375..5383719,5398526..5398728,5433241..5433318,
FT                   5434792..5434868,5439286..5439719)
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, transcript variant mCT19625"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT19625.2 created
FT                   on 01-JUL-2002"
FT   mRNA            join(<5383391..5383719,5398526..5398728,5433241..5433318,
FT                   5434792..5434868,5531005..5531120,5576532..5576637,
FT                   5652394..5652532,5655548..5655653,5676464..5676552,
FT                   5735027..5735140,5736523..5736634,5769901..5770054,
FT                   5838341..5838396,5853281..5853356,5942712..5942817,
FT                   5944360..5944970)
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, transcript variant mCT191538"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT191538.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<5383521..5383719,5398526..5398728,5433241..5433318,
FT                   5434792..5434868,5531005..5531120,5576532..5576637,
FT                   5652394..5652532,5655548..5655653,5676464..5676552,
FT                   5735027..5735140,5736523..5736634,5769901..5770054,
FT                   5838341..5838396,5853281..5853356,5942712..5942817,
FT                   5944360..5944587)
FT                   /codon_start=1
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, isoform CRA_c"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT191538.0
FT                   protein_id=mCP112461.0 isoform=CRA_c"
FT                   /protein_id="EDL20932.1"
FT                   /translation="ASQSVEWRMAGQLRFTSGKDEDHFQHQGAVELLAFNFLLILTILT
FT                   IWLFKNHRFRFLHETGGAMVYGLIMGLILRYATAPTDIDSGTVYNCGNLFFSPSTLLVN
FT                   ITDQVYEYKYQREINQHNISPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHF
FT                   FQNLGSILTYAFLGTAISCVVIGLIMYGFVKAMVHAGQLKSGDFHFTDCLFFGSLMSAT
FT                   DPVTVLAIFHELHVDPDLYTLLFGESVLNDAVAIVLTYSISIYSPKENPNAFDTAAFFQ
FT                   SVGNFLGIFAGSFAMGSAYAVVTALLTKFTKLREFPMLETGLFFLLSWSAFLSAEAAGL
FT                   TGIVAVLFCGVTQAHYTYNNLSSDSKLRTKQLFEFMNFLAENVIFCYMGLALFTFQNHI
FT                   FNALFILGAFLAIFVARACNIYPLSFLLNLGRKQKIPWNFQHMMMFSGLRGAIAFALAI
FT                   RNTESQPKQMMFTTTLLLVFFTVWVFGGGTTPMLTWLQIRVGVDLDESLKEEPSSQQAT
FT                   NKLDKNMTKTESAQLFRMWYGFDHKYLKPILTHSGPPLTTTLPAWCGPVSRLLTSPQAY
FT                   GEQLKEDDVECIVNQDELAMNYQEQSPSPSSPTTKLALDQKSSGQTPGKENIYEGDLGL
FT                   GGYDLKLEQTRGQPQMD"
FT   CDS             join(5383545..5383719,5398526..5398728,5433241..5433318,
FT                   5434792..5434868,5531005..5531120,5576532..5576637,
FT                   5652394..5652503,5655519..5655653,5676464..5676552,
FT                   5735027..5735140,5736523..5736634,5769901..5770054,
FT                   5838341..5838363,5853248..5853356,5942712..5942817,
FT                   5944360..5944587)
FT                   /codon_start=1
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, isoform CRA_a"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT10470.2
FT                   protein_id=mCP21277.2 isoform=CRA_a"
FT                   /protein_id="EDL20930.1"
FT                   /translation="MAGQLRFTSGKDEDHFQHQGAVELLAFNFLLILTILTIWLFKNHR
FT                   FRFLHETGGAMVYGLIMGLILRYATAPTDIDSGTVYNCGNLFFSPSTLLVNITDQVYEY
FT                   KYQREINQHNISPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSIL
FT                   TYAFLGTAISCVVIGLIMYGFVKAMVHAGQLKSGDFHFTDCLFFGSLMSATDPVTVLAI
FT                   FHELHVDPDLYTLLFGESVLNDAVAIVLTYSISIYSPKENPNAFDTAAFFQSVGNFLGI
FT                   FAGSFAMVVDFLNTPCHLTKFTKLREFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLF
FT                   CGVTQAHYTYNNLSSDSKLRTKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILG
FT                   AFLAIFVARACNIYPLSFLLNLGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPK
FT                   QMMFTTTLLLVFFTVWVFGGGTTPMLTWLQIRVGVDLDENVPFSMVSFQEANKLDKNMT
FT                   KTESAQLFRMWYGFDHKYLKPILTHSGPPLTTTLPAWCGPVSRLLTSPQAYGEQLKEDD
FT                   VECIVNQDELAMNYQEQSPSPSSPTTKLALDQKSSGQTPGKENIYEGDLGLGGYDLKLE
FT                   QTRGQPQMD"
FT   CDS             join(5383545..5383719,5398526..5398728,5433241..5433318,
FT                   5434792..5434868,5439286..5439292)
FT                   /codon_start=1
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, isoform CRA_d"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT19625.2
FT                   protein_id=mCP21273.2 isoform=CRA_d"
FT                   /protein_id="EDL20933.1"
FT                   /translation="MAGQLRFTSGKDEDHFQHQGAVELLAFNFLLILTILTIWLFKNHR
FT                   FRFLHETGGAMVYGLIMGLILRYATAPTDIDSGTVYNCGNLFFSPSTLLVNITDQVYEY
FT                   KYQREINQHNISPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSIL
FT                   TYAFLGTAISCVVIGT"
FT   assembly_gap    5399180..5405361
FT                   /estimated_length=6182
FT                   /gap_type="unknown"
FT   assembly_gap    5407160..5407179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5415571..5415590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5417561..5424172)
FT                   /locus_tag="mCG_147716"
FT                   /note="gene_id=mCG147716.0"
FT   mRNA            complement(join(5417561..5419144,5424009..5424172))
FT                   /locus_tag="mCG_147716"
FT                   /product="mCG147716"
FT                   /note="gene_id=mCG147716.0 transcript_id=mCT187979.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(5418522..5418944)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147716"
FT                   /product="mCG147716"
FT                   /note="gene_id=mCG147716.0 transcript_id=mCT187979.0
FT                   protein_id=mCP108542.0"
FT                   /protein_id="EDL20934.1"
FT                   /translation="MTLCFYYSRHRGISAPQFLCKPGNCFEFALSLAGSAMNCVYSFPI
FT                   IRSHQGATGLGKLNWEGLSQQKAGSEQAGWRGREGKECTLTSAESMMKMRQYIFTWCVC
FT                   LQHRAGNKEHLTSSIGPPQTSQSRASKCRQGQMSQC"
FT   assembly_gap    5430051..5430156
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    5438039..5438058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5462453..5462638
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    5464486..5465052
FT                   /estimated_length=567
FT                   /gap_type="unknown"
FT   assembly_gap    5483079..5483175
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    5504200..5505605
FT                   /estimated_length=1406
FT                   /gap_type="unknown"
FT   assembly_gap    5545415..5545434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5558165..5558692
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    5563870..5564084
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    5591585..5591604
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5592811..5592830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5611050..5611069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5624561..5624729
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    5650894..5651276
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    5677856..5677927
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    5695757..5695987
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    5717430..5717449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5727246..5727645
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   assembly_gap    5776139..5776158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5777301..5777575
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    5781697..5781716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5806342..5806530
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    5824705..5824724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(5837020..5837269,5837355..5837392,5838341..5839890)
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, transcript variant mCT170543"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT170543.0 created
FT                   on 01-JUL-2002"
FT   CDS             join(5837180..5837269,5837355..5837392,5838341..5838500)
FT                   /codon_start=1
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, isoform CRA_b"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT170543.0
FT                   protein_id=mCP93461.0 isoform=CRA_b"
FT                   /protein_id="EDL20931.1"
FT                   /translation="MRYTEPEAILENENSVLFDACQNGDAEMYSISMTGLHGASQSGVG
FT                   VDLDESLKEEPSSQQASSIKSWIKHGLVHCSSVLLEYIAKGAISKMGCLC"
FT   assembly_gap    5867898..5867917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5925806..5926160
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    5962967..5965243
FT                   /estimated_length=2277
FT                   /gap_type="unknown"
FT   assembly_gap    5986175..5989199
FT                   /estimated_length=3025
FT                   /gap_type="unknown"
FT   assembly_gap    5994045..5994064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5996171..5996373
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    6008589..6012909
FT                   /estimated_length=4321
FT                   /gap_type="unknown"
FT   assembly_gap    6021493..6021512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6026775..6026794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6038847..6039438
FT                   /estimated_length=592
FT                   /gap_type="unknown"
FT   assembly_gap    6041744..6041763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6052659..6057379
FT                   /estimated_length=4721
FT                   /gap_type="unknown"
FT   assembly_gap    6060102..6060437
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    6063187..6063206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6075909..6075928
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6093322..6093721
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   assembly_gap    6095327..6095346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6102992..6104700
FT                   /estimated_length=1709
FT                   /gap_type="unknown"
FT   assembly_gap    6110583..6111605
FT                   /estimated_length=1023
FT                   /gap_type="unknown"
FT   assembly_gap    6117608..6118003
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    6123579..6123598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6131265..6134771)
FT                   /gene="Chst2"
FT                   /locus_tag="mCG_10245"
FT                   /note="gene_id=mCG10245.2"
FT   mRNA            complement(join(6131265..6134237,6134341..6134771))
FT                   /gene="Chst2"
FT                   /locus_tag="mCG_10245"
FT                   /product="carbohydrate sulfotransferase 2"
FT                   /note="gene_id=mCG10245.2 transcript_id=mCT10464.2 created
FT                   on 21-JUN-2002"
FT   CDS             complement(6132450..6134042)
FT                   /codon_start=1
FT                   /gene="Chst2"
FT                   /locus_tag="mCG_10245"
FT                   /product="carbohydrate sulfotransferase 2"
FT                   /note="gene_id=mCG10245.2 transcript_id=mCT10464.2
FT                   protein_id=mCP21286.2 partial"
FT                   /protein_id="EDL20935.1"
FT                   /translation="MSRSSAGALPPGALPRPLPAAPAAVQRALLPPWPRRAGRRWPASP
FT                   LGMKVFRRKALVLCAGYALLLVLTMLNLLDYKWHKEPLQQCNPDGPLGAAVGAAGAGWG
FT                   RPGSPPAAPPRAHSRMDPRTPYRPPAAGVGAVPAAAAGSAGAAASLGNATRGTRGGGDK
FT                   RQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDAVSLQGAARDMLSA
FT                   LYRCDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCK
FT                   KCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLKDPALDLKVIHLVRDPRAVASS
FT                   RIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGMGGPADYHALGAMEVIC
FT                   NSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNM
FT                   TSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEV
FT                   KDLSKTLLRKPRL"
FT   assembly_gap    6134172..6134191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6151967..6152361
FT                   /estimated_length=395
FT                   /gap_type="unknown"
FT   assembly_gap    6159151..6159332
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    6163049..6163241
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   gene            complement(6183235..6238472)
FT                   /gene="2610101N10Rik"
FT                   /locus_tag="mCG_140571"
FT                   /note="gene_id=mCG140571.0"
FT   mRNA            complement(join(6183235..6188195,6189355..6189531,
FT                   6191012..6191130,6193199..6193309,6198693..6198852,
FT                   6201082..6201148,6201915..6202010,6202820..6202976,
FT                   6204113..6204235,6205981..6206068,6208362..6208441,
FT                   6208801..6208963,6210884..6211043,6211118..6211188,
FT                   6212275..6212379,6215385..6215428,6216339..6216550,
FT                   6216729..6216894,6217730..6217812,6217907..6217939,
FT                   6218021..6218115,6218963..6219030,6219737..6219870,
FT                   6220342..6220456,6222474..6222572,6227443..6227574,
FT                   6229295..6229339,6238404..6238472))
FT                   /gene="2610101N10Rik"
FT                   /locus_tag="mCG_140571"
FT                   /product="RIKEN cDNA 2610101N10"
FT                   /note="gene_id=mCG140571.0 transcript_id=mCT170118.0
FT                   created on 21-JUN-2002"
FT   CDS             complement(join(6188057..6188195,6189355..6189531,
FT                   6191012..6191130,6193199..6193309,6198693..6198852,
FT                   6201082..6201148,6201915..6202010,6202820..6202976,
FT                   6204113..6204235,6205981..6206068,6208362..6208441,
FT                   6208801..6208963,6210884..6211043,6211118..6211188,
FT                   6212275..6212379,6215385..6215428,6216339..6216550,
FT                   6216729..6216894,6217730..6217812,6217907..6217939,
FT                   6218021..6218115,6218963..6219030,6219737..6219870,
FT                   6220342..6220456,6222474..6222572,6227443..6227574,
FT                   6229295..6229339,6238404..6238448))
FT                   /codon_start=1
FT                   /gene="2610101N10Rik"
FT                   /locus_tag="mCG_140571"
FT                   /product="RIKEN cDNA 2610101N10"
FT                   /note="gene_id=mCG140571.0 transcript_id=mCT170118.0
FT                   protein_id=mCP93092.0"
FT                   /protein_id="EDL20936.1"
FT                   /translation="MADKTPGGSQKASSKNRSSDVHSSGSSDAHMDASGPSDSDMPSRT
FT                   RPKSPRKHNYRNESSRESLCDSPHQNLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEEL
FT                   KKKEDEKAAAEIYEEFLAAFEGSDGNKVKTFVRGGVVNAAKDEHETDEKRGKIYKPSSR
FT                   FADQKNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERH
FT                   KTKGRLSRFEPPQSDSDGQRRSMDVPSRRNRSSVLDDYAPGSHDVGDPSTTNLYLGNIN
FT                   PQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGK
FT                   MIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLP
FT                   PPKNKEDFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMF
FT                   RFLFENQTPAHVYYRWKLYSILQANSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEE
FT                   QETEAFVEEPSKKGALKEEQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCI
FT                   TESLSILKTPLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRT
FT                   IQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLVNIIEEKETEDVPDDLD
FT                   GAPIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIF
FT                   KVAPSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEEDTQSSKSEE
FT                   HHLYSNPVREEATESKFSKYSEMSEEKRAKLREIELKVMKFQDELESGKRPKKPGQSFQ
FT                   EQVEHYRDKLLQREKEKELERERERDKKDKEKLESRSKDKKEKDECTPTRKERKRRHST
FT                   SPSPSRSSSGRRVKSPSPKSERSERSERSHKESSRSRSSHKDSPRDASKKAKRSPSGSR
FT                   TPKRSRRSRSRSPKKSGKKSRSQSRSPHRSHKKSKKNKH"
FT   assembly_gap    6201509..6201561
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    6212573..6212592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6226641..6226957
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    6229916..6230038
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    6246669..6246688
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6248513..6248532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6253445..6253464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6254950..6254969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6265010..6265058
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    6266656..6266677
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    6270133..6270733
FT                   /estimated_length=601
FT                   /gap_type="unknown"
FT   assembly_gap    6275319..6275338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6276533..6276552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6290274..6290844
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   assembly_gap    6301334..6301353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6319595..6319899
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    6327768..6327799
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    6344624..6344643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6356697..6356725
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    6365696..6365715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6368545..6426397
FT                   /gene="Pcolce2"
FT                   /locus_tag="mCG_10247"
FT                   /note="gene_id=mCG10247.2"
FT   mRNA            join(6368545..6368790,6369569..6369677,6400604..6400859,
FT                   6408939..6409063,6412137..6412273,6417537..6417691,
FT                   6423710..6423793,6425473..6425640,6425815..6426397)
FT                   /gene="Pcolce2"
FT                   /locus_tag="mCG_10247"
FT                   /product="procollagen C-endopeptidase enhancer 2"
FT                   /note="gene_id=mCG10247.2 transcript_id=mCT10467.2 created
FT                   on 21-JUN-2002"
FT   CDS             join(6368711..6368790,6369569..6369677,6400604..6400859,
FT                   6408939..6409063,6412137..6412273,6417537..6417691,
FT                   6423710..6423793,6425473..6425640,6425815..6425945)
FT                   /codon_start=1
FT                   /gene="Pcolce2"
FT                   /locus_tag="mCG_10247"
FT                   /product="procollagen C-endopeptidase enhancer 2"
FT                   /note="gene_id=mCG10247.2 transcript_id=mCT10467.2
FT                   protein_id=mCP21251.1"
FT                   /protein_id="EDL20937.1"
FT                   /translation="MGGASACIPLCLLLATARMARPQTPERPVFTCGGILTGESGFIGS
FT                   EGFPGMYPPNSKCTWKITVPEGKVVVLNFRFIDLENDNLCRYDFVDVYNGHANGQRIGR
FT                   FCGTFRPGSLVASGNKMTVQMISDANTAGSGFMATYSAAAPDGKGDRYCGGRLEKPSGT
FT                   FKTPNWPDRDYPVGVTCVWHIIAPKNQLIELKFEKFDVERDNYCRYDYVAVFNGGEVND
FT                   AKRIGKYCGDSPPVPIVSERNELLIQFLSDLSLTADGFIGHYKFRPKKFPTTTTTPVTT
FT                   TLPVTTGLKPTVALCQQKCRRMGTLESNYCSSNFVLAGTVITTVTRGGSLHATVSIISI
FT                   YREGNLAIQQAGKNMSVKLTVVCRQCPLLRRGLNYIIMGQVGEDGRGKIMPNSFVKMFK
FT                   NKNQKPMNALKNKQC"
FT   assembly_gap    6384975..6385082
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    6393340..6393359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6413504..6413523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6435917..6481204)
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /note="gene_id=mCG10244.2"
FT   mRNA            complement(join(6435917..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6480514..6481204))
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, transcript variant mCT170116"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT170116.0 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(6435917..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6467673..6467774,
FT                   6480514..6481204))
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, transcript variant mCT170115"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT170115.0 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(6435917..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6474044..6474198,
FT                   6480514..6481204))
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, transcript variant mCT170117"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT170117.0 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(6435917..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6467673..6467774,
FT                   6474044..6474198,6480514..6481204))
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, transcript variant mCT10465"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT10465.1 created
FT                   on 21-JUN-2002"
FT   CDS             complement(join(6437590..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6474044..6474198,
FT                   6480514..6480733))
FT                   /codon_start=1
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, isoform CRA_d"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT170117.0
FT                   protein_id=mCP93079.0 isoform=CRA_d"
FT                   /db_xref="GOA:B7ZMP6"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002153"
FT                   /db_xref="InterPro:IPR004729"
FT                   /db_xref="InterPro:IPR005457"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR013555"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:109528"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZMP6"
FT                   /protein_id="EDL20941.1"
FT                   /translation="MGAPPPSPGLPPSWAAMMAALYPSTDLSGVSSSSLPSSPSSSSPN
FT                   EVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAV
FT                   TITIENESLDILQLLLDYGCQKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQ
FT                   DVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFEL
FT                   SADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRG
FT                   LLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVG
FT                   IFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMG
FT                   PALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVA
FT                   HNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQ
FT                   DFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFAL
FT                   FWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIA
FT                   NHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVK
FT                   RQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKF
FT                   RNEIRDLLGFRTSKYAMFYPRN"
FT   CDS             complement(join(6437590..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6467673..6467774,
FT                   6474044..6474198,6480514..6480733))
FT                   /codon_start=1
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, isoform CRA_a"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT10465.1
FT                   protein_id=mCP21288.1 isoform=CRA_a"
FT                   /db_xref="GOA:B2RPS7"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002153"
FT                   /db_xref="InterPro:IPR004729"
FT                   /db_xref="InterPro:IPR005457"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR013555"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:109528"
FT                   /db_xref="UniProtKB/TrEMBL:B2RPS7"
FT                   /protein_id="EDL20938.1"
FT                   /translation="MGAPPPSPGLPPSWAAMMAALYPSTDLSGVSSSSLPSSPSSSSPN
FT                   EVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAV
FT                   TITIENESLDILQLLLDYGCQSADALLVAIDSEVVGAVDILLNHRPKRSSRPTIVKLME
FT                   RIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDS
FT                   LRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQC
FT                   KMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQ
FT                   SNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTP
FT                   FMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRL
FT                   WYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGL
FT                   FAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYD
FT                   KGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQS
FT                   FVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTL
FT                   PPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCC
FT                   LVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPRN"
FT   CDS             complement(join(6437590..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6480514..6480546))
FT                   /codon_start=1
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, isoform CRA_c"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT170116.0
FT                   protein_id=mCP93087.0 isoform=CRA_c"
FT                   /protein_id="EDL20940.1"
FT                   /translation="MRSFSCWRATRKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTM
FT                   LLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILR
FT                   AFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPL
FT                   DKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTV
FT                   LTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKK
FT                   NTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFAL
FT                   KVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMG
FT                   QMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGT
FT                   CFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSF
FT                   QLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSK
FT                   GKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQD
FT                   LSKFRNEIRDLLGFRTSKYAMFYPRN"
FT   CDS             complement(join(6437590..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6467673..6467774,
FT                   6480514..6480546))
FT                   /codon_start=1
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, isoform CRA_b"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT170115.0
FT                   protein_id=mCP93083.0 isoform=CRA_b"
FT                   /protein_id="EDL20939.1"
FT                   /translation="MRSFSCWRATRSADALLVAIDSEVVGAVDILLNHRPKRSSRPTIV
FT                   KLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKN
FT                   KKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEEL
FT                   ARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKE
FT                   FVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRI
FT                   IHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSD
FT                   IKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLV
FT                   AEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLT
FT                   QLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGE
FT                   ELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDD
FT                   KCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQK
FT                   VMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPR
FT                   N"
FT   gene            complement(6483493..6575418)
FT                   /locus_tag="mCG_10241"
FT                   /note="gene_id=mCG10241.2"
FT   mRNA            complement(join(6483493..6485283,6485507..6485631,
FT                   6492146..6492269,6492767..6492900,6496544..6496658,
FT                   6499570..6499648,6503994..6504189,6505785..6505880,
FT                   6506943..6507085,6507166..6507331,6512952..6513033,
FT                   6514684..6514816,6516074..6516203,6517517..6517680,
FT                   6526262..6526366,6575310..6575418))
FT                   /locus_tag="mCG_10241"
FT                   /product="mCG10241, transcript variant mCT10461"
FT                   /note="gene_id=mCG10241.2 transcript_id=mCT10461.2 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(6483493..6485283,6485507..6485631,
FT                   6492146..6492269,6492767..6492900,6496544..6496658,
FT                   6499570..6499648,6503994..6504189,6505785..6505880,
FT                   6506943..6507085,6507166..6507331,6512952..6513033,
FT                   6514765..6514816,6516074..6516203,6517517..6517680,
FT                   6526262..6526366,6545738..6545898))
FT                   /locus_tag="mCG_10241"
FT                   /product="mCG10241, transcript variant mCT170114"
FT                   /note="gene_id=mCG10241.2 transcript_id=mCT170114.0 created
FT                   on 21-JUN-2002"
FT   CDS             complement(join(6485148..6485283,6485507..6485631,
FT                   6492146..6492269,6492767..6492900,6496544..6496658,
FT                   6499570..6499648,6503994..6504189,6505785..6505880,
FT                   6506943..6507085,6507166..6507331,6512952..6513033,
FT                   6514765..6514816,6516074..6516203,6517517..6517680,
FT                   6526262..6526331))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10241"
FT                   /product="mCG10241, isoform CRA_a"
FT                   /note="gene_id=mCG10241.2 transcript_id=mCT170114.0
FT                   protein_id=mCP93085.0 isoform=CRA_a"
FT                   /protein_id="EDL20942.1"
FT                   /translation="MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASL
FT                   PLPGYKVREIVEKILVVADNNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITA
FT                   IGGTSSISSEGTQHSYSEEEKVAFVNWINKALENDKMINLSEPDTIDERAINKKKLTPF
FT                   TVSENLNLALNSASAIGCTVVNIGAQDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEA
FT                   LIALLKDGEDLEELMKLSPEELLLRWVNYHLTNAGWRTINNFSQDIKDSKAYFHLLNQI
FT                   APKGDRDDGPAVAIDLSGFNEKNDLKRAGFMLQEADKLGCRQFVTPADVVSGNPKLNLA
FT                   FVANLFNTYPCLHKPDNNDIDLNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADAL
FT                   VIFQLYEMIRVPVNWSQVNKPPYPALGGNMKKIENCNYAVELGKNEAKFSLVGIAGQDL
FT                   NEGNATLTLALVWQLMRRYTLKVLSDLGEGEKVTDDIIIKWVNQTLKSANKSTSISSFK
FT                   DKSISTSLPVLDLIDAIAPNAVRQEMIKREHLTDEDKLNNAKYAISVARKIGARIYALP
FT                   DDLVEVKPKMVMTVFACLMGKGLNRLK"
FT   CDS             complement(join(6485148..6485283,6485507..6485631,
FT                   6492146..6492269,6492767..6492900,6496544..6496658,
FT                   6499570..6499648,6503994..6504189,6505785..6505880,
FT                   6506943..6507085,6507166..6507331,6512952..6513033,
FT                   6514684..6514816,6516074..6516203,6517517..6517680,
FT                   6526262..6526331))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10241"
FT                   /product="mCG10241, isoform CRA_b"
FT                   /note="gene_id=mCG10241.2 transcript_id=mCT10461.2
FT                   protein_id=mCP21270.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V0K9"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR030235"
FT                   /db_xref="MGI:MGI:104809"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3V0K9"
FT                   /protein_id="EDL20943.1"
FT                   /translation="MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASL
FT                   PLPGYKVREIVEKILVVADNNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITA
FT                   IGGTSSISSEGTQHSYSEEEKVAFVNWINKALENDADCSHLLPMNPNDGSLFKSLADGI
FT                   LLCKMINLSEPDTIDERAINKKKLTPFTVSENLNLALNSASAIGCTVVNIGAQDLKEGK
FT                   PHLVLGLLWQIIKVGLFADIEISRNEALIALLKDGEDLEELMKLSPEELLLRWVNYHLT
FT                   NAGWRTINNFSQDIKDSKAYFHLLNQIAPKGDRDDGPAVAIDLSGFNEKNDLKRAGFML
FT                   QEADKLGCRQFVTPADVVSGNPKLNLAFVANLFNTYPCLHKPDNNDIDLNLLEGESKEE
FT                   RTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIRVPVNWSQVNKPPYPALGGNMKK
FT                   IENCNYAVELGKNEAKFSLVGIAGQDLNEGNATLTLALVWQLMRRYTLKVLSDLGEGEK
FT                   VTDDIIIKWVNQTLKSANKSTSISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIKREHL
FT                   TDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLMGKGLNRLK"
FT   assembly_gap    6523711..6523730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6587778..6681846
FT                   /locus_tag="mCG_10240"
FT                   /note="gene_id=mCG10240.2"
FT   mRNA            join(6587778..6587922,6591508..6591599,6592922..6593071,
FT                   6595108..6595985,6596723..6596901,6597634..6597825,
FT                   6600022..6600212,6600760..6600912,6601576..6601827,
FT                   6604218..6604408,6604491..6604591,6604843..6605014,
FT                   6605734..6605904,6608595..6608789,6611366..6611551,
FT                   6613256..6613348,6615482..6615612,6618240..6618383,
FT                   6620899..6620992,6623551..6623676,6627681..6627887,
FT                   6629182..6629295,6633808..6633923,6635883..6636003,
FT                   6637441..6637578,6638395..6638587,6640624..6640802,
FT                   6645082..6645246,6646575..6646666,6650490..6650581,
FT                   6650812..6650989,6651798..6651977,6652893..6653052,
FT                   6657314..6657493,6662474..6662616,6665623..6665720,
FT                   6666439..6666671,6667658..6667792,6669294..6669494,
FT                   6671014..6671157,6672730..6672880,6675232..6675388,
FT                   6675488..6675641,6677234..6677385,6680689..6680729,
FT                   6680803..6680852,6681653..6681846)
FT                   /locus_tag="mCG_10240"
FT                   /product="mCG10240"
FT                   /note="gene_id=mCG10240.2 transcript_id=mCT10460.2 created
FT                   on 21-JUN-2002"
FT   CDS             join(6587864..6587922,6591508..6591599,6592922..6593071,
FT                   6595108..6595985,6596723..6596901,6597634..6597825,
FT                   6600022..6600212,6600760..6600912,6601576..6601827,
FT                   6604218..6604408,6604491..6604591,6604843..6605014,
FT                   6605734..6605904,6608595..6608789,6611366..6611551,
FT                   6613256..6613348,6615482..6615612,6618240..6618383,
FT                   6620899..6620992,6623551..6623676,6627681..6627887,
FT                   6629182..6629295,6633808..6633923,6635883..6636003,
FT                   6637441..6637578,6638395..6638587,6640624..6640802,
FT                   6645082..6645246,6646575..6646666,6650490..6650581,
FT                   6650812..6650989,6651798..6651977,6652893..6653052,
FT                   6657314..6657493,6662474..6662616,6665623..6665720,
FT                   6666439..6666671,6667658..6667792,6669294..6669494,
FT                   6671014..6671157,6672730..6672880,6675232..6675388,
FT                   6675488..6675641,6677234..6677385,6680689..6680729,
FT                   6680803..6680852,6681653..6681826)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10240"
FT                   /product="mCG10240"
FT                   /note="gene_id=mCG10240.2 transcript_id=mCT10460.2
FT                   protein_id=mCP21306.2"
FT                   /protein_id="EDL20944.1"
FT                   /translation="MGDHGLELASMIPALRELASATPEEYNTVVQKPRQILCQFIDRIL
FT                   TDVNVVALELVKKTDAQPTSVMLLDFIQHIMKSSPLMFVNVNGSQGQNEAKDSCIEFSH
FT                   WIITRLLRIAATPSCHMLHKKICEVICSLLFLFKSKNPAIFGVLTRELLYLFEDLIYLH
FT                   KRNAVGEVMEWPVVVSRFLSRLDEHMGCLQPAPLQFMNVQNVEFIEVTLLMVLIHIVPT
FT                   VFFRRQELLLWQIGCALLEHGSPKIRSLAISLLTELFELGGLPAQPASTFFSLFLELLQ
FT                   HLVGMDADQLKLYEEPLSKLVKTLFPFEAEAYRNIEPVYLNVLLEKLSVMFEDRVLMRL
FT                   KSDLLKAALCHLLQYFLTFVPAGYESALQVRKVYVTNICRALVDALGVQKHVGYLLGPF
FT                   YAALKMESKEIIERIQCQAQQENLSGNNDEVSPKRRKLSSSLSSYKKPSRQPEEIIHVD
FT                   MDKKSILWNVLKQKAESLQISLECGTLKNSVAEALEGITVVLQLTALCTVHCSHQDMDG
FT                   HNVKDHQHKYKKKPPVVVTWMSLDFYTKVLKSCRSLLESVQKLELELVIDSMVRICDAL
FT                   MYMQVKSSFKDHVLEELCGMLSLPWIYSYSDDNSLKMTTFATNLLPLSQRVWDSYYRVK
FT                   DDSDMVKKEFASVLGQLVCTLHGMFYLSSSVEPCFEHMDLFSKNLKATSQHECSSSQVK
FT                   ASTCKPFLFLLTKNTPSPVKLAFIDNLHHLCKHLDFQEDEREVKAVLGTLLNLMEDPDK
FT                   DVRIAFSGNIKYILESLNSEDGFVKELFVLRMKEAYTHAQIARNNELKDTLILTTGDIG
FT                   RAAKGDLIPFALLHLLHCLLSKSASVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQF
FT                   LVESLHSSQMTALPSAPCQSSEIRKQDVAHHREMALNTLSEIANVFDFPDLNRFLTRTL
FT                   QVLLPDLAAKASPAASALIRTLGKQLNVSRREILINNFKYIFSHLVCSCSKDELERALH
FT                   YLKNETEIELGSLLRQDFQGLHNELLLRIGEHYQQVFNGLSILASFASSDDPYQGPRDI
FT                   TSPELMADYLQPKLLGILAFFNMQLLSSSVGIEDKKMALTSLMSLMKLMGPKHVSSVRV
FT                   KMMTTLRTGLRFKDDFPELCCRAWDCFVRCLDHAYLGPLLSHVIVALLPLIHMQPKETA
FT                   AIFHYLIIENRDAVQDFLHEIYFLPDHPELEKIKAVLQEYRKETSETTDLQTTLQLSMK
FT                   AIQHENVDVRIHALTSLKETLYKNQEKLIKYATDSETVEPVISQLVTVILKGCQDANSQ
FT                   ARLLCGECLGELGAIDPGRLDFSTTETQGKDFTFVTGVEDLSFAYGLLMELTRAYLAYA
FT                   DNSRAQDSAAYAIQELLSIYDCREMQSNGPGYQLWKRFPEHVREILEPHLNTRYKSSQK
FT                   STDWSGVTKPIYLSKLGNNFAEWSSSWAGYLITKVRDNLASKIFTCCSIMMKHDFKVTI
FT                   YLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHDEQHAISTQDSASDLCQLSTQTVFSVL
FT                   DHLTQWARHKFQALNAEKLAQNKPKGVSNVNFEDYQSVTRFLDLIPQDTLAVASFRSKA
FT                   YTRAVMHFESFITEKKQNIQKHLGFLQKLYAAMHEPDGVAGVSAIRKAEPSLKEQILEH
FT                   ESIGLLRDATACYDRAIQLEPDQIIHYHGVVKSMLGLGQLSTVITQVNGVHANRSEWTD
FT                   ELNTYRVEAAWKLSQWDLVENYLAADGKSTTWSVRLGQLLLSAKKRDTTTFYDTLKLVR
FT                   AEQIVPLSAASFERGSYQRGYEFIVRLHMLCELEHSLKPLFRKSPGDSCNEDSLNWGAR
FT                   LEMTQNSYRAKEPILALRRALLSLNKRPDYNEMVGECWLQSARVARKAGHHQTAYNALL
FT                   NAGESRLAELYVERAKWLWSKGDVHQALIVLQKGVELCFPENKSPSESKHMLIHGRATL
FT                   LVGRFMEETANFESNAVMKKYKDVTLFLPEWEDGHFYLAKYYDKLMPMVTDNKMEKQGD
FT                   LIRYIVLHFGRSLQYGNQFIYQSMPRMLSLWLDFGAKAYEWEKGGRSDRLQMRNDLAKI
FT                   NSVLTEHTNRLAPYQFLTAFSQLISRICHSHDEVFVVLMEIIAKVFLAYPQQAMWMMTA
FT                   VSKSSYPMRVNRCKEILTKAIHMKKSLEKFVGDATRLTDKLLELCNKSVDGSNSTLSMS
FT                   THFKMLKRLVEDPTFSEILIPLQSVMIPTLPSVLGAHANHDPFPGHWAYLAGFDDVVEI
FT                   LSSLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINKSLRKDAESRRRELH
FT                   IRTYAVIPLNDECGIIEWVNNTAGLRPILTKIYKEKGVYMTGKELRQCMLPKSAALSEK
FT                   LKVFQELLLPRHPPVFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGE
FT                   NILFDSFTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEV
FT                   TLRLMRDQREPLMSVLKTFLHDPLVEWIHSKAPLNETGQVVNEKAKTHVLDIEQRLQGV
FT                   IKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM"
FT   gene            complement(6672193..>6689598)
FT                   /locus_tag="mCG_146220"
FT                   /note="gene_id=mCG146220.0"
FT   mRNA            complement(join(6672193..6673883,6676006..6676244,
FT                   6689433..>6689598))
FT                   /locus_tag="mCG_146220"
FT                   /product="mCG146220"
FT                   /note="gene_id=mCG146220.0 transcript_id=mCT186323.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(6676043..>6676240)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146220"
FT                   /product="mCG146220"
FT                   /note="gene_id=mCG146220.0 transcript_id=mCT186323.0
FT                   protein_id=mCP107618.0"
FT                   /protein_id="EDL20945.1"
FT                   /translation="IYGLFHLPVIADSNPKKIGHRNRNYLLIFLQNCKRRKILMFLKMD
FT                   PLALIYSQGPTLVLFVVAVI"
FT   assembly_gap    6680737..6680798
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   gene            6684965..6787832
FT                   /gene="Xrn1"
FT                   /locus_tag="mCG_117319"
FT                   /note="gene_id=mCG117319.1"
FT   mRNA            join(6684965..6685148,6694176..6694408,6697917..6698014,
FT                   6699438..6699547,6699652..6699762,6700910..6700992,
FT                   6703460..6703547,6703631..6703799,6704577..6704644,
FT                   6704943..6705080,6707711..6707777,6707978..6708083,
FT                   6709316..6709405,6711955..6712111,6715364..6715483,
FT                   6719017..6719186,6721154..6721274,6721367..6721465,
FT                   6725278..6725381,6728394..6728525,6729592..6729754,
FT                   6732313..6732426,6734022..6734120,6736175..6736290,
FT                   6736878..6737024,6741386..6741475,6741699..6741834,
FT                   6747927..6747983,6748223..6748355,6751982..6752051,
FT                   6754199..6754397,6757015..6757110,6763762..6763870,
FT                   6765812..6765873,6768796..6768906,6769056..6769178,
FT                   6769877..6770033,6775772..6775947,6778373..6778475,
FT                   6781626..6781786,6782546..6787832)
FT                   /gene="Xrn1"
FT                   /locus_tag="mCG_117319"
FT                   /product="5'-3' exoribonuclease 1"
FT                   /note="gene_id=mCG117319.1 transcript_id=mCT118456.1
FT                   created on 21-JUN-2002"
FT   CDS             join(6685074..6685148,6694176..6694408,6697917..6698014,
FT                   6699438..6699547,6699652..6699762,6700910..6700992,
FT                   6703460..6703547,6703631..6703799,6704577..6704644,
FT                   6704943..6705080,6707711..6707777,6707978..6708083,
FT                   6709316..6709405,6711955..6712111,6715364..6715483,
FT                   6719017..6719186,6721154..6721274,6721367..6721465,
FT                   6725278..6725381,6728394..6728525,6729592..6729754,
FT                   6732313..6732426,6734022..6734120,6736175..6736290,
FT                   6736878..6737024,6741386..6741475,6741699..6741834,
FT                   6747927..6747983,6748223..6748355,6751982..6752051,
FT                   6754199..6754397,6757015..6757110,6763762..6763870,
FT                   6765812..6765873,6768796..6768906,6769056..6769178,
FT                   6769877..6770033,6775772..6775947,6778373..6778475,
FT                   6781626..6781786,6782546..6782842)
FT                   /codon_start=1
FT                   /gene="Xrn1"
FT                   /locus_tag="mCG_117319"
FT                   /product="5'-3' exoribonuclease 1"
FT                   /note="gene_id=mCG117319.1 transcript_id=mCT118456.1
FT                   protein_id=mCP68530.1"
FT                   /protein_id="EDL20946.1"
FT                   /translation="MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSH
FT                   PNDDDVHFRISDDKIFTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRS
FT                   AKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQG
FT                   VTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFS
FT                   LLREEVRFGGKKTQRVCAPEETTFHLLHLSLMREYIDYEFSALKEKITFKYDIEKIIDD
FT                   WILMGFLVGNDFIPHLPHLHINHDALPLLYGTYIAILPELGGYINESGHLNLPRFERYL
FT                   VKLSDFDREHFSEVFVDLKWFESKVGNKYLNEAAGAAAEEAKNCKEKRKPKGQENSLSW
FT                   AALDKSEGEGVASRDNFEDETEDDDLFETEFRQYKRTYYMTKMGVDVVSDEFLANQAAC
FT                   YVQAIQWILHYYYHGVQSWSWYYPYHYAPFLSDIRSISTLKIHFELGKPFKPFEQLLAV
FT                   LPSASKNLLPTCYQHLMTSEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDETRLLE
FT                   AMETCNHSLKKEERKRNQHSECLMCWYDRDTEFTYSSPWPEKFPAIERCCTRYKMISLD
FT                   AWRVDINKNKITRVDQKALYFCGFPTLKHIKHKFFLKKSGVQVFQQSSRGENLMLEISV
FT                   NAEPDELRIENIASAVLGKAVFVNWPHLEEARVVAVSDGETKFYIEEPPGTQKVYLGKT
FT                   APPSKVIQLTDKEQSNWTKEIQGISEQYLRRKGIIINETSAVVYAQLLTGRKYQISQNG
FT                   EVRLEKQWSKQILPFVYQTIVKDIRAFDSRFSNIKTLDDLFPPRTMVFMLGTPYYGCTG
FT                   EVQDSGDLITEGRIRVVFSIPCEPNLDALIQNQHKYSIKYNPGYVLAGRLGVSGYLVSR
FT                   FTGSIFIGRGSRRNPHGDHKANVGLNLKFNKKNEEVPGYTKKVGNEWMYSSAAEQLLAE
FT                   YIERAPELFSYIAKNSQEDVFYEDDIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCD
FT                   LHILDAAIVEKIEEEVEKCKQRKSNKKVRVTVKPHLLYRPLEQQHGVIPDRDAEFRLFD
FT                   RVVNVRESFSVPVGLRGTVIGIKGASREADVLFEVLFDEEFPGGLTIRCSPGRGYRLPT
FT                   SALVNLSHGSRCETGNQKLTAIVKPQPSVSHCSAAPSGHLGGLNHSPQSPFLPTQVPTK
FT                   GDDEFCNIWQSLQGAGKIQHLQPTVQEKGAVLPQEISQVTEGHKSGFTDHSVRHQQRKH
FT                   DSQRKFKEEYKSPKAECQSQKLSSKQTSGGSARCSIKLLKRNESPGTSEAQKVVTSYPN
FT                   AVHKPPSGIENFLASLNLSKENEAQLPHHGEPPDEADLSPQSFAMKGTRMLKEILKIDS
FT                   PDTRDSKNDMKKSDNEATVSSRRDERGVSAHPKPSKKLTCHMNKPHGTNEFQNVASVDS
FT                   VCWPGQMPPVSTPVTELSRICSLVGMPQPDFSFLRTTQGSLGVSFPLPPPIFTNYPPAV
FT                   PPGAVPPVFTQPTANIMPSSSHLFGSVSWRPPVPVAGNAFHYPSYPGTMPLAGGVPGGV
FT                   HSQFIPLQVTKKRVANRKNFENKEAQSSQATPLQTNKPGSSEATKMTPQESPPASSSSS
FT                   QAAQPVSSHVETASQGHVGSQPRSAPSSSKRKSRKLAVNFSVSKPSE"
FT   assembly_gap    6700308..6700424
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            6740296..6793865
FT                   /locus_tag="mCG_147713"
FT                   /note="gene_id=mCG147713.0"
FT   mRNA            join(6740296..6740351,6744680..6744754,6748814..6748845,
FT                   6790780..6793865)
FT                   /locus_tag="mCG_147713"
FT                   /product="mCG147713"
FT                   /note="gene_id=mCG147713.0 transcript_id=mCT187976.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    6770167..6770409
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    6773968..6774305
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   assembly_gap    6777479..6778151
FT                   /estimated_length=673
FT                   /gap_type="unknown"
FT   CDS             6792651..6793028
FT                   /codon_start=1
FT                   /locus_tag="mCG_147713"
FT                   /product="mCG147713"
FT                   /note="gene_id=mCG147713.0 transcript_id=mCT187976.0
FT                   protein_id=mCP108540.0"
FT                   /protein_id="EDL20947.1"
FT                   /translation="MSILKKWVWEGYKESIWCRCSNSGLAPAVVAREIFRLFPSNQYHK
FT                   HLTVSFISGHTHGFKERSKHWQIHRFKEQPEHCEPISEASSANNEIYFANFRASVTFYK
FT                   TMTKTTLIKDKRFIPLSRQKA"
FT   assembly_gap    6807286..6808596
FT                   /estimated_length=1311
FT                   /gap_type="unknown"
FT   assembly_gap    6811235..6811254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6815773..6816094
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    6827810..6828025
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   gene            <6839579..6904672
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /note="gene_id=mCG117324.1"
FT   mRNA            join(6839579..6839790,6849253..6849346,6853635..6853710,
FT                   6858012..6858105,6860806..6860937,6865943..6866040,
FT                   6871007..6871067,6873352..6873478,6875664..6875768,
FT                   6891649..6891743,6894881..6894984,6896421..6896480,
FT                   6897610..6897743,6898993..6904672)
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /product="RIKEN cDNA C330018K18, transcript variant
FT                   mCT118461"
FT                   /note="gene_id=mCG117324.1 transcript_id=mCT118461.1
FT                   created on 21-JUN-2002"
FT   mRNA            join(<6839579..6839790,6849253..6849346,6853635..6853710,
FT                   6858012..6858105,6860806..6860937,6865943..6866018,
FT                   6870487..6870548,6870706..6870779,6871007..6871067,
FT                   6873352..6873478,6875664..6875768,6891649..6891743,
FT                   6894881..6894984,6896421..6896480,6897610..6897743,
FT                   6898993..6900270)
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /product="RIKEN cDNA C330018K18, transcript variant
FT                   mCT191554"
FT                   /note="gene_id=mCG117324.1 transcript_id=mCT191554.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<6839584..6839790,6849253..6849346,6853635..6853710,
FT                   6858012..6858105,6860806..6860937,6865943..6866018,
FT                   6870487..6870548,6870706..6870779,6871007..6871067,
FT                   6873352..6873478,6875664..6875768,6891649..6891743,
FT                   6894881..6894984,6896421..6896480,6897610..6897743,
FT                   6898993..6899141)
FT                   /codon_start=1
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /product="RIKEN cDNA C330018K18, isoform CRA_b"
FT                   /note="gene_id=mCG117324.1 transcript_id=mCT191554.0
FT                   protein_id=mCP112465.0 isoform=CRA_b"
FT                   /protein_id="EDL20949.1"
FT                   /translation="LRAGRPVATAVFGVAMSGQQERAERQREELSASASPPSRFVLGLD
FT                   VGSTVIRCHVYDQTARVRGSSAQKVENVYPQPGWVEIDPDSLWAQFVAVIKDAVKAAGV
FT                   QMNQIVGLGISTQRATFITWNKKTGHHFHNFISWQDLRAAELVKSWNNSLIMKLLHGAT
FT                   RVLHFFSRSKVMLTVSRFNFSTQHATLRLTWILQNLSEVKRAVEEDNCCFGTIDTWLLY
FT                   KLTKGSSYATDYSNASTTGFFDPYAMRWSRLITTMVSIPLSILPPVKDTSYNFGSVDEK
FT                   IFGVPIPVVALVGDQQSAMFGECCFETGDVKLTMGTGTFLDINTGKNLQHVNGGFYPLI
FT                   GWKIGQELVCLAEGNAGDTGTAIMWAQKLDLFTDAAETEKMALSLEDSEGVYFVPSFSG
FT                   LQAPLNDPCACASFMGLKHSTNKYHLVRAILESIAFRNKQLYDMLQREIQIPVTNIRAD
FT                   GGVCNNAFVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVGFWADKEELQKLRQSEM
FT                   VFKPQKKWQEYEVNMENWVKAVKRSMNWYNKT"
FT   mRNA            join(<6839605..6839790,6849253..6849346,6853635..6853710,
FT                   6858012..6858105,6860806..6860937,6865943..6866018,
FT                   6870487..6870548,6870706..6870779,6871007..6871067,
FT                   6873352..6873478,6875664..6875768,6891649..6891743,
FT                   6894881..6894984,6896421..6896480,6897610..6897743,
FT                   6898993..6899078,6901844..6903025)
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /product="RIKEN cDNA C330018K18, transcript variant
FT                   mCT191555"
FT                   /note="gene_id=mCG117324.1 transcript_id=mCT191555.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<6839605..6839790,6849253..6849346,6853635..6853710,
FT                   6858012..6858105,6860806..6860937,6865943..6866018,
FT                   6870487..6870548,6870706..6870779,6871007..6871067,
FT                   6873352..6873478,6875664..6875768,6891649..6891743,
FT                   6894881..6894984,6896421..6896480,6897610..6897743,
FT                   6898993..6899078,6901844..6901852)
FT                   /codon_start=1
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /product="RIKEN cDNA C330018K18, isoform CRA_c"
FT                   /note="gene_id=mCG117324.1 transcript_id=mCT191555.0
FT                   protein_id=mCP112466.0 isoform=CRA_c"
FT                   /protein_id="EDL20950.1"
FT                   /translation="ATAVFGVAMSGQQERAERQREELSASASPPSRFVLGLDVGSTVIR
FT                   CHVYDQTARVRGSSAQKVENVYPQPGWVEIDPDSLWAQFVAVIKDAVKAAGVQMNQIVG
FT                   LGISTQRATFITWNKKTGHHFHNFISWQDLRAAELVKSWNNSLIMKLLHGATRVLHFFS
FT                   RSKVMLTVSRFNFSTQHATLRLTWILQNLSEVKRAVEEDNCCFGTIDTWLLYKLTKGSS
FT                   YATDYSNASTTGFFDPYAMRWSRLITTMVSIPLSILPPVKDTSYNFGSVDEKIFGVPIP
FT                   VVALVGDQQSAMFGECCFETGDVKLTMGTGTFLDINTGKNLQHVNGGFYPLIGWKIGQE
FT                   LVCLAEGNAGDTGTAIMWAQKLDLFTDAAETEKMALSLEDSEGVYFVPSFSGLQAPLND
FT                   PCACASFMGLKHSTNKYHLVRAILESIAFRNKQLYDMLQREIQIPVTNIRADGGVCNNA
FT                   FVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVGFWADKEELQKLRQSEMVFKPQKK
FT                   WQEYEAF"
FT   CDS             join(6839629..6839790,6849253..6849346,6853635..6853710,
FT                   6858012..6858105,6860806..6860937,6865943..6866040,
FT                   6871007..6871067,6873352..6873478,6875664..6875768,
FT                   6891649..6891743,6894881..6894984,6896421..6896480,
FT                   6897610..6897743,6898993..6899141)
FT                   /codon_start=1
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /product="RIKEN cDNA C330018K18, isoform CRA_a"
FT                   /note="gene_id=mCG117324.1 transcript_id=mCT118461.1
FT                   protein_id=mCP68751.1 isoform=CRA_a"
FT                   /protein_id="EDL20948.1"
FT                   /translation="MSGQQERAERQREELSASASPPSRFVLGLDVGSTVIRCHVYDQTA
FT                   RVRGSSAQKVENVYPQPGWVEIDPDSLWAQFVAVIKDAVKAAGVQMNQIVGLGISTQRA
FT                   TFITWNKKTGHHFHNFISWQDLRAAELVKSWNNSLIMKLLHGATRVLHFFSRSKVMLTV
FT                   SRFNFSTQHATLRLTWILQNLSEVKRAVEEDNCCFGTIDTWLLYKLTKGKVDITDLYNF
FT                   GSVDEKIFGVPIPVVALVGDQQSAMFGECCFETGDVKLTMGTGTFLDINTGKNLQHVNG
FT                   GFYPLIGWKIGQELVCLAEGNAGDTGTAIMWAQKLDLFTDAAETEKMALSLEDSEGVYF
FT                   VPSFSGLQAPLNDPCACASFMGLKHSTNKYHLVRAILESIAFRNKQLYDMLQREIQIPV
FT                   TNIRADGGVCNNAFVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVGFWADKEELQK
FT                   LRQSEMVFKPQKKWQEYEVNMENWVKAVKRSMNWYNKT"
FT   assembly_gap    6856345..6856390
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    6876787..6877639
FT                   /estimated_length=853
FT                   /gap_type="unknown"
FT   assembly_gap    6898404..6898423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6911875..6911962
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   gene            6916401..7036895
FT                   /gene="Tfdp2"
FT                   /locus_tag="mCG_117096"
FT                   /note="gene_id=mCG117096.1"
FT   mRNA            join(6916401..6916657,6922226..6922283,6942366..6942470,
FT                   6951940..6952006,6992677..6992780,7005855..7005976,
FT                   7008828..7008875,7015491..7015634,7018244..7018312,
FT                   7024575..7024726,7028352..7028518,7035288..7035393,
FT                   7035599..7036895)
FT                   /gene="Tfdp2"
FT                   /locus_tag="mCG_117096"
FT                   /product="transcription factor Dp 2, transcript variant
FT                   mCT118463"
FT                   /note="gene_id=mCG117096.1 transcript_id=mCT118463.1
FT                   created on 21-JUN-2002"
FT   assembly_gap    6922988..6923281
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    6936696..6936715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6941626..6941645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(6942456..6942470,6951940..6952006,6992677..6992780,
FT                   7005855..7005976,7008828..7008875,7015491..7015536)
FT                   /codon_start=1
FT                   /gene="Tfdp2"
FT                   /locus_tag="mCG_117096"
FT                   /product="transcription factor Dp 2, isoform CRA_b"
FT                   /note="gene_id=mCG117096.1 transcript_id=mCT118463.1
FT                   protein_id=mCP68783.1 isoform=CRA_b"
FT                   /protein_id="EDL20952.1"
FT                   /translation="MTAKNVGLPSTNAELRGFIDQNFSPTKGNISLVAFPVSSTNSPTK
FT                   ILPKTLGPINVNVGPQMIISTPQRIANSGSVLIGNPYTPAPAMVTQTHIAEAAGWVPSD
FT                   RKRAREFIDSDFSERLMIRRTLDEEFMML"
FT   assembly_gap    6958667..6959265
FT                   /estimated_length=599
FT                   /gap_type="unknown"
FT   assembly_gap    6974005..6974024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(6977584..6977713,6992677..6992780,7005855..7005976,
FT                   7008828..7008875,7015491..7015634,7018244..7018312,
FT                   7024575..7024726,7028352..7028518,7035288..7035393,
FT                   7035599..7036895)
FT                   /gene="Tfdp2"
FT                   /locus_tag="mCG_117096"
FT                   /product="transcription factor Dp 2, transcript variant
FT                   mCT118229"
FT                   /note="gene_id=mCG117096.1 transcript_id=mCT118229.1
FT                   created on 21-JUN-2002"
FT   CDS             join(6977683..6977713,6992677..6992780,7005855..7005976,
FT                   7008828..7008875,7015491..7015536)
FT                   /codon_start=1
FT                   /gene="Tfdp2"
FT                   /locus_tag="mCG_117096"
FT                   /product="transcription factor Dp 2, isoform CRA_a"
FT                   /note="gene_id=mCG117096.1 transcript_id=mCT118229.1
FT                   protein_id=mCP68766.1 isoform=CRA_a"
FT                   /protein_id="EDL20951.1"
FT                   /translation="MYNSNYAGLVSNISLVAFPVSSTNSPTKILPKTLGPINVNVGPQM
FT                   IISTPQRIANSGSVLIGNPYTPAPAMVTQTHIAEAAGWVPSDRKRAREFIDSDFSERLM
FT                   IRRTLDEEFMML"
FT   assembly_gap    6997979..6998201
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    7000266..7000285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7001845..7001864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7012644..7014850
FT                   /estimated_length=2207
FT                   /gap_type="unknown"
FT   assembly_gap    7019507..7019526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7029722..7029746
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            complement(7050495..7083813)
FT                   /locus_tag="mCG_21656"
FT                   /note="gene_id=mCG21656.2"
FT   mRNA            complement(join(7050495..7051502,7053174..7053257,
FT                   7056455..7056505,7057997..7058181,7061055..7061162,
FT                   7063746..7063874,7083545..7083813))
FT                   /locus_tag="mCG_21656"
FT                   /product="mCG21656, transcript variant mCT20299"
FT                   /note="gene_id=mCG21656.2 transcript_id=mCT20299.2 created
FT                   on 24-JUN-2002"
FT   mRNA            complement(join(7050495..7051502,7053174..7053257,
FT                   7056455..7056505,7057997..7058181,7061055..7061162,
FT                   7063746..7063874,7067175..7067364))
FT                   /locus_tag="mCG_21656"
FT                   /product="mCG21656, transcript variant mCT170324"
FT                   /note="gene_id=mCG21656.2 transcript_id=mCT170324.0 created
FT                   on 24-JUN-2002"
FT   CDS             complement(join(7051332..7051502,7053174..7053257,
FT                   7056455..7056505,7057997..7058181,7061055..7061162,
FT                   7063746..7063874,7083545..7083653))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21656"
FT                   /product="mCG21656, isoform CRA_b"
FT                   /note="gene_id=mCG21656.2 transcript_id=mCT20299.2
FT                   protein_id=mCP21344.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q544Q7"
FT                   /db_xref="InterPro:IPR000402"
FT                   /db_xref="MGI:MGI:107788"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Q7"
FT                   /protein_id="EDL20954.1"
FT                   /translation="MTKTEKKSFHQSLAEWKLFIYNPSSGEFLGRTSKSWGLILLFYLV
FT                   FYGFLAALFTFTMWAMLQTLNDEVPKYRDQIPSPGLMVFPKPQTALEYTFSMSEPQTYK
FT                   KLVEDLESFLKPYSVEEQKNLTSCPDGAPFIQHGPDYRACQFPVSLLEECSGVTDANFG
FT                   YSKGQPCILVKMNRIIDLIPDGYPQISCLPKEENATIATYPEFGVLDLKYFPYYGKKRH
FT                   VGYRQPLVAVQVKFDSGLNKKEVTVECHIAGTRNLKNKNERDKFLGRVSFKVTARA"
FT   CDS             complement(join(7051332..7051502,7053174..7053257,
FT                   7056455..7056505,7057997..7058181,7061055..7061162,
FT                   7063746..7063874,7067175..7067211))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21656"
FT                   /product="mCG21656, isoform CRA_a"
FT                   /note="gene_id=mCG21656.2 transcript_id=mCT170324.0
FT                   protein_id=mCP93242.0 isoform=CRA_a"
FT                   /protein_id="EDL20953.1"
FT                   /translation="MMTSRDHRIESAGLILLFYLVFYGFLAALFTFTMWAMLQTLNDEV
FT                   PKYRDQIPSPGLMVFPKPQTALEYTFSMSEPQTYKKLVEDLESFLKPYSVEEQKNLTSC
FT                   PDGAPFIQHGPDYRACQFPVSLLEECSGVTDANFGYSKGQPCILVKMNRIIDLIPDGYP
FT                   QISCLPKEENATIATYPEFGVLDLKYFPYYGKKRHVGYRQPLVAVQVKFDSGLNKKEVT
FT                   VECHIAGTRNLKNKNERDKFLGRVSFKVTARA"
FT   assembly_gap    7073834..7073853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7074907..7074926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7089516..7091538
FT                   /estimated_length=2023
FT                   /gap_type="unknown"
FT   assembly_gap    7092497..7092992
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   assembly_gap    7094105..7094151
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    7098408..7098427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7099709..7099728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7101184..7101203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7105182..7105211
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    7118399..7118477
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    7147634..7147733
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    7174023..7174042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7193063..7200712)
FT                   /locus_tag="mCG_21643"
FT                   /note="gene_id=mCG21643.2"
FT   mRNA            complement(join(7193063..7193969,7196076..7196123,
FT                   7200525..7200712))
FT                   /locus_tag="mCG_21643"
FT                   /product="mCG21643"
FT                   /note="gene_id=mCG21643.2 transcript_id=mCT20286.2 created
FT                   on 24-JUN-2002"
FT   CDS             complement(join(7193851..7193969,7196076..7196123,
FT                   7200525..7200699))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21643"
FT                   /product="mCG21643"
FT                   /note="gene_id=mCG21643.2 transcript_id=mCT20286.2
FT                   protein_id=mCP21351.2"
FT                   /protein_id="EDL20955.1"
FT                   /translation="MADVEDGEEPCVLSSHSGSAGSKSGGDKMFSLKKWNAVAMWSWDV
FT                   ECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQ
FT                   DWVVQRIGK"
FT   assembly_gap    7213125..7213144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7240025..7240044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7247319..7247569
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    7248704..7248967
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   gene            7260312..7260913
FT                   /pseudo
FT                   /locus_tag="mCG_21647"
FT                   /note="gene_id=mCG21647.1"
FT   mRNA            7260312..7260913
FT                   /pseudo
FT                   /locus_tag="mCG_21647"
FT                   /note="gene_id=mCG21647.1 transcript_id=mCT20290.1 created
FT                   on 24-JUN-2002"
FT   gene            complement(7262367..7354474)
FT                   /gene="Rasa2"
FT                   /locus_tag="mCG_21645"
FT                   /note="gene_id=mCG21645.2"
FT   mRNA            complement(join(7262367..7265541,7267345..7267531,
FT                   7267854..7267957,7268655..7268863,7269313..7269395,
FT                   7275369..7275475,7276179..7276252,7280466..7280543,
FT                   7283764..7283847,7289082..7289188,7291430..7291553,
FT                   7292086..7292160,7292757..7292871,7293732..7293880,
FT                   7294931..7295087,7299352..7299453,7300539..7300615,
FT                   7303553..7303625,7305805..7305888,7315013..7315089,
FT                   7325761..7325855,7329141..7329244,7334430..7334547,
FT                   7354335..7354474))
FT                   /gene="Rasa2"
FT                   /locus_tag="mCG_21645"
FT                   /product="RAS p21 protein activator 2"
FT                   /note="gene_id=mCG21645.2 transcript_id=mCT20289.2 created
FT                   on 24-JUN-2002"
FT   CDS             complement(join(7265511..7265541,7267345..7267531,
FT                   7267854..7267957,7268655..7268863,7269313..7269395,
FT                   7275369..7275475,7276179..7276252,7280466..7280543,
FT                   7283764..7283847,7289082..7289188,7291430..7291553,
FT                   7292086..7292160,7292757..7292871,7293732..7293880,
FT                   7294931..7295087,7299352..7299453,7300539..7300615,
FT                   7303553..7303625,7305805..7305888,7315013..7315089,
FT                   7325761..7325855,7329141..7329244,7334430..7334547,
FT                   7354335..7354464))
FT                   /codon_start=1
FT                   /gene="Rasa2"
FT                   /locus_tag="mCG_21645"
FT                   /product="RAS p21 protein activator 2"
FT                   /note="gene_id=mCG21645.2 transcript_id=mCT20289.2
FT                   protein_id=mCP21275.2"
FT                   /db_xref="GOA:P58069"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001562"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="MGI:MGI:2149960"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58069"
FT                   /protein_id="EDL20956.1"
FT                   /translation="MAAAAPAAAASPEAPAVSGSADPETGDEDSREVRVLQSLRGRIYE
FT                   AKNLLPYLGPNKMRDCFCTINLDQEEVYRTQVVEKSLSPYFSEEFYFEIPRTFQYLSFY
FT                   VYDKNVLQRDLRIGKVAIKKEDLCSHSGKETWFSLQPIDSNSEVQGKVHLELRLNELIT
FT                   ENGTVCQQLVVHIKACHGLPLINGQSCDPYATVSLVGPSRNDQKKTKVKKKTSNPQFNE
FT                   VFYFEVTRSSSYSRKSQFQVEEEDIEKLEIRIDLWNNENLVQDVFLGEIKVPVNVLRSD
FT                   SFHQAWYLLQPRDNGNKSSKTDDLGSLLLTLCYTEDCVLPSEYYGPLKTLLLKSPDVQP
FT                   VSASAAYILGEICQDQKDAVLPLVRLLLHHNKLVPFITAVAELDLKDTPDANAIFRGNS
FT                   LATQCLTEMMKIVGGHYLKVTLKPVLDEICESSKSCEIDPVKLKEGDNVENNKENLYYY
FT                   VDKVFNTIVGSSVSCPTVMCDIFYSLRQMAAKKFPNHPHVQYSAVSSFVFLRFFAVAIL
FT                   SPHAFHLRPHYPDTQTVRTLTLISKTIQIIGNWGCQSRKKSRFKKSVMCEFLKMFQEER
FT                   YFTDVKKFLDEISSTETKESSGTSEPVHLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSR
FT                   ELTYHRQQGKDAIYTIPVKNILAVEKLEEGSFNKKNMFQVIHTEKTLYIQANNCVEANE
FT                   WIDVLCRVSRCNHNRLSSFHPSAYLNGNWLCCQETSESTPGCKPCTAGIPADIQIDIDE
FT                   DRETERIYSIFTLSLLKLQKMEETCGSIAVYQGPQKEPGYSKFTIEDSVATFKTIQQIK
FT                   STIEKLDEPHEKYRKKRSSSAKYGSKENPIVGKIS"
FT   assembly_gap    7340483..7340502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7353720..7354223
FT                   /estimated_length=504
FT                   /gap_type="unknown"
FT   gene            complement(<7404751..7475413)
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /note="gene_id=mCG21644.1"
FT   mRNA            complement(join(<7404751..7408341,7437549..7437648,
FT                   7450605..7451053,7451559..7451624,7474007..7474088,
FT                   7475086..7475413))
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38,
FT                   transcript variant mCT170323"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT170323.0 created
FT                   on 24-JUN-2002"
FT   mRNA            complement(join(<7404751..7408341,7437549..7437648,
FT                   7450605..7451053,7451559..7451624,7451992..7452081))
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38,
FT                   transcript variant mCT150472"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT150472.1 created
FT                   on 24-JUN-2002"
FT   mRNA            complement(join(<7404751..7408341,7437549..7437648,
FT                   7439125..7439190))
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38,
FT                   transcript variant mCT170322"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT170322.0 created
FT                   on 24-JUN-2002"
FT   mRNA            complement(join(<7404751..7408341,7437549..7437648,
FT                   7438699..7438782))
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38,
FT                   transcript variant mCT20288"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT20288.1 created
FT                   on 24-JUN-2002"
FT   CDS             complement(7404751..7408341)
FT                   /codon_start=1
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT150472.1
FT                   protein_id=mCP68822.1 isoform=CRA_a"
FT                   /protein_id="EDL20957.1"
FT                   /translation="MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFK
FT                   AHSNVLAASSLYFKNIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETV
FT                   TDLAAAGKKLGISFLEDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPR
FT                   ITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTASLCQERASVCHEVEPVRTLAEHS
FT                   YAVSSITEAYRSQPPREQDSSSSAKTGKETGDALATKAKPCRKPKPQTQDSDSTTENMP
FT                   LSLVTCPEVNQERSPQPAPDLSHSEPPSNEGDIHFPREDENQPSDAPGPGAAEVPPLVY
FT                   NCSCCSKSFDSSTLLSAHMQLHKPTQEPFVCKYCNKQFTTLNRLDRHEQICMRSSHVPI
FT                   PGGNPPFLENYPTIGQDGTSFRSPESLGPENRIGELSSAGSALSDADHMVKFVNGQMLY
FT                   SCIVCKRSYVTLSSLRRHANVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCI
FT                   FCLETFMTYYILKNHQKSFHAIDHRLSINKKTANGGLKPTVYPYKLYRLLPMRCKRAPY
FT                   KSYRNSSYVSAQGSSQRGESAPDTFIVPNLQSSEMPTLDFQDGRNTLPSSPAVPVETPS
FT                   RQGAPTSARVKNAEGIKWRKQAVKTNLVDNFDSTEVSVSSTGNTVSTTLQTEPACVSSV
FT                   GKGSEHSASVISYSGSVPSVIVHSSQFSSVIKHSNTIASLTNSNHKSPSQPVVSPSLIK
FT                   DSKPETDKASKSASRPKSIKEKKKTAPSNRGEITEEAKYIADHGGSSGKTTNAEETSKI
FT                   ETYIAKPALPGTSTNSNVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRKPKYQMQEET
FT                   LPRENDPETPGDSPLGLCQAECVEMSEAFDEVSDQDSTDKPWRPYYNYKPKKKSKQLRK
FT                   MRKVKWRKERRSRSPVGRCRYPAELDRAEVKLPPDKAFEEEEEEENKEMPKLQCELCDG
FT                   CPDGAAGAGAEGKPHQHLTSKPYICELCAKQFQSSSTLKMHMRCHTGEKPYQCKTCGRC
FT                   FSVQGNLQKHERIHLGVKEFICQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQGFLY
FT                   LSTKRNHERRHIREHDGKGFACFQCPKICKTAAALRMHQKKHLYKTLPKQEETGDTCHE
FT                   NADLLESQLCTDSEDSEQKDDIKAFAENVL"
FT   CDS             complement(7404751..7408341)
FT                   /codon_start=1
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT170322.0
FT                   protein_id=mCP93241.0 isoform=CRA_a"
FT                   /protein_id="EDL20958.1"
FT                   /translation="MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFK
FT                   AHSNVLAASSLYFKNIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETV
FT                   TDLAAAGKKLGISFLEDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPR
FT                   ITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTASLCQERASVCHEVEPVRTLAEHS
FT                   YAVSSITEAYRSQPPREQDSSSSAKTGKETGDALATKAKPCRKPKPQTQDSDSTTENMP
FT                   LSLVTCPEVNQERSPQPAPDLSHSEPPSNEGDIHFPREDENQPSDAPGPGAAEVPPLVY
FT                   NCSCCSKSFDSSTLLSAHMQLHKPTQEPFVCKYCNKQFTTLNRLDRHEQICMRSSHVPI
FT                   PGGNPPFLENYPTIGQDGTSFRSPESLGPENRIGELSSAGSALSDADHMVKFVNGQMLY
FT                   SCIVCKRSYVTLSSLRRHANVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCI
FT                   FCLETFMTYYILKNHQKSFHAIDHRLSINKKTANGGLKPTVYPYKLYRLLPMRCKRAPY
FT                   KSYRNSSYVSAQGSSQRGESAPDTFIVPNLQSSEMPTLDFQDGRNTLPSSPAVPVETPS
FT                   RQGAPTSARVKNAEGIKWRKQAVKTNLVDNFDSTEVSVSSTGNTVSTTLQTEPACVSSV
FT                   GKGSEHSASVISYSGSVPSVIVHSSQFSSVIKHSNTIASLTNSNHKSPSQPVVSPSLIK
FT                   DSKPETDKASKSASRPKSIKEKKKTAPSNRGEITEEAKYIADHGGSSGKTTNAEETSKI
FT                   ETYIAKPALPGTSTNSNVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRKPKYQMQEET
FT                   LPRENDPETPGDSPLGLCQAECVEMSEAFDEVSDQDSTDKPWRPYYNYKPKKKSKQLRK
FT                   MRKVKWRKERRSRSPVGRCRYPAELDRAEVKLPPDKAFEEEEEEENKEMPKLQCELCDG
FT                   CPDGAAGAGAEGKPHQHLTSKPYICELCAKQFQSSSTLKMHMRCHTGEKPYQCKTCGRC
FT                   FSVQGNLQKHERIHLGVKEFICQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQGFLY
FT                   LSTKRNHERRHIREHDGKGFACFQCPKICKTAAALRMHQKKHLYKTLPKQEETGDTCHE
FT                   NADLLESQLCTDSEDSEQKDDIKAFAENVL"
FT   CDS             complement(7404751..7408341)
FT                   /codon_start=1
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT170323.0
FT                   protein_id=mCP93240.0 isoform=CRA_a"
FT                   /protein_id="EDL20959.1"
FT                   /translation="MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFK
FT                   AHSNVLAASSLYFKNIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETV
FT                   TDLAAAGKKLGISFLEDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPR
FT                   ITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTASLCQERASVCHEVEPVRTLAEHS
FT                   YAVSSITEAYRSQPPREQDSSSSAKTGKETGDALATKAKPCRKPKPQTQDSDSTTENMP
FT                   LSLVTCPEVNQERSPQPAPDLSHSEPPSNEGDIHFPREDENQPSDAPGPGAAEVPPLVY
FT                   NCSCCSKSFDSSTLLSAHMQLHKPTQEPFVCKYCNKQFTTLNRLDRHEQICMRSSHVPI
FT                   PGGNPPFLENYPTIGQDGTSFRSPESLGPENRIGELSSAGSALSDADHMVKFVNGQMLY
FT                   SCIVCKRSYVTLSSLRRHANVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCI
FT                   FCLETFMTYYILKNHQKSFHAIDHRLSINKKTANGGLKPTVYPYKLYRLLPMRCKRAPY
FT                   KSYRNSSYVSAQGSSQRGESAPDTFIVPNLQSSEMPTLDFQDGRNTLPSSPAVPVETPS
FT                   RQGAPTSARVKNAEGIKWRKQAVKTNLVDNFDSTEVSVSSTGNTVSTTLQTEPACVSSV
FT                   GKGSEHSASVISYSGSVPSVIVHSSQFSSVIKHSNTIASLTNSNHKSPSQPVVSPSLIK
FT                   DSKPETDKASKSASRPKSIKEKKKTAPSNRGEITEEAKYIADHGGSSGKTTNAEETSKI
FT                   ETYIAKPALPGTSTNSNVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRKPKYQMQEET
FT                   LPRENDPETPGDSPLGLCQAECVEMSEAFDEVSDQDSTDKPWRPYYNYKPKKKSKQLRK
FT                   MRKVKWRKERRSRSPVGRCRYPAELDRAEVKLPPDKAFEEEEEEENKEMPKLQCELCDG
FT                   CPDGAAGAGAEGKPHQHLTSKPYICELCAKQFQSSSTLKMHMRCHTGEKPYQCKTCGRC
FT                   FSVQGNLQKHERIHLGVKEFICQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQGFLY
FT                   LSTKRNHERRHIREHDGKGFACFQCPKICKTAAALRMHQKKHLYKTLPKQEETGDTCHE
FT                   NADLLESQLCTDSEDSEQKDDIKAFAENVL"
FT   CDS             complement(7404751..7408341)
FT                   /codon_start=1
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT20288.1
FT                   protein_id=mCP21274.1 isoform=CRA_a"
FT                   /protein_id="EDL20960.1"
FT                   /translation="MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFK
FT                   AHSNVLAASSLYFKNIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETV
FT                   TDLAAAGKKLGISFLEDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPR
FT                   ITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTASLCQERASVCHEVEPVRTLAEHS
FT                   YAVSSITEAYRSQPPREQDSSSSAKTGKETGDALATKAKPCRKPKPQTQDSDSTTENMP
FT                   LSLVTCPEVNQERSPQPAPDLSHSEPPSNEGDIHFPREDENQPSDAPGPGAAEVPPLVY
FT                   NCSCCSKSFDSSTLLSAHMQLHKPTQEPFVCKYCNKQFTTLNRLDRHEQICMRSSHVPI
FT                   PGGNPPFLENYPTIGQDGTSFRSPESLGPENRIGELSSAGSALSDADHMVKFVNGQMLY
FT                   SCIVCKRSYVTLSSLRRHANVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCI
FT                   FCLETFMTYYILKNHQKSFHAIDHRLSINKKTANGGLKPTVYPYKLYRLLPMRCKRAPY
FT                   KSYRNSSYVSAQGSSQRGESAPDTFIVPNLQSSEMPTLDFQDGRNTLPSSPAVPVETPS
FT                   RQGAPTSARVKNAEGIKWRKQAVKTNLVDNFDSTEVSVSSTGNTVSTTLQTEPACVSSV
FT                   GKGSEHSASVISYSGSVPSVIVHSSQFSSVIKHSNTIASLTNSNHKSPSQPVVSPSLIK
FT                   DSKPETDKASKSASRPKSIKEKKKTAPSNRGEITEEAKYIADHGGSSGKTTNAEETSKI
FT                   ETYIAKPALPGTSTNSNVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRKPKYQMQEET
FT                   LPRENDPETPGDSPLGLCQAECVEMSEAFDEVSDQDSTDKPWRPYYNYKPKKKSKQLRK
FT                   MRKVKWRKERRSRSPVGRCRYPAELDRAEVKLPPDKAFEEEEEEENKEMPKLQCELCDG
FT                   CPDGAAGAGAEGKPHQHLTSKPYICELCAKQFQSSSTLKMHMRCHTGEKPYQCKTCGRC
FT                   FSVQGNLQKHERIHLGVKEFICQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQGFLY
FT                   LSTKRNHERRHIREHDGKGFACFQCPKICKTAAALRMHQKKHLYKTLPKQEETGDTCHE
FT                   NADLLESQLCTDSEDSEQKDDIKAFAENVL"
FT   gene            7425168..7430790
FT                   /locus_tag="mCG_147711"
FT                   /note="gene_id=mCG147711.0"
FT   mRNA            join(7425168..7426223,7429032..7430790)
FT                   /locus_tag="mCG_147711"
FT                   /product="mCG147711"
FT                   /note="gene_id=mCG147711.0 transcript_id=mCT187974.0
FT                   created on 13-JAN-2004"
FT   CDS             7425673..7426194
FT                   /codon_start=1
FT                   /locus_tag="mCG_147711"
FT                   /product="mCG147711"
FT                   /note="gene_id=mCG147711.0 transcript_id=mCT187974.0
FT                   protein_id=mCP108537.0"
FT                   /protein_id="EDL20961.1"
FT                   /translation="MVSRHYELEVSEVLTSDPGSFRAAGTASGGEKKKVSQYLERVTCS
FT                   SAAPFSRVSAKPYKQRTLHSLSQQVLDQFPSTSVLSNPAPASCDRSILVLCPAMESRQP
FT                   VIVSAPISAYQAKYLLPHPDSFQRPTLWTQTQQRQKRPAVSILVVLSHLQTLSYTPTHF
FT                   PSCDVHAAME"
FT   assembly_gap    7439242..7439261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7441693..7441712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7455968..7455987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7460016..7460035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7462207..7462439
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    7464250..7464269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7465562..7465581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7466790..7466809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7468407..7468426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7477361..7477380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7482175..7482291
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            7488558..7494962
FT                   /locus_tag="mCG_1032863"
FT                   /note="gene_id=mCG1032863.1"
FT   mRNA            join(7488558..7488661,7492960..7493077,7493293..7493438,
FT                   7494823..7494962)
FT                   /locus_tag="mCG_1032863"
FT                   /product="mCG1032863, transcript variant mCT170320"
FT                   /note="gene_id=mCG1032863.1 transcript_id=mCT170320.0
FT                   created on 24-JUN-2002"
FT   mRNA            join(7488558..7488661,7492960..7493077,7493293..7493438,
FT                   7494910..7494956)
FT                   /locus_tag="mCG_1032863"
FT                   /product="mCG1032863, transcript variant mCT150567"
FT                   /note="gene_id=mCG1032863.1 transcript_id=mCT150567.1
FT                   created on 24-JUN-2002"
FT   assembly_gap    7488765..7489201
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   CDS             join(7493073..7493077,7493293..7493431)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032863"
FT                   /product="mCG1032863, isoform CRA_a"
FT                   /note="gene_id=mCG1032863.1 transcript_id=mCT150567.1
FT                   protein_id=mCP68647.1 isoform=CRA_a"
FT                   /protein_id="EDL20962.1"
FT                   /translation="MSFGLDVRLPFHFICQHVSHSRSVYKQVTEGGSALTYLTLFRLKT
FT                   KR"
FT   CDS             join(7493073..7493077,7493293..7493431)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032863"
FT                   /product="mCG1032863, isoform CRA_a"
FT                   /note="gene_id=mCG1032863.1 transcript_id=mCT170320.0
FT                   protein_id=mCP93238.0 isoform=CRA_a"
FT                   /protein_id="EDL20963.1"
FT                   /translation="MSFGLDVRLPFHFICQHVSHSRSVYKQVTEGGSALTYLTLFRLKT
FT                   KR"
FT   assembly_gap    7496487..7497051
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   gene            7503218..7505764
FT                   /locus_tag="mCG_140610"
FT                   /note="gene_id=mCG140610.0"
FT   mRNA            join(7503218..7503430,7505587..7505764)
FT                   /locus_tag="mCG_140610"
FT                   /product="mCG140610"
FT                   /note="gene_id=mCG140610.0 transcript_id=mCT170321.0
FT                   created on 24-JUN-2002"
FT   CDS             7503297..7503392
FT                   /codon_start=1
FT                   /locus_tag="mCG_140610"
FT                   /product="mCG140610"
FT                   /note="gene_id=mCG140610.0 transcript_id=mCT170321.0
FT                   protein_id=mCP93239.0"
FT                   /protein_id="EDL20964.1"
FT                   /translation="MECIRRTGTHDDWGPANHRTLTLPERWLVAM"
FT   assembly_gap    7516248..7516267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7518189..7518300
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    7519137..7519261
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   gene            complement(7536536..7537474)
FT                   /pseudo
FT                   /locus_tag="mCG_1032753"
FT                   /note="gene_id=mCG1032753.1"
FT   mRNA            complement(7536536..7537474)
FT                   /pseudo
FT                   /locus_tag="mCG_1032753"
FT                   /note="gene_id=mCG1032753.1 transcript_id=mCT150457.1
FT                   created on 24-JUN-2002"
FT   gene            complement(7545530..7612892)
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /note="gene_id=mCG21642.2"
FT   mRNA            complement(join(7545530..7548734,7552042..7552181,
FT                   7562292..7562418,7563165..7563323,7579857..7579988,
FT                   7612779..7612892))
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /product="acid phosphatase-like 2, transcript variant
FT                   mCT20285"
FT                   /note="gene_id=mCG21642.2 transcript_id=mCT20285.2 created
FT                   on 20-FEB-2003"
FT   mRNA            complement(join(7545530..7548734,7552042..7552181,
FT                   7562292..7562418,7563165..7563323,7579857..7579988,
FT                   7584278..7584495,7612779..7612892))
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /product="acid phosphatase-like 2, transcript variant
FT                   mCT180711"
FT                   /note="gene_id=mCG21642.2 transcript_id=mCT180711.0 created
FT                   on 20-FEB-2003"
FT   mRNA            complement(join(7545530..7548734,7552042..7552181,
FT                   7562292..7562418,7563165..7563323,7579857..7579988,
FT                   7584278..7584513,7612779..7612892))
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /product="acid phosphatase-like 2, transcript variant
FT                   mCT170567"
FT                   /note="gene_id=mCG21642.2 transcript_id=mCT170567.0 created
FT                   on 20-FEB-2003"
FT   CDS             complement(join(7547797..7548734,7552042..7552181,
FT                   7562292..7562418,7563165..7563323,7579857..7579935))
FT                   /codon_start=1
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /product="acid phosphatase-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG21642.2 transcript_id=mCT170567.0
FT                   protein_id=mCP93485.0 isoform=CRA_a"
FT                   /protein_id="EDL20965.1"
FT                   /translation="MLHRNRFLVLLALAGLLAFLSLSLQFFHLIPVSATKNGGSSKSRK
FT                   RIMPDPVTEPPTVDPVYEALLYCNIPSVAEHSMEGHAPHHYKLVSVHVFIRHGDRYPLY
FT                   AIPKTKRPEIDCTLVASRKPYHPKLEAFISHMLKGSGASFESPLNSLPLYPNHPLCETG
FT                   ELTQTGVVQHLLNGQLLRDIYLRKHKLLPNNWSSDQLYLESTGKSRTLQSGLALLYGFL
FT                   PEFDWKKVYFKHQPSALFCSGSCYCPLRNQYLEKEQRRQYLLRLKNSDLERTYGEMAKI
FT                   VDIPTKQLRAANPIDSMLCHFCHNVSFPCSRSGCLGMEHFKVIKTHQIEDERERHEKLL
FT                   YFGYSLLGAHPILNQTVNRMQRAASGWRDELFTLYSAHDVTLSPILSALGLLEARFPRF
FT                   AARLVFELWQDRQKPSEHSVRILYNGADVTFHTSFCHDFHKRSPKPMCPLENLVRFVKR
FT                   DMFVALDGSSTNYYDACHGEGA"
FT   CDS             complement(join(7547797..7548734,7552042..7552181,
FT                   7562292..7562418,7563165..7563323,7579857..7579935))
FT                   /codon_start=1
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /product="acid phosphatase-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG21642.2 transcript_id=mCT180711.0
FT                   protein_id=mCP103633.0 isoform=CRA_a"
FT                   /protein_id="EDL20966.1"
FT                   /translation="MLHRNRFLVLLALAGLLAFLSLSLQFFHLIPVSATKNGGSSKSRK
FT                   RIMPDPVTEPPTVDPVYEALLYCNIPSVAEHSMEGHAPHHYKLVSVHVFIRHGDRYPLY
FT                   AIPKTKRPEIDCTLVASRKPYHPKLEAFISHMLKGSGASFESPLNSLPLYPNHPLCETG
FT                   ELTQTGVVQHLLNGQLLRDIYLRKHKLLPNNWSSDQLYLESTGKSRTLQSGLALLYGFL
FT                   PEFDWKKVYFKHQPSALFCSGSCYCPLRNQYLEKEQRRQYLLRLKNSDLERTYGEMAKI
FT                   VDIPTKQLRAANPIDSMLCHFCHNVSFPCSRSGCLGMEHFKVIKTHQIEDERERHEKLL
FT                   YFGYSLLGAHPILNQTVNRMQRAASGWRDELFTLYSAHDVTLSPILSALGLLEARFPRF
FT                   AARLVFELWQDRQKPSEHSVRILYNGADVTFHTSFCHDFHKRSPKPMCPLENLVRFVKR
FT                   DMFVALDGSSTNYYDACHGEGA"
FT   CDS             complement(join(7547797..7548734,7552042..7552181,
FT                   7562292..7562418,7563165..7563323,7579857..7579935))
FT                   /codon_start=1
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /product="acid phosphatase-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG21642.2 transcript_id=mCT20285.2
FT                   protein_id=mCP21363.2 isoform=CRA_a"
FT                   /protein_id="EDL20967.1"
FT                   /translation="MLHRNRFLVLLALAGLLAFLSLSLQFFHLIPVSATKNGGSSKSRK
FT                   RIMPDPVTEPPTVDPVYEALLYCNIPSVAEHSMEGHAPHHYKLVSVHVFIRHGDRYPLY
FT                   AIPKTKRPEIDCTLVASRKPYHPKLEAFISHMLKGSGASFESPLNSLPLYPNHPLCETG
FT                   ELTQTGVVQHLLNGQLLRDIYLRKHKLLPNNWSSDQLYLESTGKSRTLQSGLALLYGFL
FT                   PEFDWKKVYFKHQPSALFCSGSCYCPLRNQYLEKEQRRQYLLRLKNSDLERTYGEMAKI
FT                   VDIPTKQLRAANPIDSMLCHFCHNVSFPCSRSGCLGMEHFKVIKTHQIEDERERHEKLL
FT                   YFGYSLLGAHPILNQTVNRMQRAASGWRDELFTLYSAHDVTLSPILSALGLLEARFPRF
FT                   AARLVFELWQDRQKPSEHSVRILYNGADVTFHTSFCHDFHKRSPKPMCPLENLVRFVKR
FT                   DMFVALDGSSTNYYDACHGEGA"
FT   assembly_gap    7552844..7552961
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   gene            7619021..7619794
FT                   /pseudo
FT                   /locus_tag="mCG_21652"
FT                   /note="gene_id=mCG21652.2"
FT   mRNA            7619021..7619794
FT                   /pseudo
FT                   /locus_tag="mCG_21652"
FT                   /note="gene_id=mCG21652.2 transcript_id=mCT20295.2 created
FT                   on 16-JUL-2003"
FT   assembly_gap    7625490..7625509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7628802..7629812
FT                   /pseudo
FT                   /locus_tag="mCG_21648"
FT                   /note="gene_id=mCG21648.1"
FT   mRNA            7628802..7629812
FT                   /pseudo
FT                   /locus_tag="mCG_21648"
FT                   /note="gene_id=mCG21648.1 transcript_id=mCT20291.1 created
FT                   on 09-JUL-2002"
FT   assembly_gap    7634075..7634094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7660140..7660159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7666939..7742313)
FT                   /gene="Spsb4"
FT                   /locus_tag="mCG_21649"
FT                   /note="gene_id=mCG21649.2"
FT   mRNA            complement(join(7666939..7668163,7718996..7719842,
FT                   7741611..7742313))
FT                   /gene="Spsb4"
FT                   /locus_tag="mCG_21649"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 4"
FT                   /note="gene_id=mCG21649.2 transcript_id=mCT20292.2 created
FT                   on 09-JUL-2002"
FT   CDS             complement(join(7668036..7668163,7718996..7719689))
FT                   /codon_start=1
FT                   /gene="Spsb4"
FT                   /locus_tag="mCG_21649"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 4"
FT                   /note="gene_id=mCG21649.2 transcript_id=mCT20292.2
FT                   protein_id=mCP21302.2"
FT                   /protein_id="EDL20968.1"
FT                   /translation="MGQKLSGSLKSVEVREPALRPAKRELRGLEPGRPARLDQLLDMPA
FT                   AGLAVQLRHAWNPEDRSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQIHW
FT                   PARQRGTHAVVGVATARAPLHSVGYTALVGSDSESWGWDLGRSRLYHDGKNRPGVAYPA
FT                   FLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEV
FT                   TMRYINGLDPEPLPLMDLCRRSIRSALGRQRLRDIGSLPLPQSLKNYLQYQ"
FT   gene            7739387..7742313
FT                   /locus_tag="mCG_140663"
FT                   /note="gene_id=mCG140663.0"
FT   mRNA            join(7739387..7739758,7741410..7742313)
FT                   /locus_tag="mCG_140663"
FT                   /product="mCG140663, transcript variant mCT170577"
FT                   /note="gene_id=mCG140663.0 transcript_id=mCT170577.0
FT                   created on 09-JUL-2002"
FT   mRNA            join(7741016..7741183,7741410..7742313)
FT                   /locus_tag="mCG_140663"
FT                   /product="mCG140663, transcript variant mCT170576"
FT                   /note="gene_id=mCG140663.0 transcript_id=mCT170576.0
FT                   created on 09-JUL-2002"
FT   CDS             7741732..7741881
FT                   /codon_start=1
FT                   /locus_tag="mCG_140663"
FT                   /product="mCG140663, isoform CRA_a"
FT                   /note="gene_id=mCG140663.0 transcript_id=mCT170576.0
FT                   protein_id=mCP93494.0 isoform=CRA_a"
FT                   /protein_id="EDL20969.1"
FT                   /translation="MLAAASQPAARPLDLYPAAAPSRSAGCPGVRDVLGEVDARERPPR
FT                   SGPE"
FT   CDS             7741732..7741881
FT                   /codon_start=1
FT                   /locus_tag="mCG_140663"
FT                   /product="mCG140663, isoform CRA_a"
FT                   /note="gene_id=mCG140663.0 transcript_id=mCT170577.0
FT                   protein_id=mCP93495.0 isoform=CRA_a"
FT                   /protein_id="EDL20970.1"
FT                   /translation="MLAAASQPAARPLDLYPAAAPSRSAGCPGVRDVLGEVDARERPPR
FT                   SGPE"
FT   gene            complement(7765943..7766249)
FT                   /pseudo
FT                   /locus_tag="mCG_140653"
FT                   /note="gene_id=mCG140653.0"
FT   mRNA            complement(7765943..7766249)
FT                   /pseudo
FT                   /locus_tag="mCG_140653"
FT                   /note="gene_id=mCG140653.0 transcript_id=mCT170544.0
FT                   created on 09-JUL-2002"
FT   assembly_gap    7767568..7767587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7770350..7770379
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   gene            complement(7770860..7771753)
FT                   /locus_tag="mCG_1032865"
FT                   /note="gene_id=mCG1032865.0"
FT   mRNA            complement(join(7770860..7771271,7771662..7771753))
FT                   /locus_tag="mCG_1032865"
FT                   /product="mCG1032865"
FT                   /note="gene_id=mCG1032865.0 transcript_id=mCT150569.0
FT                   created on 09-JUL-2002"
FT   CDS             complement(7770994..7771209)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032865"
FT                   /product="mCG1032865"
FT                   /note="gene_id=mCG1032865.0 transcript_id=mCT150569.0
FT                   protein_id=mCP68655.1"
FT                   /protein_id="EDL20971.1"
FT                   /translation="MLDGSFRDAATIDVTSCKQPLAVVMYGSQEAHGVTMQDWTVACFC
FT                   CGCLIGLIALRSFRKKKKSHTFPVQN"
FT   assembly_gap    7778729..7778748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7797952..7834376)
FT                   /gene="Slc25a36"
FT                   /locus_tag="mCG_146563"
FT                   /note="gene_id=mCG146563.0"
FT   mRNA            complement(join(7797952..7802578,7803532..7803821,
FT                   7808331..7808397,7816351..7816451,7820377..7820454,
FT                   7823349..7823513,7834156..7834376))
FT                   /gene="Slc25a36"
FT                   /locus_tag="mCG_146563"
FT                   /product="solute carrier family 25, member 36, transcript
FT                   variant mCT186826"
FT                   /note="gene_id=mCG146563.0 transcript_id=mCT186826.0
FT                   created on 25-NOV-2003"
FT   CDS             complement(join(7802385..7802578,7803532..7803821,
FT                   7808331..7808397,7816351..7816451,7820377..7820454,
FT                   7823349..7823513,7834156..7834196))
FT                   /codon_start=1
FT                   /gene="Slc25a36"
FT                   /locus_tag="mCG_146563"
FT                   /product="solute carrier family 25, member 36, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG146563.0 transcript_id=mCT186826.0
FT                   protein_id=mCP108065.0 isoform=CRA_b"
FT                   /protein_id="EDL20973.1"
FT                   /translation="MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISE
FT                   VQLNTMAGASVNRVVSPGPLHCLKAILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSN
FT                   CKEKLNGVFDPDSTQVHMASAAMAGFTAITATNPIWLIKTRLQLDARTRGEKQMGAFEC
FT                   VRKVYQTDGLRGFYRGMSASYAGISETVIHFVIYESIKQKLLECKTASMMETDEESVKE
FT                   ASDFVRMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLIVQEEGYGSLY
FT                   RGLTTHLVRQIPNTAIMMATYELVVYLLNG"
FT   mRNA            complement(join(7803706..7803821,7808331..7808397,
FT                   7813367..7813448,7816351..7816451,7820377..7820454,
FT                   7823349..7823513,7834156..>7834252))
FT                   /gene="Slc25a36"
FT                   /locus_tag="mCG_146563"
FT                   /product="solute carrier family 25, member 36, transcript
FT                   variant mCT191512"
FT                   /note="gene_id=mCG146563.0 transcript_id=mCT191512.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(7813435..7813448,7816351..7816451,
FT                   7820377..7820454,7823349..7823513,7834156..>7834250))
FT                   /codon_start=1
FT                   /gene="Slc25a36"
FT                   /locus_tag="mCG_146563"
FT                   /product="solute carrier family 25, member 36, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG146563.0 transcript_id=mCT191512.0
FT                   protein_id=mCP112473.0 isoform=CRA_a"
FT                   /protein_id="EDL20972.1"
FT                   /translation="GLLGPRPASTPGGHAEERMSQRDTLVHLFAGGCGGTVGAILTCPL
FT                   EVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKAILEKEGPRSLFRGLGP
FT                   NLVGVAPSRAIYFAAYSNCKEKLNGVFDPDSTQVHMASAAMAEHKN"
FT   assembly_gap    7833881..7833900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7838215..7838275
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    7841154..7841440
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    7847289..7847308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7857159..7857178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7864568..7864587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7872520..7872539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7874097..7874116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7888912..7888931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7898330..7898503
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    7899152..7899480
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   gene            <7903892..>7904692
FT                   /locus_tag="mCG_18601"
FT                   /note="gene_id=mCG18601.0"
FT   mRNA            <7903892..>7904692
FT                   /locus_tag="mCG_18601"
FT                   /product="mCG18601"
FT                   /note="gene_id=mCG18601.0 transcript_id=mCT14765.0 created
FT                   on 14-AUG-2002"
FT   CDS             7903892..7904692
FT                   /codon_start=1
FT                   /locus_tag="mCG_18601"
FT                   /product="mCG18601"
FT                   /note="gene_id=mCG18601.0 transcript_id=mCT14765.0
FT                   protein_id=mCP21365.0"
FT                   /protein_id="EDL20974.1"
FT                   /translation="MPKVKKAKGKKVAPAPAVVKKQEAKKVVNPLFEKRPKNFGIGQDI
FT                   QPKRDLMRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRP
FT                   ETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDP
FT                   IELVVFLPALCRKMGVPYCIIKENARLGHLVHRKTCTTVAFTQVNSEDKGALAKLVEAI
FT                   RTNYNDSYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG"
FT   assembly_gap    7918856..7919136
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   gene            complement(7933733..7935570)
FT                   /pseudo
FT                   /locus_tag="mCG_49766"
FT                   /note="gene_id=mCG49766.2"
FT   mRNA            complement(join(7933733..7934729,7935028..7935570))
FT                   /pseudo
FT                   /locus_tag="mCG_49766"
FT                   /note="gene_id=mCG49766.2 transcript_id=mCT49949.2 created
FT                   on 09-JUL-2002"
FT   assembly_gap    7937430..7937449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7952630..7953552)
FT                   /pseudo
FT                   /locus_tag="mCG_1032754"
FT                   /note="gene_id=mCG1032754.1"
FT   mRNA            complement(7952630..7953552)
FT                   /pseudo
FT                   /locus_tag="mCG_1032754"
FT                   /note="gene_id=mCG1032754.1 transcript_id=mCT150458.1
FT                   created on 09-JUL-2002"
FT   assembly_gap    7960272..7960291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7981081..7981137
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    7996567..7996625
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   gene            <8003378..8017181
FT                   /locus_tag="mCG_1032866"
FT                   /note="gene_id=mCG1032866.0"
FT   mRNA            join(<8003378..8003583,8006113..8006245,8017082..8017181)
FT                   /locus_tag="mCG_1032866"
FT                   /product="mCG1032866"
FT                   /note="gene_id=mCG1032866.0 transcript_id=mCT150570.0
FT                   created on 09-JUL-2002"
FT   CDS             join(<8006117..8006245,8017082..8017135)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032866"
FT                   /product="mCG1032866"
FT                   /note="gene_id=mCG1032866.0 transcript_id=mCT150570.0
FT                   protein_id=mCP68664.0"
FT                   /protein_id="EDL20975.1"
FT                   /translation="GFEYYIGEKRREEKRREEKRREEKRHCAHCLIPECGGVLCFPIDI
FT                   LKHPSLAPLHRRSSL"
FT   assembly_gap    8056384..8056403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8058391..8058809
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   gene            complement(8067193..8087426)
FT                   /gene="Trim42"
FT                   /locus_tag="mCG_18603"
FT                   /note="gene_id=mCG18603.2"
FT   mRNA            complement(join(8067193..8067453,8080325..8081145,
FT                   8083046..8083743,8086971..8087426))
FT                   /gene="Trim42"
FT                   /locus_tag="mCG_18603"
FT                   /product="tripartite motif-containing 42"
FT                   /note="gene_id=mCG18603.2 transcript_id=mCT14767.2 created
FT                   on 09-JUL-2002"
FT   CDS             complement(join(8067367..8067453,8080325..8081145,
FT                   8083046..8083743,8086971..8087311))
FT                   /codon_start=1
FT                   /gene="Trim42"
FT                   /locus_tag="mCG_18603"
FT                   /product="tripartite motif-containing 42"
FT                   /note="gene_id=mCG18603.2 transcript_id=mCT14767.2
FT                   protein_id=mCP21396.2"
FT                   /protein_id="EDL20976.1"
FT                   /translation="METAMCVCSPCCTWQRCCPRLFSCLCCKFIFTSERNCTCFPCPYK
FT                   DERNCQFCHCTCAENPNCHWCCCSWANDPNCKCCCTASTNLKCYYYESHCCRNVTITFR
FT                   KGRLRSIVTSSKTALRVGSSDTQMDEPKTMPASSHLVSHLTCPMCNRLRLHSFMLPCNH
FT                   SLCEKCLRQLQKHAEVTENFFILICPMCSRSHCMPYSHQMHLPENYLRGRLTKRYMQQH
FT                   GYLKWRFDRSSGPILCQVCRTRRIAYKRCVTCRLNLCNDCLKAFHSDVAMQDHVFVDTS
FT                   AEDQDEKICIHHPSSRINEYCRSDNQLLCAFCKIAFHNGHDTVSLIDACSERSAALFSA
FT                   IAKFKAVRYEIDNDLMEFNILKSSFKADKEAKRKEVRNGFLKLRAILQEKEKIIMEQIE
FT                   NLEVSRQKEIEKYVYITTMKVNEMDGLIAYSKEALKETGQVAFLQSAKILVDQIEEGIQ
FT                   NTFRPDPQLRLHSLHCIPLDFAELSNAIHELFPTGPKKACSSGDSLPSQYPIHSEMMIA
FT                   RKVTFSTHSFGNQQIYQRSSSLISFNTANDKGKMGLENYGRAQSAAPAKTTDGLYTYWS
FT                   ATGETQPPQSSNSFHNWYSFNDTSVRTPGPIVIYQTLVYPRAAKVVTPDGRGKNRAKWG
FT                   LLKNIQSALQKRF"
FT   assembly_gap    8075189..8078085
FT                   /estimated_length=2897
FT                   /gap_type="unknown"
FT   assembly_gap    8079342..8079361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8088185..8088443
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    8135670..8135728
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    8146807..8147098
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   gene            complement(8161850..>8750765)
FT                   /gene="Clstn2"
FT                   /locus_tag="mCG_18600"
FT                   /note="gene_id=mCG18600.2"
FT   mRNA            complement(join(8161850..8163165,8172059..8172219,
FT                   8173902..8174086,8174789..8174912,8175023..8175168,
FT                   8175570..8175740,8178808..8179031,8180914..8181062,
FT                   8187080..8187246,8200290..8200452,8243773..8243894,
FT                   8250081..8250329,8259193..8259378,8288116..8288265,
FT                   8300018..8300226,8301063..8301258,8516932..8517054,
FT                   8750698..>8750765))
FT                   /gene="Clstn2"
FT                   /locus_tag="mCG_18600"
FT                   /product="calsyntenin 2"
FT                   /note="gene_id=mCG18600.2 transcript_id=mCT14764.1 created
FT                   on 16-AUG-2002"
FT   CDS             complement(join(8163105..8163165,8172059..8172219,
FT                   8173902..8174086,8174789..8174912,8175023..8175168,
FT                   8175570..8175740,8178808..8179031,8180914..8181062,
FT                   8187080..8187246,8200290..8200452,8243773..8243894,
FT                   8250081..8250329,8259193..8259378,8288116..8288265,
FT                   8300018..8300226,8301063..8301258,8516932..8517054,
FT                   8750698..>8750764))
FT                   /codon_start=1
FT                   /gene="Clstn2"
FT                   /locus_tag="mCG_18600"
FT                   /product="calsyntenin 2"
FT                   /note="gene_id=mCG18600.2 transcript_id=mCT14764.1
FT                   protein_id=mCP21342.1"
FT                   /protein_id="EDL20977.1"
FT                   /translation="VGSGGGSGDGGDSRRRRLLVAKVNKHKPWIETSYHGVITENNDTV
FT                   ILDPPLVALDKDAPVPFAGEICAFKIHGQELPFEAVVLNKTSGEGRLRAKSPIDCELQK
FT                   EYTFIIQAYDCGAGPREAAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVTEGKIYDS
FT                   ILQVEAIDEDCSPQYSQICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAY
FT                   DCGQKPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIHLETCDGAVSSL
FT                   QVTAELQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEM
FT                   IFKFDGRQGAKIPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHH
FT                   YALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDG
FT                   ATYEPYLVTNDWPIHPSHIAMQLTVGACWQGGEVAKPRFAQFFHGSLASLTIRPGKMES
FT                   QKVISCLQACKEGLDINSLESLGRGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINS
FT                   RQFPTAGVRRLRLSSKVQCFGEDVCISIPDVDAYIMVLQAIEPQITLQGTERFWRPAAQ
FT                   FESARGVTLFPDIKIVSTFAKTEASGDMRATGTAPKSAVLEEMLHNLDFCDILVLGGDL
FT                   DPRQECLELNHSELHQRHLDATNSTAGYSIYGVGSMNRYEQVLHHLRYRNWHPTSLETR
FT                   RFRIKCSELNGRYTSNEFNLEVSVLHEVRVSDKEHVNHLIVQPPFLQSVHHPETRSSIQ
FT                   RSSVVPSIATVVIIISVCMLVFVVAMGVYRVRIAHQHFIQETEAAKEAEMDWDDSALTI
FT                   TVNPMEKHEGPGHGEDETTEGEEEEEAEEGSSSSSSGSDDSEEEEEEGMGRVRHGQSGT
FT                   SSQSPERSTWNTAGVINIWK"
FT   assembly_gap    8205590..8205774
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    8219483..8219687
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    8271607..8271626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8281284..8281303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8312516..8312586
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    8313950..8313969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8330062..8330099
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    8333939..8334023
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    8365554..8365573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8387809..8387828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8465910..8466909
FT                   /estimated_length=1000
FT                   /gap_type="unknown"
FT   assembly_gap    8585750..8586397
FT                   /estimated_length=648
FT                   /gap_type="unknown"
FT   assembly_gap    8645842..8646208
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    8673719..8673752
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    8707642..8707897
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    8709095..8709114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <8721271..8727785
FT                   /locus_tag="mCG_60674"
FT                   /note="gene_id=mCG60674.2"
FT   mRNA            join(<8721271..8721546,8727465..8727785)
FT                   /locus_tag="mCG_60674"
FT                   /product="mCG60674, transcript variant mCT170574"
FT                   /note="gene_id=mCG60674.2 transcript_id=mCT170574.0 created
FT                   on 09-JUL-2002"
FT   mRNA            join(<8721271..8721546,8722505..8723618)
FT                   /locus_tag="mCG_60674"
FT                   /product="mCG60674, transcript variant mCT60857"
FT                   /note="gene_id=mCG60674.2 transcript_id=mCT60857.2 created
FT                   on 09-JUL-2002"
FT   CDS             join(<8721424..8721546,8727465..8727509)
FT                   /codon_start=1
FT                   /locus_tag="mCG_60674"
FT                   /product="mCG60674, isoform CRA_a"
FT                   /note="gene_id=mCG60674.2 transcript_id=mCT170574.0
FT                   protein_id=mCP93492.0 isoform=CRA_a"
FT                   /protein_id="EDL20978.1"
FT                   /translation="SQSYPFSHSLGWSLSSGCSQAPIRVEGTIYSATEPVDTVLSLTPS
FT                   VQACCSAASM"
FT   CDS             join(<8721424..8721546,8722505..8722627)
FT                   /codon_start=1
FT                   /locus_tag="mCG_60674"
FT                   /product="mCG60674, isoform CRA_b"
FT                   /note="gene_id=mCG60674.2 transcript_id=mCT60857.2
FT                   protein_id=mCP41335.2 isoform=CRA_b"
FT                   /protein_id="EDL20979.1"
FT                   /translation="SQSYPFSHSLGWSLSSGCSQAPIRVEGTIYSATEPVDTVLSQYIL
FT                   HIKFLEYFKIRTNQNTKSLSCSICATTTEHHTLDRF"
FT   assembly_gap    8750766..8750785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8802716..8802735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8811846..8811935
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    8817276..8817295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8831150..8831269
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    8848227..8848358
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    8861457..8861626
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    8874471..8874502
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   gene            complement(8904360..>8904985)
FT                   /locus_tag="mCG_52933"
FT                   /note="gene_id=mCG52933.2"
FT   mRNA            complement(join(8904360..8904657,8904768..>8904985))
FT                   /locus_tag="mCG_52933"
FT                   /product="mCG52933"
FT                   /note="gene_id=mCG52933.2 transcript_id=mCT53116.2 created
FT                   on 09-JUL-2002"
FT   CDS             complement(join(8904489..8904657,8904768..>8904985))
FT                   /codon_start=1
FT                   /locus_tag="mCG_52933"
FT                   /product="mCG52933"
FT                   /note="gene_id=mCG52933.2 transcript_id=mCT53116.2
FT                   protein_id=mCP41324.2"
FT                   /protein_id="EDL20980.1"
FT                   /translation="ISHSSSSDCLSDCTSKPETPGLGKLLCSPLLTRLSSHFRQITRTA
FT                   AWGWQHQEASFSRIQRDYLSTEAEHSYRCPGRMRPGLLSESKCVVKQSEEEEEEAWRKK
FT                   QEPWCQTDMALSPAAFTSMGGAVA"
FT   assembly_gap    8955877..8956132
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    8969537..8975212
FT                   /estimated_length=5676
FT                   /gap_type="unknown"
FT   gene            9005004..9136718
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /note="gene_id=mCG9789.2"
FT   mRNA            join(9005004..9005126,9070255..9070400,9083517..9084307)
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /product="nicotinamide nucleotide adenylyltransferase 3,
FT                   transcript variant mCT170580"
FT                   /note="gene_id=mCG9789.2 transcript_id=mCT170580.0 created
FT                   on 09-JUL-2002"
FT   mRNA            join(9014127..9014524,9070255..9070400,9115680..9115863,
FT                   9119765..9119844,9126303..9127652)
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /product="nicotinamide nucleotide adenylyltransferase 3,
FT                   transcript variant mCT9858"
FT                   /note="gene_id=mCG9789.2 transcript_id=mCT9858.2 created on
FT                   09-JUL-2002"
FT   mRNA            join(9014153..9014276,9070255..9070400,9115680..9115863,
FT                   9119765..9119844,9136451..9136718)
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /product="nicotinamide nucleotide adenylyltransferase 3,
FT                   transcript variant mCT170579"
FT                   /note="gene_id=mCG9789.2 transcript_id=mCT170579.0 created
FT                   on 09-JUL-2002"
FT   gene            9019161..9019808
FT                   /pseudo
FT                   /locus_tag="mCG_9787"
FT                   /note="gene_id=mCG9787.0"
FT   mRNA            9019161..9019808
FT                   /pseudo
FT                   /locus_tag="mCG_9787"
FT                   /note="gene_id=mCG9787.0 transcript_id=mCT9856.0 created on
FT                   09-JUL-2002"
FT   assembly_gap    9026549..9026568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9063748..9063767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9064870..9065351
FT                   /estimated_length=482
FT                   /gap_type="unknown"
FT   CDS             join(9070292..9070400,9115680..9115863,9119765..9119844,
FT                   9136451..9136458)
FT                   /codon_start=1
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /product="nicotinamide nucleotide adenylyltransferase 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9789.2 transcript_id=mCT170579.0
FT                   protein_id=mCP93497.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V3F1"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="MGI:MGI:1921330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V3F1"
FT                   /protein_id="EDL20981.1"
FT                   /translation="MKNRIPVVLLACGSFNPITNMHLRLFEVARDHLHQTGRYQVIEGI
FT                   ISPVNDSYGKKDLVASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHREL
FT                   LRSSAQMDGPDPSKTPSASADA"
FT   CDS             join(9070292..9070400,9115680..9115863,9119765..9119844,
FT                   9126303..9126667)
FT                   /codon_start=1
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /product="nicotinamide nucleotide adenylyltransferase 3,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9789.2 transcript_id=mCT9858.2
FT                   protein_id=mCP21402.2 isoform=CRA_c"
FT                   /protein_id="EDL20983.1"
FT                   /translation="MKNRIPVVLLACGSFNPITNMHLRLFEVARDHLHQTGRYQVIEGI
FT                   ISPVNDSYGKKDLVASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHREL
FT                   LRSSAQMDGPDPSKTPSASAALPELKLLCGADVLKTFQTPNLWKDTHIQEIVEKFGLVC
FT                   VSRSGHDPERYISDSPILQQFQHNIHLAREPVLNEISATYVRKALGQGQSVKYLLPEAV
FT                   ITYIRDQGLYINDGSWKGKGKTG"
FT   CDS             join(9070292..9070400,9083517..9083686)
FT                   /codon_start=1
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /product="nicotinamide nucleotide adenylyltransferase 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG9789.2 transcript_id=mCT170580.0
FT                   protein_id=mCP93498.0 isoform=CRA_b"
FT                   /protein_id="EDL20982.1"
FT                   /translation="MKNRIPVVLLACGSFNPITNMHLRLFEVARDHLHQTELLEATCSK
FT                   ALVSGIDEEHSKLNHQSSQPLQERSKDIMRHRSMAHMRLVRRMWRDS"
FT   assembly_gap    9076463..9076482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9098092..9098148
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    9106277..9106296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9139287..9162788
FT                   /gene="Rbp1"
FT                   /locus_tag="mCG_9784"
FT                   /note="gene_id=mCG9784.2"
FT   mRNA            join(9139287..9141344,9141747..9141925,9160804..9160905,
FT                   9162510..9162788)
FT                   /gene="Rbp1"
FT                   /locus_tag="mCG_9784"
FT                   /product="retinol binding protein 1, cellular"
FT                   /note="gene_id=mCG9784.2 transcript_id=mCT9853.2 created on
FT                   09-JUL-2002"
FT   assembly_gap    9140262..9140287
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   CDS             join(9141272..9141344,9141747..9141925,9160804..9160905,
FT                   9162510..9162563)
FT                   /codon_start=1
FT                   /gene="Rbp1"
FT                   /locus_tag="mCG_9784"
FT                   /product="retinol binding protein 1, cellular"
FT                   /note="gene_id=mCG9784.2 transcript_id=mCT9853.2
FT                   protein_id=mCP21366.2 partial"
FT                   /db_xref="GOA:Q58EU7"
FT                   /db_xref="InterPro:IPR000463"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR031259"
FT                   /db_xref="InterPro:IPR031264"
FT                   /db_xref="MGI:MGI:97876"
FT                   /db_xref="UniProtKB/TrEMBL:Q58EU7"
FT                   /protein_id="EDL20984.1"
FT                   /translation="MPVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQ
FT                   DGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEG
FT                   RGWTQWIEGDELHLEMRAEGVICKQVFKKVH"
FT   assembly_gap    9149874..9149893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9153658..9153677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9164347..9164433
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    9188972..9189168
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    9193551..9193570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9195327..9219016
FT                   /gene="Rbp2"
FT                   /locus_tag="mCG_9785"
FT                   /note="gene_id=mCG9785.2"
FT   mRNA            join(9195327..9195458,9199792..9199926,9207986..9208164,
FT                   9216987..9217088,9218772..9219016)
FT                   /gene="Rbp2"
FT                   /locus_tag="mCG_9785"
FT                   /product="retinol binding protein 2, cellular"
FT                   /note="gene_id=mCG9785.2 transcript_id=mCT9854.1 created on
FT                   09-JUL-2002"
FT   CDS             join(9199854..9199926,9207986..9208164,9216987..9217088,
FT                   9218772..9218822)
FT                   /codon_start=1
FT                   /gene="Rbp2"
FT                   /locus_tag="mCG_9785"
FT                   /product="retinol binding protein 2, cellular"
FT                   /note="gene_id=mCG9785.2 transcript_id=mCT9854.1
FT                   protein_id=mCP21339.1"
FT                   /db_xref="GOA:Q059R7"
FT                   /db_xref="InterPro:IPR000463"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR031259"
FT                   /db_xref="InterPro:IPR031266"
FT                   /db_xref="MGI:MGI:97877"
FT                   /db_xref="UniProtKB/TrEMBL:Q059R7"
FT                   /protein_id="EDL20985.1"
FT                   /translation="MTKDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKIITQ
FT                   DGDNFKTKTNSTFRNYDLDFTVGVEFDEHTKGLDGRHVKTLVTWEGNTLVCVQKGEKEN
FT                   RGWKQWVEGDKLYLELTCGDQVCRQVFKKK"
FT   assembly_gap    9213436..9213646
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    9225810..9225829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9230445..9230659
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    9232544..9232563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9271802..9272953)
FT                   /locus_tag="mCG_1032870"
FT                   /note="gene_id=mCG1032870.1"
FT   mRNA            complement(9271802..9272953)
FT                   /locus_tag="mCG_1032870"
FT                   /product="mCG1032870"
FT                   /note="gene_id=mCG1032870.1 transcript_id=mCT150574.1
FT                   created on 09-JUL-2002"
FT   CDS             complement(9272495..9272836)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032870"
FT                   /product="mCG1032870"
FT                   /note="gene_id=mCG1032870.1 transcript_id=mCT150574.1
FT                   protein_id=mCP68825.1"
FT                   /db_xref="GOA:Q8BH39"
FT                   /db_xref="MGI:MGI:1923131"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BH39"
FT                   /protein_id="EDL20986.1"
FT                   /translation="MERSAGFLLNVGSSGGARKRYPNSVSLWQRKESSKTVYSSGLRNG
FT                   AQSGVWVLGETDRGGKDVGAAPAFEAPRSPEILVLEAPGGSRVITLQRASTGSFVWLCT
FT                   FSWWYCHIT"
FT   gene            9273063..9297724
FT                   /gene="Copb2"
FT                   /locus_tag="mCG_9781"
FT                   /note="gene_id=mCG9781.2"
FT   mRNA            join(9273063..9273165,9277335..9277472,9279651..9279737,
FT                   9279928..9280054,9280839..9280987,9282782..9282928,
FT                   9283413..9283512,9286305..9286447,9286675..9286874,
FT                   9288328..9288438,9289429..9289517,9289605..9289711,
FT                   9290482..9290625,9291619..9291749,9292037..9292244,
FT                   9294330..9294440,9295279..9295493,9296387..9296479,
FT                   9296572..9296752,9296899..9296967,9297108..9297176,
FT                   9297392..9297724)
FT                   /gene="Copb2"
FT                   /locus_tag="mCG_9781"
FT                   /product="coatomer protein complex, subunit beta 2 (beta
FT                   prime)"
FT                   /note="gene_id=mCG9781.2 transcript_id=mCT9852.2 created on
FT                   09-JUL-2002"
FT   CDS             join(9273163..9273165,9277335..9277472,9279651..9279737,
FT                   9279928..9280054,9280839..9280987,9282782..9282928,
FT                   9283413..9283512,9286305..9286447,9286675..9286874,
FT                   9288328..9288438,9289429..9289517,9289605..9289711,
FT                   9290482..9290625,9291619..9291749,9292037..9292244,
FT                   9294330..9294440,9295279..9295493,9296387..9296479,
FT                   9296572..9296752,9296899..9296967,9297108..9297176,
FT                   9297392..9297487)
FT                   /codon_start=1
FT                   /gene="Copb2"
FT                   /locus_tag="mCG_9781"
FT                   /product="coatomer protein complex, subunit beta 2 (beta
FT                   prime)"
FT                   /note="gene_id=mCG9781.2 transcript_id=mCT9852.2
FT                   protein_id=mCP21322.2"
FT                   /protein_id="EDL20987.1"
FT                   /translation="MPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHE
FT                   TQTLVKTFEVCDLPVRAAKFVARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRC
FT                   IAVHPTQPFILTSSDDMLIKLWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQFASASL
FT                   DRTIKVWQLGSSSPNFTLEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIWDYQNKTCV
FT                   QTLEGHAQNVSCASFHPELPIIITGSEDGTVRIWHSSTYRLESTLNYGMERVWCVASLR
FT                   GSNNVALGYDEGSIIVKLGREEPAMSMDANGKIIWAKHSEVQQANLKAMGDTEIKDGER
FT                   LPLAVKDMGSCEIYPQTIQHNPNGRFVVVCGDGEYIIYTAMALRNKSFGSAQEFAWAHD
FT                   SSEYAIRESNSIVKIFKNFKEKKSFKPDFGAESIYGGFLLGVRSVNGLAFYDWENTELI
FT                   RRIEIQPKHIFWSDSGELVCIATEESFFILKYLSEKVLAAQETHEGVTEDGIEDAFEVL
FT                   GEIQEIVKTGLWVGDCFIYTSSVNRLNYYVGGEIVTIAHLDRTMYLLGYIPKDNRLYLG
FT                   DKELNIVSYSLLVSVLEYQTAVMRRDFSMADKVLPTIPKEQRTRVAHFLEKQGFKQQAL
FT                   TVSTDPEHRFELALQLGELKIAYQLAVEAESEQKWKQLAELAISKCQFSLAQECLHHAQ
FT                   DYGGLLLLATASGNASMVNKLAEGAERDGKNNVAFMSYFLQGKLDACLELLIRTGRLPE
FT                   AAFLARTYLPSQVSRVVKLWRENLSKVNQKAAESLADPTEYENLFPGLKEAFVVEEWVK
FT                   ETHADLWPAKQYPLVTPNEERNVMEEAKGFQPSRPTAQQEPDGKPASSPVIMASQTTHK
FT                   EEKSLLELEVDLDNLELEDIDTTDINLDEDILDD"
FT   gene            complement(9298084..9310989)
FT                   /gene="Mrps22"
FT                   /locus_tag="mCG_9783"
FT                   /note="gene_id=mCG9783.2"
FT   mRNA            complement(join(9298084..9298273,9299382..9299490,
FT                   9301903..9302048,9303421..9303504,9304018..9304161,
FT                   9306147..9306311,9307462..9307625,9310800..9310989))
FT                   /gene="Mrps22"
FT                   /locus_tag="mCG_9783"
FT                   /product="mitochondrial ribosomal protein S22"
FT                   /note="gene_id=mCG9783.2 transcript_id=mCT9851.1 created on
FT                   09-JUL-2002"
FT   CDS             complement(join(9298178..9298273,9299382..9299490,
FT                   9301903..9302048,9303421..9303504,9304018..9304161,
FT                   9306147..9306311,9307462..9307625,9310800..9310971))
FT                   /codon_start=1
FT                   /gene="Mrps22"
FT                   /locus_tag="mCG_9783"
FT                   /product="mitochondrial ribosomal protein S22"
FT                   /note="gene_id=mCG9783.2 transcript_id=mCT9851.1
FT                   protein_id=mCP21325.1"
FT                   /protein_id="EDL20988.1"
FT                   /translation="MAAVRTPLSLWRFQLGSRRARRVCTRATAQRHPDALLATRPQPFE
FT                   VGQPRRLLSSEAESGSSEVKKPAFMDEEVQRILTKITGLDLQKTFRPAIQPLKPPTYKL
FT                   MTQAQLEEATRLAVEAAKVRLKMPPVLEERKPINDVLAEDKILEGTETNKYVFTDISYN
FT                   IPHRERFIVVREPSGTLRKASWEERDRVIQIYFPKEGRRVLPPVIFKDENLKTMYSQDR
FT                   HADVLNLCVAQFEPDSAEYIKVHHQTYEDIDRHGKYELLRSTRHFGGMAWYFVNKKKID
FT                   GLLIDQIQRDLVDDATSLVQLYHMLHPDGQSAQEAKEQAAEGVDLIKVFAKTEAQRGAY
FT                   IELALQTYQEIVTSHSAAS"
FT   assembly_gap    9304404..9304508
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    9325735..9325792
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    9332467..9332857
FT                   /estimated_length=391
FT                   /gap_type="unknown"
FT   assembly_gap    9358798..9358818
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    9388049..9388231
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    9413866..9413918
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    9446232..9446404
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    9449283..9449302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9450453..9450472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<9450473..9516429)
FT                   /locus_tag="mCG_1051021"
FT                   /note="gene_id=mCG1051021.0"
FT   mRNA            complement(join(<9450473..9451306,9459639..9459768,
FT                   9516276..9516429))
FT                   /locus_tag="mCG_1051021"
FT                   /product="mCG1051021"
FT                   /note="gene_id=mCG1051021.0 transcript_id=mCT194810.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(<9450473..9450733)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051021"
FT                   /product="mCG1051021"
FT                   /note="gene_id=mCG1051021.0 transcript_id=mCT194810.0
FT                   protein_id=mCP115839.0"
FT                   /protein_id="EDL20989.1"
FT                   /translation="MAANTSAVVRRGQQVNAIEEERKCGLSGSLTHVASVACGPVLSLY
FT                   RDSDDQKMYLVMTRNQQWVMVRYEFDLWIERTLHFVGANRVQ"
FT   assembly_gap    9455352..9455371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9471756..9471775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9474162..9474181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9475409..9475428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9485853..9485976
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   gene            <9538882..9539940
FT                   /locus_tag="mCG_65589"
FT                   /note="gene_id=mCG65589.2"
FT   mRNA            <9538882..9539940
FT                   /locus_tag="mCG_65589"
FT                   /product="mCG65589"
FT                   /note="gene_id=mCG65589.2 transcript_id=mCT65772.2 created
FT                   on 09-JUL-2002"
FT   CDS             9538882..9539658
FT                   /codon_start=1
FT                   /locus_tag="mCG_65589"
FT                   /product="mCG65589"
FT                   /note="gene_id=mCG65589.2 transcript_id=mCT65772.2
FT                   protein_id=mCP41311.2"
FT                   /db_xref="GOA:G3UW32"
FT                   /db_xref="InterPro:IPR018903"
FT                   /db_xref="MGI:MGI:3645743"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW32"
FT                   /protein_id="EDL20990.1"
FT                   /translation="MLRTRPRSPSANPAPCWSPQTPAPSPAKRRRLHQEPACPEPLAQP
FT                   ELEAPAEPASSALTSVVFLAAGSALQLPLDGIDLLLEPEPTSVLQVSLQEHTILLVPEG
FT                   LMTQPQPGQPGFVAISPQGAAAQDGPQDHLVGLQEETFCEYFYQEDVCDEDADLELLEP
FT                   WARPPDDQANGNFSSIPGVPSPLLQEQVPGPSTGAERYSPRFIWELDSYLLGPLPGSPL
FT                   QPLPPSPSQSPQEQLPPRPPCSPRAPCKARKRLVYD"
FT   gene            <9552872..>9553633
FT                   /locus_tag="mCG_140662"
FT                   /note="gene_id=mCG140662.0"
FT   mRNA            <9552872..>9553633
FT                   /locus_tag="mCG_140662"
FT                   /product="mCG140662"
FT                   /note="gene_id=mCG140662.0 transcript_id=mCT170573.0
FT                   created on 09-JUL-2002"
FT   CDS             9552872..9553633
FT                   /codon_start=1
FT                   /locus_tag="mCG_140662"
FT                   /product="mCG140662"
FT                   /note="gene_id=mCG140662.0 transcript_id=mCT170573.0
FT                   protein_id=mCP93491.0"
FT                   /db_xref="GOA:D3YWX5"
FT                   /db_xref="InterPro:IPR018903"
FT                   /db_xref="MGI:MGI:3645937"
FT                   /db_xref="UniProtKB/TrEMBL:D3YWX5"
FT                   /protein_id="EDL20991.1"
FT                   /translation="MLRTRPRSPCVDPAPCWSPQTSAPSPAKRRRLHQEPACPEPLAQP
FT                   ELEAPAEPTTSVVFLAAGSALQLPLDGIDLLLEPEPTSVLQVSLQGHTILLVPEGLMTQ
FT                   PQPGQPGFVAISPQGAAAQDGPQDHLVGLQEETCEYFYQEDVCNEDADLEFLEPWARPP
FT                   DDQANGSFFSIPGVPSPLLQEQVPGPSTGAERYSPRSIWELDSYLLGPLPGSPLQPLPP
FT                   SPSQSPQEQLPPCPPCSPRAPCKARKRLVYD"
FT   gene            9561069..9562859
FT                   /locus_tag="mCG_140661"
FT                   /note="gene_id=mCG140661.0"
FT   mRNA            9561069..9562859
FT                   /locus_tag="mCG_140661"
FT                   /product="mCG140661"
FT                   /note="gene_id=mCG140661.0 transcript_id=mCT170572.0
FT                   created on 09-JUL-2002"
FT   CDS             9561275..9562039
FT                   /codon_start=1
FT                   /locus_tag="mCG_140661"
FT                   /product="mCG140661"
FT                   /note="gene_id=mCG140661.0 transcript_id=mCT170572.0
FT                   protein_id=mCP93490.0"
FT                   /protein_id="EDL20992.1"
FT                   /translation="MLRTRPRSPSADPAPCWSPQTPAPSPAKRRRLHQEPACPEPLAQP
FT                   ELEAPAEPTTSVVFLAAGSALQLPLDGVDLLLEPEPTSVLQVSLQGHTILLVPEGLQDS
FT                   THFGQPGFVAISPQGAAAQDGPQDHLVGLQEETFCEYFYQEDVCDEDADLEFLEHWASP
FT                   PDDQANGNFSSIPGVPSPLSQDQVPGPSTGAEQYSPRFIWELDINMLGPFPGSPLQPLP
FT                   PSPSRNPQEQLPPCPPCSPRAPRRARKRLVYE"
FT   gene            complement(9566022..9568757)
FT                   /pseudo
FT                   /locus_tag="mCG_113821"
FT                   /note="gene_id=mCG113821.1"
FT   mRNA            complement(9566022..9568757)
FT                   /pseudo
FT                   /locus_tag="mCG_113821"
FT                   /note="gene_id=mCG113821.1 transcript_id=mCT114909.1
FT                   created on 09-JUL-2002"
FT   assembly_gap    9582749..9582773
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            9582874..9583593
FT                   /pseudo
FT                   /locus_tag="mCG_140655"
FT                   /note="gene_id=mCG140655.0"
FT   mRNA            9582874..9583593
FT                   /pseudo
FT                   /locus_tag="mCG_140655"
FT                   /note="gene_id=mCG140655.0 transcript_id=mCT170546.0
FT                   created on 09-JUL-2002"
FT   gene            9592263..9592658
FT                   /pseudo
FT                   /locus_tag="mCG_140654"
FT                   /note="gene_id=mCG140654.0"
FT   mRNA            9592263..9592658
FT                   /pseudo
FT                   /locus_tag="mCG_140654"
FT                   /note="gene_id=mCG140654.0 transcript_id=mCT170545.0
FT                   created on 09-JUL-2002"
FT   assembly_gap    9614302..9614471
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    9616223..9616242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9617623..9617642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9619286..9619305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9620825..9620844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9622809..9623866
FT                   /estimated_length=1058
FT                   /gap_type="unknown"
FT   assembly_gap    9626487..9626506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9626642..9627025)
FT                   /pseudo
FT                   /locus_tag="mCG_50376"
FT                   /note="gene_id=mCG50376.2"
FT   mRNA            complement(9626642..9627025)
FT                   /pseudo
FT                   /locus_tag="mCG_50376"
FT                   /note="gene_id=mCG50376.2 transcript_id=mCT50559.2 created
FT                   on 09-JUL-2002"
FT   assembly_gap    9632329..9632366
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   gene            <9657104..>9658470
FT                   /locus_tag="mCG_52244"
FT                   /note="gene_id=mCG52244.2"
FT   mRNA            join(<9657104..9657636,9658143..>9658470)
FT                   /locus_tag="mCG_52244"
FT                   /product="mCG52244"
FT                   /note="gene_id=mCG52244.2 transcript_id=mCT52427.2 created
FT                   on 10-JUL-2002"
FT   CDS             join(9657104..9657636,9658143..9658470)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52244"
FT                   /product="mCG52244"
FT                   /note="gene_id=mCG52244.2 transcript_id=mCT52427.2
FT                   protein_id=mCP41380.2"
FT                   /protein_id="EDL20993.1"
FT                   /translation="MMASYPEPEDTAGTLLAPESGRAVKEAEASPPSPGKGGGTTPEKP
FT                   DPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSL
FT                   NECFIKVPREGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLF
FT                   GSGGAAGGCGVPGAGCGGIRLGGPPAAPPPPPPPPHPHPHPHAHHLHAAAAPPPAPPHH
FT                   GAAAPPPGQLSPASPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALH
FT                   SRLDL"
FT   assembly_gap    9657637..9658142
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    9662328..9662347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9666332..9666351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9667676..9667981
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    9669813..9670406
FT                   /estimated_length=594
FT                   /gap_type="unknown"
FT   assembly_gap    9674212..9674613
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    9677684..9677800
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    9685626..9685774
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   gene            9687862..9703507
FT                   /gene="Faim"
FT                   /locus_tag="mCG_9782"
FT                   /note="gene_id=mCG9782.1"
FT   mRNA            join(9687862..9688001,9692404..9692460,9693590..9693722,
FT                   9694002..9694230,9700456..9700505,9703044..9703507)
FT                   /gene="Faim"
FT                   /locus_tag="mCG_9782"
FT                   /product="Fas apoptotic inhibitory molecule, transcript
FT                   variant mCT170578"
FT                   /note="gene_id=mCG9782.1 transcript_id=mCT170578.0 created
FT                   on 10-JUL-2002"
FT   mRNA            join(9687862..9688001,9693590..9693722,9694002..9694230,
FT                   9700456..9700505,9703044..9703507)
FT                   /gene="Faim"
FT                   /locus_tag="mCG_9782"
FT                   /product="Fas apoptotic inhibitory molecule, transcript
FT                   variant mCT9850"
FT                   /note="gene_id=mCG9782.1 transcript_id=mCT9850.1 created on
FT                   10-JUL-2002"
FT   CDS             join(9692417..9692460,9693590..9693722,9694002..9694230,
FT                   9700456..9700505,9703044..9703193)
FT                   /codon_start=1
FT                   /gene="Faim"
FT                   /locus_tag="mCG_9782"
FT                   /product="Fas apoptotic inhibitory molecule, isoform CRA_a"
FT                   /note="gene_id=mCG9782.1 transcript_id=mCT170578.0
FT                   protein_id=mCP93496.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3Z3C1"
FT                   /db_xref="InterPro:IPR010695"
FT                   /db_xref="MGI:MGI:1344387"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z3C1"
FT                   /protein_id="EDL20994.1"
FT                   /translation="MASGDDSPIFEDDESPLYSLEKMTDLVAVWDVALSDGVHKIEFEH
FT                   GTTSGKRVVYVDGKEEIRREWMFKLVGKETFFVGAAKTKATINIDAISGFAYEYTLEID
FT                   GKSLKKYMENRSKTTSTWVLRLDGEDLRVVLEKDTMDVWCNGQKMETAGEFVDDGTETH
FT                   FSVGNHGCYIKAVSSGKRKEGIIHTLIVDNREIPELTQ"
FT   CDS             join(9693612..9693722,9694002..9694230,9700456..9700505,
FT                   9703044..9703193)
FT                   /codon_start=1
FT                   /gene="Faim"
FT                   /locus_tag="mCG_9782"
FT                   /product="Fas apoptotic inhibitory molecule, isoform CRA_b"
FT                   /note="gene_id=mCG9782.1 transcript_id=mCT9850.1
FT                   protein_id=mCP21321.0 isoform=CRA_b"
FT                   /protein_id="EDL20995.1"
FT                   /translation="MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRREWM
FT                   FKLVGKETFFVGAAKTKATINIDAISGFAYEYTLEIDGKSLKKYMENRSKTTSTWVLRL
FT                   DGEDLRVVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHGCYIKAVSSGKRKEGI
FT                   IHTLIVDNREIPELTQ"
FT   gene            complement(9708288..>9712768)
FT                   /locus_tag="mCG_9779"
FT                   /note="gene_id=mCG9779.2"
FT   mRNA            complement(join(9708288..9708570,9710731..9710935,
FT                   9712599..>9712768))
FT                   /locus_tag="mCG_9779"
FT                   /product="mCG9779"
FT                   /note="gene_id=mCG9779.2 transcript_id=mCT9848.2 created on
FT                   10-JUL-2002"
FT   CDS             complement(join(9708566..9708570,9710731..9710935,
FT                   9712599..>9712766))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9779"
FT                   /product="mCG9779"
FT                   /note="gene_id=mCG9779.2 transcript_id=mCT9848.2
FT                   protein_id=mCP21319.2"
FT                   /protein_id="EDL20996.1"
FT                   /translation="HIGSVSITTPEQTIQKARGETVHLPCTFTLSPEDHGPLFIDWMQL
FT                   TGPQNEVVNRMFIVYLADKIYDNFYQDMKGRVQFTSNDIRSGEASINITDARLSDAGTY
FT                   QCGVSHAFGTAKGTIQLTVVG"
FT   assembly_gap    9711618..9711769
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            complement(<9715674..9737107)
FT                   /locus_tag="mCG_113820"
FT                   /note="gene_id=mCG113820.1"
FT   mRNA            complement(join(<9715674..9715878,9717605..9717774,
FT                   9719792..9719996,9724651..9724820,9736985..9737107))
FT                   /locus_tag="mCG_113820"
FT                   /product="mCG113820"
FT                   /note="gene_id=mCG113820.1 transcript_id=mCT114908.1
FT                   created on 10-JUL-2002"
FT   CDS             complement(join(<9715674..9715878,9717605..9717774,
FT                   9719792..9719996,9724651..9724820,9736985..9737027))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113820"
FT                   /product="mCG113820"
FT                   /note="gene_id=mCG113820.1 transcript_id=mCT114908.1
FT                   protein_id=mCP68852.1"
FT                   /protein_id="EDL20997.1"
FT                   /translation="MVFLLGFLFLCGVTDHIGSVSITTPEQTIQEVQGETVHLPCMFTL
FT                   SPEDQGPLDIEWLRLSGPNNEAMDHVIILYAVDKIYSDFYQDMRGRVNFTSNGITSGEA
FT                   SIKIRDVQPADSGTYLCKVKTAPGVAKTTVQLTVVDYIGSVSITTPEQTIEKDQGETVH
FT                   LPCMFTFISKDQGPLNIEWLRLSGPNNEAMDHVVILYSADKIHDDVYPDLKGRVYFTSN
FT                   DIKSGDASINITNVQLSDAGTYQCKVKTYPGTVNRNLQLAVT"
FT   assembly_gap    9718771..9718790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9720149..9720168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9739806..9825751)
FT                   /gene="Pik3cb"
FT                   /locus_tag="mCG_113823"
FT                   /note="gene_id=mCG113823.1"
FT   mRNA            complement(join(9739806..9741254,9742328..9742460,
FT                   9743931..9744076,9746152..9746275,9747954..9748121,
FT                   9753723..9753801,9755389..9755498,9756760..9756938,
FT                   9761603..9761702,9763149..9763292,9764255..9764376,
FT                   9765442..9765630,9766982..9767032,9771663..9771793,
FT                   9772770..9772866,9775004..9775255,9791914..9791991,
FT                   9793459..9793629,9796334..9796513,9797731..9797954,
FT                   9804484..9804709,9808850..9809036,9825655..9825751))
FT                   /gene="Pik3cb"
FT                   /locus_tag="mCG_113823"
FT                   /product="phosphatidylinositol 3-kinase, catalytic, beta
FT                   polypeptide"
FT                   /note="gene_id=mCG113823.1 transcript_id=mCT114911.1
FT                   created on 10-JUL-2002"
FT   CDS             complement(join(9741117..9741254,9742328..9742460,
FT                   9743931..9744076,9746152..9746275,9747954..9748121,
FT                   9753723..9753801,9755389..9755498,9756760..9756938,
FT                   9761603..9761702,9763149..9763292,9764255..9764376,
FT                   9765442..9765630,9766982..9767032,9771663..9771793,
FT                   9772770..9772866,9775004..9775255,9791914..9791991,
FT                   9793459..9793629,9796334..9796513,9797731..9797954,
FT                   9804484..9804709,9808850..9809002))
FT                   /codon_start=1
FT                   /gene="Pik3cb"
FT                   /locus_tag="mCG_113823"
FT                   /product="phosphatidylinositol 3-kinase, catalytic, beta
FT                   polypeptide"
FT                   /note="gene_id=mCG113823.1 transcript_id=mCT114911.1
FT                   protein_id=mCP68638.1"
FT                   /db_xref="GOA:Q8BTI9"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1922019"
FT                   /db_xref="PDB:2Y3A"
FT                   /db_xref="PDB:4BFR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BTI9"
FT                   /protein_id="EDL20998.1"
FT                   /translation="MPPAMADNLDIWAVDSQIASDGAISVDFLLPTGIYIQLEVPREAT
FT                   ISYIKQMLWKQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLK
FT                   LVTRSCDPAEKLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEAKIQSLVGLSWI
FT                   DWLKHTYPPEHEPSVLENLEDKLYGGKLVVAVHFENSQDVFSFQVSPNLNPIKINELAI
FT                   QKRLTIRGKEDEASPCDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECC
FT                   KIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRVISHIWDNNNPFQITLVKGNKLNTE
FT                   ETVKVHVRAGLFHGTELLCKTVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVY
FT                   AVLDKVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSS
FT                   FPDELEEMLNPMGTVQTNPYAENATALHITFPENKKQPCYYPPFDKIIEKAAELASGDS
FT                   ANVSSRGGKKFLAVLKEILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKW
FT                   NKLEDVAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQ
FT                   LVQVLKYEPFLDCALSRFLLERALDNRRIGQFLFWHLRSEVHTPAVSVQFGVILEAYCR
FT                   GSVGHMKVLSKQVEALNKLKTLNSLIKLNAVKLSRAKGKEAMHTCLKQSAYREALSDLQ
FT                   SPLNPCVILSELYVEKCKYMDSKMKPLWLVYSSRAFGEDSVGVIFKNGDDLRQDMLTLQ
FT                   MLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFN
FT                   KDALLNWLKEYNSGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHI
FT                   DFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRR
FT                   HGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWT
FT                   TKVNWMAHTVRKDYRS"
FT   assembly_gap    9750475..9750533
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    9785416..9785435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9787099..9787118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9820918..9821429
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   assembly_gap    9843370..9843677
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    9847186..9848647
FT                   /estimated_length=1462
FT                   /gap_type="unknown"
FT   assembly_gap    9849431..9849458
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    9851316..9851454
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    9852191..9852234
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    9852726..9852912
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    9854847..9854866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9859402..9859611
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   gene            complement(9861687..9862117)
FT                   /pseudo
FT                   /locus_tag="mCG_140656"
FT                   /note="gene_id=mCG140656.0"
FT   mRNA            complement(9861687..9862117)
FT                   /pseudo
FT                   /locus_tag="mCG_140656"
FT                   /note="gene_id=mCG140656.0 transcript_id=mCT170547.0
FT                   created on 10-JUL-2002"
FT   assembly_gap    9907332..9907351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9918428..9918664
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   gene            complement(9923696..9924218)
FT                   /pseudo
FT                   /locus_tag="mCG_140658"
FT                   /note="gene_id=mCG140658.0"
FT   mRNA            complement(9923696..9924218)
FT                   /pseudo
FT                   /locus_tag="mCG_140658"
FT                   /note="gene_id=mCG140658.0 transcript_id=mCT170556.0
FT                   created on 10-JUL-2002"
FT   gene            complement(<9933114..>9940017)
FT                   /locus_tag="mCG_18104"
FT                   /note="gene_id=mCG18104.2"
FT   mRNA            complement(join(<9933114..9933263,9936092..9936141,
FT                   9937963..9938191,9939910..>9940017))
FT                   /locus_tag="mCG_18104"
FT                   /product="mCG18104"
FT                   /note="gene_id=mCG18104.2 transcript_id=mCT19943.2 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(9933114..9933263,9936092..9936141,
FT                   9937963..9938191,9939910..9940017))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18104"
FT                   /product="mCG18104"
FT                   /note="gene_id=mCG18104.2 transcript_id=mCT19943.2
FT                   protein_id=mCP21244.2"
FT                   /db_xref="GOA:J3QPY3"
FT                   /db_xref="InterPro:IPR010695"
FT                   /db_xref="MGI:MGI:3647754"
FT                   /db_xref="UniProtKB/TrEMBL:J3QPY3"
FT                   /protein_id="EDL20999.1"
FT                   /translation="MKIAAIWDVILSDGVHKIEFEHGTTSGKRVVYVDGKEVIRKEWMF
FT                   PLVGKETFCVGAAKNKAIIRILSGKGCGFSYTLEIDGKSFRKFVENRSKTTNTWVLHLD
FT                   DKDFRIVLEKPTMDVWCNGKIVESVGEFVDDGTETHFSVGNHGCYIKAVSSGKKREGII
FT                   HTLIVDNREIPELTQ"
FT   assembly_gap    9936367..9936494
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   gene            9947020..9997647
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /note="gene_id=mCG18107.2"
FT   mRNA            join(9947020..9947172,9949994..9950093,9957982..9958104,
FT                   9966265..9966355,9966555..9966678,9967358..9967538,
FT                   9972889..9973058,9974700..9974756,9975248..9975329,
FT                   9975421..9975509,9978339..9978413,9986509..9986614,
FT                   9988838..9989008,9993338..9993484,9993587..9993755,
FT                   9994890..9995004,9995749..9995828,9996974..9997647)
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /product="centrosomal protein 70, transcript variant
FT                   mCT19947"
FT                   /note="gene_id=mCG18107.2 transcript_id=mCT19947.2 created
FT                   on 01-AUG-2002"
FT   mRNA            join(9947117..9947172,9949950..9950093,9957982..9958104,
FT                   9966265..9966355,9966555..9966678,9967358..9967538,
FT                   9972889..9973058,9974700..9974756,9975248..9975329,
FT                   9975421..9975509,9978339..9978413,9986509..9986614,
FT                   9988838..9989008,9993338..9993484,9993587..9993755,
FT                   9994890..9995004,9995749..9995828,9996974..9997647)
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /product="centrosomal protein 70, transcript variant
FT                   mCT170559"
FT                   /note="gene_id=mCG18107.2 transcript_id=mCT170559.0 created
FT                   on 01-AUG-2002"
FT   mRNA            join(9947163..9947523,9949994..9950093,9957982..9958104,
FT                   9966265..9966355,9966555..9966678,9967358..9967538,
FT                   9972889..9973058,9974700..9974756,9975248..9975329,
FT                   9975421..9975509,9978339..9978413,9986509..9986614,
FT                   9988838..9989008,9993338..9993484,9993587..9993755,
FT                   9994890..9995004,9995749..9995828,9996974..9997647)
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /product="centrosomal protein 70, transcript variant
FT                   mCT170558"
FT                   /note="gene_id=mCG18107.2 transcript_id=mCT170558.0 created
FT                   on 01-AUG-2002"
FT   assembly_gap    9947592..9947630
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   CDS             join(9950085..9950093,9957982..9958104,9966265..9966355,
FT                   9966555..9966678,9967358..9967538,9972889..9973058,
FT                   9974700..9974756,9975248..9975329,9975421..9975509,
FT                   9978339..9978413,9986509..9986614,9988838..9989008,
FT                   9993338..9993484,9993587..9993755,9994890..9995004,
FT                   9995749..9995828,9996974..9997035)
FT                   /codon_start=1
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /product="centrosomal protein 70, isoform CRA_a"
FT                   /note="gene_id=mCG18107.2 transcript_id=mCT170559.0
FT                   protein_id=mCP93476.0 isoform=CRA_a"
FT                   /protein_id="EDL21000.1"
FT                   /translation="MTEGSQIFLLPISTSDSTKEPLSPVASKAQDPSLLSNRLMIEKQQ
FT                   EEAEWESINGLLMTHGFKPLCLVKGADLRDFIVFDKQSSQKMRQILKTLMEETTRQQSM
FT                   IRELIETNQQLKSELQLEQNRAAHQEQRANDLQQIMDSVKSKIGELEDESLNRVCQQQN
FT                   RIKDLQKEYKMLQMKCQQYKKNRMEQEGTIASLQKEIHRLAKEEEERILTQNRVFAHLC
FT                   RRVPHSVLDKQLLCLIDYYECKLRKLHIQRQFEEDSQSEEKDFTNLGASPNYKGVLMSL
FT                   QKQLKESKSRIDVLVGEKLSLQKDLENRPTEHELRLYKQQVKKLEKTLKKNIKLQDLIG
FT                   QKKSDDTEKKDEPSKDSHQQALIEQSYFQVLCSINSIVHNPRAPVIIYKQSKGRAPNGN
FT                   KDIGQDCGFEHLVPIIEMWVDELTSLKDLYKSLKILSAELVPWHSLKKLDEKEGVKVGD
FT                   LLFMVDTMLEEVENQKETSSTPNSQTLQAIVSHFQKLFDVQSLNGVFPRMNEVYTRLGE
FT                   MNNAVRNLQELLELDSSSSLCVVVSTVGKLCEIINKDVSEQVKQVLGPEDLQSIIKKLE
FT                   EHEEFFPAFQAFANDLLEILEIDDLDAIVPAVKKLKILSY"
FT   CDS             join(9950085..9950093,9957982..9958104,9966265..9966355,
FT                   9966555..9966678,9967358..9967538,9972889..9973058,
FT                   9974700..9974756,9975248..9975329,9975421..9975509,
FT                   9978339..9978413,9986509..9986614,9988838..9989008,
FT                   9993338..9993484,9993587..9993755,9994890..9995004,
FT                   9995749..9995828,9996974..9997035)
FT                   /codon_start=1
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /product="centrosomal protein 70, isoform CRA_a"
FT                   /note="gene_id=mCG18107.2 transcript_id=mCT19947.2
FT                   protein_id=mCP21330.2 isoform=CRA_a"
FT                   /protein_id="EDL21001.1"
FT                   /translation="MTEGSQIFLLPISTSDSTKEPLSPVASKAQDPSLLSNRLMIEKQQ
FT                   EEAEWESINGLLMTHGFKPLCLVKGADLRDFIVFDKQSSQKMRQILKTLMEETTRQQSM
FT                   IRELIETNQQLKSELQLEQNRAAHQEQRANDLQQIMDSVKSKIGELEDESLNRVCQQQN
FT                   RIKDLQKEYKMLQMKCQQYKKNRMEQEGTIASLQKEIHRLAKEEEERILTQNRVFAHLC
FT                   RRVPHSVLDKQLLCLIDYYECKLRKLHIQRQFEEDSQSEEKDFTNLGASPNYKGVLMSL
FT                   QKQLKESKSRIDVLVGEKLSLQKDLENRPTEHELRLYKQQVKKLEKTLKKNIKLQDLIG
FT                   QKKSDDTEKKDEPSKDSHQQALIEQSYFQVLCSINSIVHNPRAPVIIYKQSKGRAPNGN
FT                   KDIGQDCGFEHLVPIIEMWVDELTSLKDLYKSLKILSAELVPWHSLKKLDEKEGVKVGD
FT                   LLFMVDTMLEEVENQKETSSTPNSQTLQAIVSHFQKLFDVQSLNGVFPRMNEVYTRLGE
FT                   MNNAVRNLQELLELDSSSSLCVVVSTVGKLCEIINKDVSEQVKQVLGPEDLQSIIKKLE
FT                   EHEEFFPAFQAFANDLLEILEIDDLDAIVPAVKKLKILSY"
FT   CDS             join(9950085..9950093,9957982..9958104,9966265..9966355,
FT                   9966555..9966678,9967358..9967538,9972889..9973058,
FT                   9974700..9974756,9975248..9975329,9975421..9975509,
FT                   9978339..9978413,9986509..9986614,9988838..9989008,
FT                   9993338..9993484,9993587..9993755,9994890..9995004,
FT                   9995749..9995828,9996974..9997035)
FT                   /codon_start=1
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /product="centrosomal protein 70, isoform CRA_a"
FT                   /note="gene_id=mCG18107.2 transcript_id=mCT170558.0
FT                   protein_id=mCP93477.0 isoform=CRA_a"
FT                   /protein_id="EDL21002.1"
FT                   /translation="MTEGSQIFLLPISTSDSTKEPLSPVASKAQDPSLLSNRLMIEKQQ
FT                   EEAEWESINGLLMTHGFKPLCLVKGADLRDFIVFDKQSSQKMRQILKTLMEETTRQQSM
FT                   IRELIETNQQLKSELQLEQNRAAHQEQRANDLQQIMDSVKSKIGELEDESLNRVCQQQN
FT                   RIKDLQKEYKMLQMKCQQYKKNRMEQEGTIASLQKEIHRLAKEEEERILTQNRVFAHLC
FT                   RRVPHSVLDKQLLCLIDYYECKLRKLHIQRQFEEDSQSEEKDFTNLGASPNYKGVLMSL
FT                   QKQLKESKSRIDVLVGEKLSLQKDLENRPTEHELRLYKQQVKKLEKTLKKNIKLQDLIG
FT                   QKKSDDTEKKDEPSKDSHQQALIEQSYFQVLCSINSIVHNPRAPVIIYKQSKGRAPNGN
FT                   KDIGQDCGFEHLVPIIEMWVDELTSLKDLYKSLKILSAELVPWHSLKKLDEKEGVKVGD
FT                   LLFMVDTMLEEVENQKETSSTPNSQTLQAIVSHFQKLFDVQSLNGVFPRMNEVYTRLGE
FT                   MNNAVRNLQELLELDSSSSLCVVVSTVGKLCEIINKDVSEQVKQVLGPEDLQSIIKKLE
FT                   EHEEFFPAFQAFANDLLEILEIDDLDAIVPAVKKLKILSY"
FT   assembly_gap    9995461..9995480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9996253..10001976)
FT                   /locus_tag="mCG_53155"
FT                   /note="gene_id=mCG53155.3"
FT   mRNA            complement(join(9996253..9997000,10001722..10001976))
FT                   /locus_tag="mCG_53155"
FT                   /product="mCG53155"
FT                   /note="gene_id=mCG53155.3 transcript_id=mCT53338.3 created
FT                   on 20-FEB-2003"
FT   CDS             complement(10001778..10001888)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53155"
FT                   /product="mCG53155"
FT                   /note="gene_id=mCG53155.3 transcript_id=mCT53338.3
FT                   protein_id=mCP41339.3"
FT                   /protein_id="EDL21003.1"
FT                   /translation="MSTGNFCAVLQPGSGVTAASKANTVHERSQIITVEV"
FT   gene            complement(10007216..>10057588)
FT                   /gene="D9Ertd280e"
FT                   /locus_tag="mCG_18100"
FT                   /note="gene_id=mCG18100.3"
FT   mRNA            complement(join(10007216..10008923,10009192..10009241,
FT                   10012435..10012540,10013894..10014025,10014454..10014552,
FT                   10015136..10015635,10016751..10016900,10017503..10017589,
FT                   10018082..10018150,10018630..10018692,10018775..10018837,
FT                   10019346..10019435,10019845..10019893,10021406..10021488,
FT                   10022145..10022315,10025148..10025268,10027004..10027059,
FT                   10029764..10029847,10030422..10030488,10035104..10035258,
FT                   10037827..10037868,10057108..10057587))
FT                   /gene="D9Ertd280e"
FT                   /locus_tag="mCG_18100"
FT                   /product="DNA segment, Chr 9, ERATO Doi 280, expressed,
FT                   transcript variant mCT19940"
FT                   /note="gene_id=mCG18100.3 transcript_id=mCT19940.2 created
FT                   on 10-JUL-2002"
FT   mRNA            complement(join(10007389..10008923,10009192..10009241,
FT                   10012435..10012540,10013894..10014025,10014454..10014552,
FT                   10015136..10015635,10016751..10016900,10017503..10017589,
FT                   10018082..10018150,10018630..10018692,10018775..10018837,
FT                   10019346..10019435,10019845..10019893,10021406..10021488,
FT                   10022145..10022315,10025148..10025268,10027004..10027059,
FT                   10029764..10029853,10030422..10030488,10031853..10031929,
FT                   10035124..10035258,10037827..10037868,10057108..>10057588))
FT                   /gene="D9Ertd280e"
FT                   /locus_tag="mCG_18100"
FT                   /product="DNA segment, Chr 9, ERATO Doi 280, expressed,
FT                   transcript variant mCT191511"
FT                   /note="gene_id=mCG18100.3 transcript_id=mCT191511.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(10008887..10008923,10009192..10009241,
FT                   10012435..10012540,10013894..10014025,10014454..10014552,
FT                   10015136..10015635,10016751..10016900,10017503..10017589,
FT                   10018082..10018150,10018630..10018692,10018775..10018837,
FT                   10019346..10019435,10019845..10019893,10021406..10021488,
FT                   10022145..10022315,10025148..10025268,10027004..10027059,
FT                   10029764..10029853,10030422..10030488,10031853..10031929,
FT                   10035124..10035258,10037827..10037868,10057108..>10057470))
FT                   /codon_start=1
FT                   /gene="D9Ertd280e"
FT                   /locus_tag="mCG_18100"
FT                   /product="DNA segment, Chr 9, ERATO Doi 280, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG18100.3 transcript_id=mCT191511.0
FT                   protein_id=mCP112485.0 isoform=CRA_a"
FT                   /protein_id="EDL21004.1"
FT                   /translation="RGQAGDSEMQPEEPCAPSAPGGPDVPERGQRSRDPGPRLSGQLLP
FT                   ELYSFVARVLFYLAPVYLAGYLGLSVTWLLLGALLWMWWRRNRRGKLGRLEAAFEFLEH
FT                   EREFISRELRGQHLPAWIHFPDVERVEWANKIIIQIWPYLSMIMENKIREKLEPKIREK
FT                   SIHLRTFTFTKLYFGQKCPKVNGVKVHTDKRNRRKVTLDLQICYIGDCEISVELQKIRG
FT                   GVSGVQLQGTLRVILEPLLVDKPFIGAVTVFFLQKPHLQINWTGLTNLLDMPGINELSD
FT                   SLLEDLIAAHLVLPNRVTVPVKKGLDVTNLRVPLPCGVIRVHLLEAKKLAQKDNFLGLG
FT                   GKSDPYAKVSIGLQHCRSRTIYKNLNPTWNEVFEFMVYEVPGQDLEVDLYDEDTDKDDF
FT                   LGSLQICLGDVMKNRVVDEWFALNDTTSGRLHLRLEWLSLLTDQEALTENDSGLSTAIL
FT                   VVFLENACNLPRNPFDYLNGEYRAKKLSRFVKNKASRDPSSYVKLTVGKKTFTSKTCPH
FT                   SKDPVWSQVFSFFVHSVAAEQLCLKVLDDELECALGVLEFPLCRILPCADLTLEQCFQL
FT                   DHSGLDSLISMRLVLRFLRVEGRELGSPYTGPDALKKGPLFIKKVATNQGCKAPPLNEG
FT                   LADVTSTSNPASYIKGASKSIDNISAATTDPEPMPEPQGPGPEPKGKDSARGLCESPGK
FT                   KKNPATTFLTVPGLHSPGPIKSPRPMSRPAFPFAWPLTRVAPSMSSLNSLASSCFDLTD
FT                   VSLNTEAGDSRQGRLGEIQLTVRYVCLRHCLRVLVNGCRNLTPCTSSGADPYVRIYLLP
FT                   ERRWASRKKTSVKQKTLEPLFDETFEFFVPMGEVQKRSLDVAVKNSRPLGSHRRKELGK
FT                   VLIDLSKQDLIKGFSQWYELTADGQPRS"
FT   CDS             complement(join(10008887..10008923,10009192..10009241,
FT                   10012435..10012540,10013894..10014025,10014454..10014552,
FT                   10015136..10015635,10016751..10016900,10017503..10017589,
FT                   10018082..10018150,10018630..10018692,10018775..10018837,
FT                   10019346..10019435,10019845..10019893,10021406..10021488,
FT                   10022145..10022315,10025148..10025268,10027004..10027059,
FT                   10029764..10029847,10030422..10030488,10035104..10035258,
FT                   10037827..10037868,10057108..10057446))
FT                   /codon_start=1
FT                   /gene="D9Ertd280e"
FT                   /locus_tag="mCG_18100"
FT                   /product="DNA segment, Chr 9, ERATO Doi 280, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG18100.3 transcript_id=mCT19940.2
FT                   protein_id=mCP21399.2 isoform=CRA_b"
FT                   /protein_id="EDL21005.1"
FT                   /translation="MQPEEPCAPSAPGGPDVPERGQRSRDPGPRLSGQLLPELYSFVAR
FT                   VLFYLAPVYLAGYLGLSVTWLLLGALLWMWWRRNRRGKLGRLEAAFEFLEHEREFISRE
FT                   LRGQHLPAWIHFPDVERVEWANKIIIQIWPYLSMIMENKIREKLEPKIREKSIHLRTFT
FT                   FTKLYFGQKVGTAPVSYIGDCEISVELQKIRGGVSGVQGTLRVILEPLLVDKPFIGAVT
FT                   VFFLQKPHLQINWTGLTNLLDMPGINELSDSLLEDLIAAHLVLPNRVTVPVKKGLDVTN
FT                   LRVPLPCGVIRVHLLEAKKLAQKDNFLGLGGKSDPYAKVSIGLQHCRSRTIYKNLNPTW
FT                   NEVFEFMVYEVPGQDLEVDLYDEDTDKDDFLGSLQICLGDVMKNRVVDEWFALNDTTSG
FT                   RLHLRLEWLSLLTDQEALTENDSGLSTAILVVFLENACNLPRNPFDYLNGEYRAKKLSR
FT                   FVKNKASRDPSSYVKLTVGKKTFTSKTCPHSKDPVWSQVFSFFVHSVAAEQLCLKVLDD
FT                   ELECALGVLEFPLCRILPCADLTLEQCFQLDHSGLDSLISMRLVLRFLRVEGRELGSPY
FT                   TGPDALKKGPLFIKKVATNQGCKAPPLNEGLADVTSTSNPASYIKGASKSIDNISAATT
FT                   DPEPMPEPQGPGPEPKGKDSARGLCESPGKKKNPATTFLTVPGLHSPGPIKSPRPMSRP
FT                   AFPFAWPLTRVAPSMSSLNSLASSCFDLTDVSLNTEAGDSRQGRLGEIQLTVRYVCLRH
FT                   CLRVLVNGCRNLTPCTSSGADPYVRIYLLPERRWASRKKTSVKQKTLEPLFDETFEFFV
FT                   PMGEVQKRSLDVAVKNSRPLGSHRRKELGKVLIDLSKQDLIKGFSQWYELTADGQPRS"
FT   assembly_gap    10027705..10029085
FT                   /estimated_length=1381
FT                   /gap_type="unknown"
FT   assembly_gap    10065363..10065423
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    10077010..10077060
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    10081196..10081215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10082837..10082977
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   gene            10084145..10085509
FT                   /locus_tag="mCG_18096"
FT                   /note="gene_id=mCG18096.2"
FT   mRNA            join(10084145..10084339,10084970..10085509)
FT                   /locus_tag="mCG_18096"
FT                   /product="mCG18096"
FT                   /note="gene_id=mCG18096.2 transcript_id=mCT19936.2 created
FT                   on 10-JUL-2002"
FT   gene            complement(10084151..10085488)
FT                   /locus_tag="mCG_147714"
FT                   /note="gene_id=mCG147714.0"
FT   mRNA            complement(10084151..10085488)
FT                   /locus_tag="mCG_147714"
FT                   /product="mCG147714"
FT                   /note="gene_id=mCG147714.0 transcript_id=mCT187977.0
FT                   created on 13-JAN-2004"
FT   CDS             join(10084338..10084339,10084970..10085180)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18096"
FT                   /product="mCG18096"
FT                   /note="gene_id=mCG18096.2 transcript_id=mCT19936.2
FT                   protein_id=mCP21257.1"
FT                   /protein_id="EDL21006.1"
FT                   /translation="MIVEDESPGPEMARSRPFCPPACGVSLGHGQFRMDALDDEPECTA
FT                   SAERGGGAGSLPSGQLCDSLLRALV"
FT   CDS             complement(10084490..10084747)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147714"
FT                   /product="mCG147714"
FT                   /note="gene_id=mCG147714.0 transcript_id=mCT187977.0
FT                   protein_id=mCP108541.0"
FT                   /protein_id="EDL21007.1"
FT                   /translation="MCVPITSDVYLPCNPLTSASLVCRFSSITLPPLYRFICPPQPSPL
FT                   PQYGAMLWPPPSQAPCHTGNIWMLPLGAPHTLPWLLLWST"
FT   gene            complement(10086243..10135429)
FT                   /gene="Mras"
FT                   /locus_tag="mCG_18105"
FT                   /note="gene_id=mCG18105.2"
FT   mRNA            complement(join(10086243..10087231,10088460..10088539,
FT                   10091673..10091772,10093196..10093349,10110127..10110336,
FT                   10135028..10135429))
FT                   /gene="Mras"
FT                   /locus_tag="mCG_18105"
FT                   /product="muscle and microspikes RAS, transcript variant
FT                   mCT170557"
FT                   /note="gene_id=mCG18105.2 transcript_id=mCT170557.0 created
FT                   on 10-JUL-2002"
FT   mRNA            complement(join(10086243..10087231,10088460..10088539,
FT                   10091673..10091772,10093196..10093349,10110127..10110336,
FT                   10124509..10124628))
FT                   /gene="Mras"
FT                   /locus_tag="mCG_18105"
FT                   /product="muscle and microspikes RAS, transcript variant
FT                   mCT19944"
FT                   /note="gene_id=mCG18105.2 transcript_id=mCT19944.1 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(10087132..10087231,10088460..10088539,
FT                   10091673..10091772,10093196..10093349,10110127..10110319))
FT                   /codon_start=1
FT                   /gene="Mras"
FT                   /locus_tag="mCG_18105"
FT                   /product="muscle and microspikes RAS, isoform CRA_a"
FT                   /note="gene_id=mCG18105.2 transcript_id=mCT170557.0
FT                   protein_id=mCP93475.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TPX5"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1100856"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TPX5"
FT                   /protein_id="EDL21008.1"
FT                   /translation="MATSAVPSENLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPT
FT                   IEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVD
FT                   RFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLN
FT                   VDKTFHDLVRVIRQQVPEKNQKKKKKTKWRGDRATGTHKLQCVIL"
FT   CDS             complement(join(10087132..10087231,10088460..10088539,
FT                   10091673..10091772,10093196..10093349,10110127..10110319))
FT                   /codon_start=1
FT                   /gene="Mras"
FT                   /locus_tag="mCG_18105"
FT                   /product="muscle and microspikes RAS, isoform CRA_a"
FT                   /note="gene_id=mCG18105.2 transcript_id=mCT19944.1
FT                   protein_id=mCP21316.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TPX5"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1100856"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TPX5"
FT                   /protein_id="EDL21009.1"
FT                   /translation="MATSAVPSENLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPT
FT                   IEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVD
FT                   RFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLN
FT                   VDKTFHDLVRVIRQQVPEKNQKKKKKTKWRGDRATGTHKLQCVIL"
FT   assembly_gap    10098596..10098935
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    10106077..10106137
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    10108791..10108810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10146817..10147034
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    10148537..10149096
FT                   /estimated_length=560
FT                   /gap_type="unknown"
FT   assembly_gap    10149822..10151675
FT                   /estimated_length=1854
FT                   /gap_type="unknown"
FT   assembly_gap    10157368..10157387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <10158786..10173805
FT                   /locus_tag="mCG_51521"
FT                   /note="gene_id=mCG51521.2"
FT   mRNA            join(<10158786..10158889,10159625..10159696,
FT                   10161583..10161699,10163613..10163688,10164093..10164263,
FT                   10167264..10167346,10168661..10168815,10169815..10169986,
FT                   10173448..10173805)
FT                   /locus_tag="mCG_51521"
FT                   /product="mCG51521, transcript variant mCT51704"
FT                   /note="gene_id=mCG51521.2 transcript_id=mCT51704.2 created
FT                   on 10-JUL-2002"
FT   CDS             join(<10158788..10158889,10159625..10159696,
FT                   10161583..10161699,10163613..10163688,10164093..10164263,
FT                   10167264..10167346,10168661..10168815,10169815..10169986,
FT                   10173448..10173609)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51521"
FT                   /product="mCG51521, isoform CRA_b"
FT                   /note="gene_id=mCG51521.2 transcript_id=mCT51704.2
FT                   protein_id=mCP41346.2 isoform=CRA_b"
FT                   /protein_id="EDL21011.1"
FT                   /translation="VDVYQGWCGPCKPMVSLFQKMRIEVGLDRLHFASAEADRLDVLEK
FT                   YQGKCEPTFLFYTRGELVAVVKGANPTLLQKTILQQLEAEKKVPAEGGEWRAATDEELL
FT                   GALKWPPHRKDGGEDGDIAAISHKSHRHCAMSFPEPSYEKSGPAAFEDQRVRQAPTGKM
FT                   ACINSQDAREPGLDTTASSGKTCTLGIIKPDAVAHGKAEEIIMKEAFERLVHHMCSGPS
FT                   HLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESETIVSFTLYQPVSGLSTAQKCL
FT                   LMLCMEAGTERTPTESWRCSSPVSSSQIKTRKLHRVLRLKLWWAPWRTLACLSVSEDWN
FT                   AVLSSAGIKVTRPPEEPSVHAGRHRRLQR"
FT   mRNA            join(10169498..10169986,10173448..10173805)
FT                   /locus_tag="mCG_51521"
FT                   /product="mCG51521, transcript variant mCT170571"
FT                   /note="gene_id=mCG51521.2 transcript_id=mCT170571.0 created
FT                   on 10-JUL-2002"
FT   CDS             join(10169798..10169986,10173448..10173609)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51521"
FT                   /product="mCG51521, isoform CRA_a"
FT                   /note="gene_id=mCG51521.2 transcript_id=mCT170571.0
FT                   protein_id=mCP93489.0 isoform=CRA_a"
FT                   /protein_id="EDL21010.1"
FT                   /translation="MHFSSSETIVSFTLYQPVSGLSTAQKCLLMLCMEAGTERTPTESW
FT                   RCSSPVSSSQIKTRKLHRVLRLKLWWAPWRTLACLSVSEDWNAVLSSAGIKVTRPPEEP
FT                   SVHAGRHRRLQR"
FT   gene            complement(10176953..10267541)
FT                   /gene="Armc8"
FT                   /locus_tag="mCG_18099"
FT                   /note="gene_id=mCG18099.2"
FT   mRNA            complement(join(10176953..10179355,10181719..10181812,
FT                   10182585..10182657,10186483..10186578,10194795..10194890,
FT                   10195887..10196036,10197937..10198029,10201156..10201242,
FT                   10203913..10203994,10204298..10204380,10219137..10219232,
FT                   10221789..10221989,10224003..10224063,10225541..10225631,
FT                   10225729..10225804,10227981..10228061,10231747..10231839,
FT                   10234444..10234541,10234812..10234954,10236337..10236408,
FT                   10250192..10250268,10267241..10267541))
FT                   /gene="Armc8"
FT                   /locus_tag="mCG_18099"
FT                   /product="armadillo repeat containing 8, transcript variant
FT                   mCT19939"
FT                   /note="gene_id=mCG18099.2 transcript_id=mCT19939.2 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(10179322..10179355,10181719..10181812,
FT                   10182585..10182657,10186483..10186578,10194795..10194890,
FT                   10195887..10196036,10197937..10198029,10201156..10201242,
FT                   10203913..10203994,10204298..10204380,10219137..10219232,
FT                   10221789..10221989,10224003..10224063,10225541..10225631,
FT                   10225729..10225804,10227981..10228061,10231747..10231839,
FT                   10234444..10234541,10234812..10234954,10236337..10236408,
FT                   10250192..10250268,10267241..10267285))
FT                   /codon_start=1
FT                   /gene="Armc8"
FT                   /locus_tag="mCG_18099"
FT                   /product="armadillo repeat containing 8, isoform CRA_b"
FT                   /note="gene_id=mCG18099.2 transcript_id=mCT19939.2
FT                   protein_id=mCP21376.2 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:1921375"
FT                   /db_xref="UniProtKB/TrEMBL:G3X920"
FT                   /protein_id="EDL21013.1"
FT                   /translation="MACLLETPIRMSVLSEVTASSRHYVDRLFDPDPQKVLQGVIDMKN
FT                   AVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDC
FT                   HIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYT
FT                   QEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSPSYKVRMQALKCFSVLAFENPQV
FT                   SMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDSCIVLKTL
FT                   PCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSA
FT                   ITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKIIETETMMDRIVTGLSESSVK
FT                   VRLAAVRCLHSLSRSVQQLRTSFQDHAVWKPLMKVLQNAPDEILVVASSMLCNLLLEFS
FT                   PSKEPILESGAVELLCGLTQSENPALRVNGIWALMNMAFQAEQKIKADILRSLSTEQLF
FT                   RLLSDSDMNVLMKTLGLLRNLLSTRPHIDKIMSTHGKQIMQAVTLILEGEHSIEVKEQT
FT                   LCILANIADGTTAKELIMTNDDILQKIKYYMGHSHVKLQLAAMFCISNLIWNEEEGSQE
FT                   RQDKLRDMGIVDILHKLSQSADSNLCDKAKTALQQYLA"
FT   mRNA            complement(join(10217455..10219232,10221789..10221989,
FT                   10224003..10224063,10225541..10225631,10225729..10225804,
FT                   10227981..10228061,10231747..10231839,10234444..10234541,
FT                   10234812..10234954,10236337..10236408,10250192..10250268,
FT                   10267241..10267541))
FT                   /gene="Armc8"
FT                   /locus_tag="mCG_18099"
FT                   /product="armadillo repeat containing 8, transcript variant
FT                   mCT170553"
FT                   /note="gene_id=mCG18099.2 transcript_id=mCT170553.0 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(10219071..10219232,10221789..10221989,
FT                   10224003..10224063,10225541..10225631,10225729..10225804,
FT                   10227981..10228061,10231747..10231839,10234444..10234541,
FT                   10234812..10234954,10236337..10236408,10250192..10250268,
FT                   10267241..10267285))
FT                   /codon_start=1
FT                   /gene="Armc8"
FT                   /locus_tag="mCG_18099"
FT                   /product="armadillo repeat containing 8, isoform CRA_a"
FT                   /note="gene_id=mCG18099.2 transcript_id=mCT170553.0
FT                   protein_id=mCP93471.0 isoform=CRA_a"
FT                   /protein_id="EDL21012.1"
FT                   /translation="MACLLETPIRMSVLSEVTASSRHYVDRLFDPDPQKVLQGVIDMKN
FT                   AVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDC
FT                   HIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYT
FT                   QEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSPSYKVRMQALKCFSVLAFENPQV
FT                   SMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDSCIVLKTL
FT                   PCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSA
FT                   ITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST
FT                   "
FT   assembly_gap    10270842..10271149
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   gene            10274277..10282970
FT                   /gene="Dbr1"
FT                   /locus_tag="mCG_18106"
FT                   /note="gene_id=mCG18106.2"
FT   mRNA            join(10274277..10274603,10275054..10275178,
FT                   10276919..10276999,10277835..10277920,10278617..10278841,
FT                   10280500..10280580,10280795..10280940,10281790..10282970)
FT                   /gene="Dbr1"
FT                   /locus_tag="mCG_18106"
FT                   /product="debranching enzyme homolog 1 (S. cerevisiae)"
FT                   /note="gene_id=mCG18106.2 transcript_id=mCT19946.2 created
FT                   on 10-JUL-2002"
FT   CDS             join(10274407..10274603,10275054..10275178,
FT                   10276919..10276999,10277835..10277920,10278617..10278841,
FT                   10280500..10280580,10280795..10280940,10281790..10282498)
FT                   /codon_start=1
FT                   /gene="Dbr1"
FT                   /locus_tag="mCG_18106"
FT                   /product="debranching enzyme homolog 1 (S. cerevisiae)"
FT                   /note="gene_id=mCG18106.2 transcript_id=mCT19946.2
FT                   protein_id=mCP21247.2"
FT                   /protein_id="EDL21014.1"
FT                   /translation="MRVAVAGCCHGELDKIYETLALAERRGSGPVDLLLCCGDFQAVRN
FT                   EADLRCMAVPPKYRHMQTFYRYYSGEKKAPVLTIFIGGNHEASNHLQELPYGGWVAPNI
FT                   YYLGLAGVVKYRGVRIGGISGIFKSHDYRKGHFECPPYNSSTIRSIYHVRNIEVYKLKQ
FT                   LKQPVHIFLSHDWPRNIYHYGNKKQLLKTKSFFRQEVENSTLGSPAASELLEHLQPAYW
FT                   FSAHLHVKFAALMQHQATDKDQAGKETKFLALDKCLPHRDFLQVLEIEHDPSAPEYLEY
FT                   DVEWLTVLRATDDLINVTGGLWNMPEDNGLHTRWDYSATEETMKEVMEKLNHDPKVPCN
FT                   FTMTAACYDPSKPQTQVKLVHRINPQTTEFCAQLGITDINVMIQKAREEEHHQCGEYEQ
FT                   QGDPGTEESEEDRSEYNTDTSALSSINPDEIMLDEEEEEEEEEEAVSAHSDMNTPSVEP
FT                   ASDQASDLSTSFSDIRNLPSSMFVSSDDASRSPASGEGKCGETVESGDEKDLAKFPLKR
FT                   LSDEHEPEQRKKIKRRNQAIYAAVDDGDASAE"
FT   assembly_gap    10291002..10291149
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    10299045..10299064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10301264..10301283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10312597..>10320904
FT                   /locus_tag="mCG_18102"
FT                   /note="gene_id=mCG18102.1"
FT   mRNA            join(10312597..10312687,10313521..10314009,
FT                   10320290..>10320904)
FT                   /locus_tag="mCG_18102"
FT                   /product="mCG18102"
FT                   /note="gene_id=mCG18102.1 transcript_id=mCT19942.1 created
FT                   on 10-JUL-2002"
FT   CDS             join(10313599..10314009,10320290..10320904)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18102"
FT                   /product="mCG18102"
FT                   /note="gene_id=mCG18102.1 transcript_id=mCT19942.1
FT                   protein_id=mCP21232.2"
FT                   /db_xref="GOA:Q14BT6"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR007652"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:2143261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14BT6"
FT                   /protein_id="EDL21015.1"
FT                   /translation="MLKEIYLSLSLVLVFACGLLYQLTMRSQCFFACLPPFSFPQGLDG
FT                   LLRSGRSIMFIETSERVEPPPMVSCAVESAAKIYPEQPIIFFMKGLRDSVQLTSNTSYP
FT                   AFSLLSAINNVFFVPLDMERLFKDTPLFSWYTKVNSSTEKHWLHVSSDAARLAIIWKYG
FT                   GIYMDTDVISLQPIPEENFLAAQGSRHSSNGVFGFLPHHPFLWACMENFVEHYDSTIWG
FT                   NQGPQLMTRMLRVWCRLKDFHGLGDLKCLNISFLHPQRFYPIPYPQWKRYYQVWDKEPS
FT                   FNESYALHLWNYMNKEGKTVVRGSKTLVENLYQKHCPKTYRVLIQGAEGTVSKKPGTGS
FT                   R"
FT   assembly_gap    10322803..10323188
FT                   /estimated_length=386
FT                   /gap_type="unknown"
FT   gene            10329689..10369119
FT                   /gene="Dzip1l"
FT                   /locus_tag="mCG_18098"
FT                   /note="gene_id=mCG18098.3"
FT   mRNA            join(10329689..10330074,10332749..10332860,
FT                   10337442..10338018,10339910..10339994,10341840..10341958,
FT                   10342639..10342800,10347298..10347426,10349766..10349828,
FT                   10351125..10351265,10355071..10355101,10355789..10355842,
FT                   10359838..10359980,10361127..10361310,10363146..10363362,
FT                   10363731..10363921,10365918..10366057,10367835..10369119)
FT                   /gene="Dzip1l"
FT                   /locus_tag="mCG_18098"
FT                   /product="DAZ interacting protein 1-like, transcript
FT                   variant mCT19938"
FT                   /note="gene_id=mCG18098.3 transcript_id=mCT19938.3 created
FT                   on 14-JUN-2003"
FT   mRNA            join(10329689..10330074,10337442..10338018,
FT                   10339910..10339994,10341840..10341958,10342639..10342800,
FT                   10347298..10347426,10349766..10349828,10351125..10351265,
FT                   10355071..10355101,10355789..10355842,10359838..10359980,
FT                   10361127..10361310,10363146..10363362,10363734..10363921,
FT                   10365918..10366057,10367835..10369119)
FT                   /gene="Dzip1l"
FT                   /locus_tag="mCG_18098"
FT                   /product="DAZ interacting protein 1-like, transcript
FT                   variant mCT185186"
FT                   /note="gene_id=mCG18098.3 transcript_id=mCT185186.0 created
FT                   on 14-JUN-2003"
FT   CDS             join(10337518..10338018,10339910..10339994,
FT                   10341840..10341958,10342639..10342800,10347298..10347426,
FT                   10349766..10349828,10351125..10351265,10355071..10355101,
FT                   10355789..10355842,10359838..10359980,10361127..10361310,
FT                   10363146..10363362,10363731..10363921,10365918..10366057,
FT                   10367835..10367999)
FT                   /codon_start=1
FT                   /gene="Dzip1l"
FT                   /locus_tag="mCG_18098"
FT                   /product="DAZ interacting protein 1-like, isoform CRA_b"
FT                   /note="gene_id=mCG18098.3 transcript_id=mCT19938.3
FT                   protein_id=mCP21347.3 isoform=CRA_b"
FT                   /db_xref="GOA:B2RR42"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR032714"
FT                   /db_xref="MGI:MGI:1919757"
FT                   /db_xref="UniProtKB/TrEMBL:B2RR42"
FT                   /protein_id="EDL21017.1"
FT                   /translation="MQYPAATAEGLSGPLSGAYTLPAFKFQPRRESIDWRRISAVDVDR
FT                   VARELDVATLQENIAGVTFCNLDGEVCNHCRQPVDPVLLKVLRLAQLIIEYLLHCQDCL
FT                   SASVAQLEARLQASLGQQQRGQQELGRQADELKGVREESRRRRKMISTLQQLLLQTSAH
FT                   SYHTCHLCDKTFMNATFLRGHIQRRHAGMADVGKQKQEQPLGEVLEELRAKLKWTQGEL
FT                   EAQREAERQRQVQELEMARQREMEAKKKFDEWKEKERSKLYGEIDKLKQLFWDEFKTVA
FT                   NQNSTLEEKLKALQSYSMTESHLGSLRDEESEERLKHAQEVQALQEKMEVQKTEWKRKM
FT                   KALHEERAAERRQLQEENERLHVSLSQDQKKAAAQSQRHINALRAQLQEQARLIESQEE
FT                   TIQTLSLRKVEEVQEMPKAVATEEDSSEEELEASLEERQEQRKVLAALRKNPTWLKQFR
FT                   PILEDTLEEKLEGLGIKRDTKGISAQTVRRLEPLLRTQREQIARSFREFPSLREKLNKE
FT                   VSSRVKQRWESTTQPDGQPPVKSQRVTLATREVRPKTRTLTVALPSKPAEPSTPTLQGH
FT                   SSHGPGLTQVSTPIPRPRVHGPSSTPVSPGSGLSSTPPFSSEEEPEGDVVQRVSLQPPK
FT                   VLPRSAAKPEDNWGWSDSETSEESAQPPGKGSGGLASSGTLVQSIVKNLEKQLETPAKK
FT                   PSGGVNMFLRPNAALQRASTPARKSQLSEDESDVEISSLEDLSQDLGQKGKPKPLSHSK
FT                   LPEKFDVSPWSSGSRPRIPGW"
FT   CDS             join(10337518..10338018,10339910..10339994,
FT                   10341840..10341958,10342639..10342800,10347298..10347426,
FT                   10349766..10349828,10351125..10351265,10355071..10355101,
FT                   10355789..10355842,10359838..10359980,10361127..10361310,
FT                   10363146..10363362,10363734..10363921,10365918..10366057,
FT                   10367835..10367999)
FT                   /codon_start=1
FT                   /gene="Dzip1l"
FT                   /locus_tag="mCG_18098"
FT                   /product="DAZ interacting protein 1-like, isoform CRA_a"
FT                   /note="gene_id=mCG18098.3 transcript_id=mCT185186.0
FT                   protein_id=mCP106444.0 isoform=CRA_a"
FT                   /protein_id="EDL21016.1"
FT                   /translation="MQYPAATAEGLSGPLSGAYTLPAFKFQPRRESIDWRRISAVDVDR
FT                   VARELDVATLQENIAGVTFCNLDGEVCNHCRQPVDPVLLKVLRLAQLIIEYLLHCQDCL
FT                   SASVAQLEARLQASLGQQQRGQQELGRQADELKGVREESRRRRKMISTLQQLLLQTSAH
FT                   SYHTCHLCDKTFMNATFLRGHIQRRHAGMADVGKQKQEQPLGEVLEELRAKLKWTQGEL
FT                   EAQREAERQRQVQELEMARQREMEAKKKFDEWKEKERSKLYGEIDKLKQLFWDEFKTVA
FT                   NQNSTLEEKLKALQSYSMTESHLGSLRDEESEERLKHAQEVQALQEKMEVQKTEWKRKM
FT                   KALHEERAAERRQLQEENERLHVSLSQDQKKAAAQSQRHINALRAQLQEQARLIESQEE
FT                   TIQTLSLRKVEEVQEMPKAVATEEDSSEEELEASLEERQEQRKVLAALRKNPTWLKQFR
FT                   PILEDTLEEKLEGLGIKRDTKGISAQTVRRLEPLLRTQREQIARSFREFPSLREKLNKE
FT                   VSSRVKQRWESTTQPDGQPPVKSQRVTLATREVRPKTRTLTVALPSKPAEPSTPTLQGH
FT                   SSHGPGLTQVSTPIPRPRVHGPSSTPVSPGSGLSTPPFSSEEEPEGDVVQRVSLQPPKV
FT                   LPRSAAKPEDNWGWSDSETSEESAQPPGKGSGGLASSGTLVQSIVKNLEKQLETPAKKP
FT                   SGGVNMFLRPNAALQRASTPARKSQLSEDESDVEISSLEDLSQDLGQKGKPKPLSHSKL
FT                   PEKFDVSPWSSGSRPRIPGW"
FT   assembly_gap    10343796..10344087
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    10389977..10390049
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   gene            complement(10391033..10417513)
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /note="gene_id=mCG18101.2"
FT   mRNA            complement(join(10391033..10393128,10396269..10396379,
FT                   10398250..10398376,10398987..10399151,10417242..10417513))
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, transcript variant mCT55446"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT55446.1 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(10391033..10393128,10396257..10396379,
FT                   10398250..10398376,10398987..10399151,10417242..10417513))
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, transcript variant mCT170555"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT170555.0 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(10391033..10393128,10396269..10396379,
FT                   10398250..10398376,10398987..10399151,10409994..10410328))
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, transcript variant mCT19941"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT19941.2 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(10391033..10393128,10396257..10396379,
FT                   10398250..10398376,10398987..10399151,10409994..10410328))
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, transcript variant mCT170554"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT170554.0 created
FT                   on 11-JUL-2002"
FT   CDS             complement(join(10392957..10393128,10396269..10396379,
FT                   10398250..10398376,10398987..10399151,10417242..10417461))
FT                   /codon_start=1
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, isoform CRA_c"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT55446.1
FT                   protein_id=mCP41398.1 isoform=CRA_c"
FT                   /protein_id="EDL21020.1"
FT                   /translation="MSVTACQGLGFVVSLIGFAGIIAATCMDQWSTQDLYNNPVTAVFN
FT                   YQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCI
FT                   RIGSMDDSAKAKMTLTSGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGG
FT                   MVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLTPDDSNFKAVSYHASGQNVA
FT                   YRPGGFKASTGFGSNTRNKKIYDGGARTEDDEQSHPTKYDYV"
FT   CDS             complement(join(10392957..10393128,10396269..10396379,
FT                   10398250..10398376,10398987..10399151,10409994..10410213))
FT                   /codon_start=1
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, isoform CRA_b"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT19941.2
FT                   protein_id=mCP21231.2 isoform=CRA_b"
FT                   /protein_id="EDL21019.1"
FT                   /translation="MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQ
FT                   YEGLWRSCVQQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCI
FT                   RIGSMDDSAKAKMTLTSGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGG
FT                   MVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLTPDDSNFKAVSYHASGQNVA
FT                   YRPGGFKASTGFGSNTRNKKIYDGGARTEDDEQSHPTKYDYV"
FT   CDS             complement(join(10396265..10396379,10398250..10398376,
FT                   10398987..10399151,10417242..10417461))
FT                   /codon_start=1
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, isoform CRA_d"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT170555.0
FT                   protein_id=mCP93472.0 isoform=CRA_d"
FT                   /protein_id="EDL21021.1"
FT                   /translation="MSVTACQGLGFVVSLIGFAGIIAATCMDQWSTQDLYNNPVTAVFN
FT                   YQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCI
FT                   RIGSMDDSAKAKMTLTSGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGG
FT                   MVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLTPDDSK"
FT   CDS             complement(join(10396265..10396379,10398250..10398376,
FT                   10398987..10399151,10409994..10410213))
FT                   /codon_start=1
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, isoform CRA_a"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT170554.0
FT                   protein_id=mCP93473.0 isoform=CRA_a"
FT                   /protein_id="EDL21018.1"
FT                   /translation="MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQ
FT                   YEGLWRSCVQQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCI
FT                   RIGSMDDSAKAKMTLTSGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGG
FT                   MVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLTPDDSK"
FT   assembly_gap    10404266..10404711
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    10440084..10442369
FT                   /estimated_length=2286
FT                   /gap_type="unknown"
FT   assembly_gap    10443554..10443573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10483826..10483845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10490105..10490124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10494004..10494056
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   gene            complement(10494231..10494595)
FT                   /pseudo
FT                   /locus_tag="mCG_116253"
FT                   /note="gene_id=mCG116253.1"
FT   mRNA            complement(10494231..10494595)
FT                   /pseudo
FT                   /locus_tag="mCG_116253"
FT                   /note="gene_id=mCG116253.1 transcript_id=mCT117370.1
FT                   created on 22-JUL-2002"
FT   assembly_gap    10508273..10508776
FT                   /estimated_length=504
FT                   /gap_type="unknown"
FT   assembly_gap    10511704..10511861
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    10514112..10514133
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    10516285..10516551
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    10542300..10542515
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    10553595..10553614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <10560843..10561361
FT                   /locus_tag="mCG_1032883"
FT                   /note="gene_id=mCG1032883.1"
FT   mRNA            <10560843..10561361
FT                   /locus_tag="mCG_1032883"
FT                   /product="mCG1032883"
FT                   /note="gene_id=mCG1032883.1 transcript_id=mCT150587.1
FT                   created on 22-JUL-2002"
FT   CDS             10560843..10561169
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032883"
FT                   /product="mCG1032883"
FT                   /note="gene_id=mCG1032883.1 transcript_id=mCT150587.1
FT                   protein_id=mCP68900.1"
FT                   /protein_id="EDL21022.1"
FT                   /translation="MNINELTPLQENNISFLFLFYRSVGFVSVILSYQQRGNKLSCKSF
FT                   CPHLEHIKTMPFFFLLADSFSPFAYQLIHHYILNEIARPRPSPKFQPDVGKWEAGFPCF
FT                   RIVT"
FT   gene            complement(10567411..10569365)
FT                   /locus_tag="mCG_1032756"
FT                   /note="gene_id=mCG1032756.1"
FT   mRNA            complement(10567411..10569365)
FT                   /locus_tag="mCG_1032756"
FT                   /product="mCG1032756"
FT                   /note="gene_id=mCG1032756.1 transcript_id=mCT150460.1
FT                   created on 22-JUL-2002"
FT   CDS             complement(10568266..10568988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032756"
FT                   /product="mCG1032756"
FT                   /note="gene_id=mCG1032756.1 transcript_id=mCT150460.1
FT                   protein_id=mCP68731.0"
FT                   /db_xref="GOA:Q3UUP3"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR022097"
FT                   /db_xref="MGI:MGI:98362"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UUP3"
FT                   /protein_id="EDL21023.1"
FT                   /translation="MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAE
FT                   WKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDP
FT                   LKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATSA
FT                   LPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYILFP
FT                   GMTKTGIDPYSSAHATAM"
FT   assembly_gap    10569786..10570065
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    10578155..10578174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10597075..10597190
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    10601040..10601319
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    10602871..10602890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10632601..10632620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10634983..10635002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10642574..10643977)
FT                   /pseudo
FT                   /locus_tag="mCG_18097"
FT                   /note="gene_id=mCG18097.2"
FT   mRNA            complement(10642574..10643977)
FT                   /pseudo
FT                   /locus_tag="mCG_18097"
FT                   /note="gene_id=mCG18097.2 transcript_id=mCT19937.2 created
FT                   on 22-JUL-2002"
FT   assembly_gap    10670996..10671015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10692704..10692840
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   gene            10718633..10731101
FT                   /locus_tag="mCG_60240"
FT                   /note="gene_id=mCG60240.2"
FT   mRNA            join(10718633..10719016,10720011..10720087,
FT                   10730980..10731101)
FT                   /locus_tag="mCG_60240"
FT                   /product="mCG60240"
FT                   /note="gene_id=mCG60240.2 transcript_id=mCT60423.2 created
FT                   on 22-JUL-2002"
FT   CDS             join(10718998..10719016,10720011..10720087,
FT                   10730980..10730988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_60240"
FT                   /product="mCG60240"
FT                   /note="gene_id=mCG60240.2 transcript_id=mCT60423.2
FT                   protein_id=mCP41386.2"
FT                   /protein_id="EDL21024.1"
FT                   /translation="MVHWKQGDEDVDNGEERVSHMDAIKDLTEDLKLI"
FT   assembly_gap    10758243..10758376
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    10763237..10763256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10768706..10774370
FT                   /estimated_length=5665
FT                   /gap_type="unknown"
FT   assembly_gap    10790185..10790204
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10791334..10791353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10793575..10793594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10794697..10796927
FT                   /estimated_length=2231
FT                   /gap_type="unknown"
FT   assembly_gap    10798300..10798319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10799414..10799433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10800469..10800488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10801969..10801988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10803492..10803511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10805025..10805985
FT                   /estimated_length=961
FT                   /gap_type="unknown"
FT   assembly_gap    10814267..10814286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10845932..10845951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10864933..10864952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10925167..10925186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10945177..10945317
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    10947622..10947641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10955791..10955810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10961650..10961669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10983513..10983617
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    10986969..10987122
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   gene            complement(11019987..11021875)
FT                   /locus_tag="mCG_147710"
FT                   /note="gene_id=mCG147710.0"
FT   mRNA            complement(join(11019987..11020298,11021638..11021875))
FT                   /locus_tag="mCG_147710"
FT                   /product="mCG147710"
FT                   /note="gene_id=mCG147710.0 transcript_id=mCT187973.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(11020056..11020265)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147710"
FT                   /product="mCG147710"
FT                   /note="gene_id=mCG147710.0 transcript_id=mCT187973.0
FT                   protein_id=mCP108536.0"
FT                   /protein_id="EDL21025.1"
FT                   /translation="MKKTLRSGTWVVSLRNSSRPLREDLKQVRHTGTSPSYGASECRSK
FT                   ARITWQKSHSDGSAEELGRVGAIS"
FT   assembly_gap    11031546..11031565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11038070..11045301
FT                   /estimated_length=7232
FT                   /gap_type="unknown"
FT   assembly_gap    11046567..11046586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11062712..11062731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11067800..11067819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11071902..11072087
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    11074797..11074816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11095207..11095295
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    11098225..11098260
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    11120510..11121433
FT                   /estimated_length=924
FT                   /gap_type="unknown"
FT   assembly_gap    11129532..11129625
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    11135506..11136108
FT                   /estimated_length=603
FT                   /gap_type="unknown"
FT   assembly_gap    11145386..11145482
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    11148582..11148912
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   gene            complement(11160248..11173104)
FT                   /gene="Fndc6"
FT                   /locus_tag="mCG_19504"
FT                   /note="gene_id=mCG19504.2"
FT   mRNA            complement(join(11160248..11161798,11163960..11164102,
FT                   11168787..11168937,11170894..11171018,11173014..11173104))
FT                   /gene="Fndc6"
FT                   /locus_tag="mCG_19504"
FT                   /product="fibronectin type III domain containing 6,
FT                   transcript variant mCT19767"
FT                   /note="gene_id=mCG19504.2 transcript_id=mCT19767.2 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(11160248..11161798,11163960..11164102,
FT                   11164220..11164327))
FT                   /gene="Fndc6"
FT                   /locus_tag="mCG_19504"
FT                   /product="fibronectin type III domain containing 6,
FT                   transcript variant mCT171132"
FT                   /note="gene_id=mCG19504.2 transcript_id=mCT171132.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(11161682..11161798,11163960..11164102,
FT                   11168787..11168937,11170894..11170998))
FT                   /codon_start=1
FT                   /gene="Fndc6"
FT                   /locus_tag="mCG_19504"
FT                   /product="fibronectin type III domain containing 6, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19504.2 transcript_id=mCT19767.2
FT                   protein_id=mCP21389.2 isoform=CRA_b"
FT                   /protein_id="EDL21027.1"
FT                   /translation="MEVTEHGLHLVIELEDLGPQFEFLVVYWRREPGAAEHVKMVRSGD
FT                   IPVHLETMEPGAMYCVKAQALVKAIGRHSAFSQPTCVEMQGESLPLALALFAFVGFMLI
FT                   LVVVLLSVWKMGQLLRYSCCPAVVLPDTLKITSSSQKLISCRKEEVDACAVAVLSSEHL
FT                   FGVWISQT"
FT   CDS             complement(join(11161682..11161798,11163960..11164102,
FT                   11164220..11164262))
FT                   /codon_start=1
FT                   /gene="Fndc6"
FT                   /locus_tag="mCG_19504"
FT                   /product="fibronectin type III domain containing 6, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19504.2 transcript_id=mCT171132.0
FT                   protein_id=mCP94050.0 isoform=CRA_a"
FT                   /protein_id="EDL21026.1"
FT                   /translation="MVVVVAIGGHTKSQGESLPLALALFAFVGFMLILVVVLLSVWKMG
FT                   QLLRYSCCPAVVLPDTLKITSSSQKLISCRKEEVDACAVAVLSSEHLFGVWISQT"
FT   assembly_gap    11165738..11166323
FT                   /estimated_length=586
FT                   /gap_type="unknown"
FT   assembly_gap    11173107..11173205
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   gene            complement(11196349..11248530)
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /note="gene_id=mCG19501.2"
FT   mRNA            complement(join(11196349..11198159,11199750..11200462,
FT                   11210851..11211094,11248387..11248530))
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, transcript variant mCT19764"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT19764.2 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(11196349..11198159,11199750..11200462,
FT                   11210851..11211094,11248419..11248510))
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, transcript variant mCT170561"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT170561.0 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(11196349..11198159,11199750..11200462,
FT                   11210851..11211094,11247939..11248123))
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, transcript variant mCT170562"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT170562.0 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(11196349..11198159,11199750..11200462,
FT                   11209147..11209243))
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, transcript variant mCT170563"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT170563.0 created
FT                   on 11-JUL-2002"
FT   CDS             complement(join(11197965..11198159,11199750..11200462,
FT                   11210851..11211076))
FT                   /codon_start=1
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT170561.0
FT                   protein_id=mCP93481.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99M51"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR017304"
FT                   /db_xref="InterPro:IPR035562"
FT                   /db_xref="InterPro:IPR035564"
FT                   /db_xref="InterPro:IPR035565"
FT                   /db_xref="MGI:MGI:109601"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99M51"
FT                   /protein_id="EDL21028.1"
FT                   /translation="MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSM
FT                   NKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDTASPADDSFVDPGERL
FT                   YDLNMPAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEE
FT                   GDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEK
FT                   PENDPEWWKCRKINGMVGLVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNP
FT                   WYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYC
FT                   IGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS"
FT   CDS             complement(join(11197965..11198159,11199750..11200462,
FT                   11210851..11211076))
FT                   /codon_start=1
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT170562.0
FT                   protein_id=mCP93480.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99M51"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR017304"
FT                   /db_xref="InterPro:IPR035562"
FT                   /db_xref="InterPro:IPR035564"
FT                   /db_xref="InterPro:IPR035565"
FT                   /db_xref="MGI:MGI:109601"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99M51"
FT                   /protein_id="EDL21029.1"
FT                   /translation="MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSM
FT                   NKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDTASPADDSFVDPGERL
FT                   YDLNMPAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEE
FT                   GDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEK
FT                   PENDPEWWKCRKINGMVGLVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNP
FT                   WYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYC
FT                   IGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS"
FT   CDS             complement(join(11197965..11198159,11199750..11200462,
FT                   11210851..11211076))
FT                   /codon_start=1
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT19764.2
FT                   protein_id=mCP21318.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q99M51"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR017304"
FT                   /db_xref="InterPro:IPR035562"
FT                   /db_xref="InterPro:IPR035564"
FT                   /db_xref="InterPro:IPR035565"
FT                   /db_xref="MGI:MGI:109601"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99M51"
FT                   /protein_id="EDL21031.1"
FT                   /translation="MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSM
FT                   NKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDTASPADDSFVDPGERL
FT                   YDLNMPAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEE
FT                   GDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEK
FT                   PENDPEWWKCRKINGMVGLVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNP
FT                   WYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYC
FT                   IGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS"
FT   CDS             complement(join(11197965..11198159,11199750..11200462,
FT                   11209147..11209180))
FT                   /codon_start=1
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT170563.0
FT                   protein_id=mCP93479.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8BH99"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR017304"
FT                   /db_xref="InterPro:IPR035564"
FT                   /db_xref="InterPro:IPR035565"
FT                   /db_xref="MGI:MGI:109601"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BH99"
FT                   /protein_id="EDL21030.1"
FT                   /translation="MDWLNIFKDFFSIGKVKRKPSVPDTASPADDSFVDPGERLYDLNM
FT                   PAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEEGDSPL
FT                   GDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDP
FT                   EWWKCRKINGMVGLVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGK
FT                   VTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRK
FT                   FSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS"
FT   gene            complement(11254613..11273350)
FT                   /locus_tag="mCG_51522"
FT                   /note="gene_id=mCG51522.2"
FT   mRNA            complement(join(11254613..11256031,11273227..11273350))
FT                   /locus_tag="mCG_51522"
FT                   /product="mCG51522"
FT                   /note="gene_id=mCG51522.2 transcript_id=mCT51705.1 created
FT                   on 22-JUL-2002"
FT   CDS             complement(11254775..11256013)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51522"
FT                   /product="mCG51522"
FT                   /note="gene_id=mCG51522.2 transcript_id=mCT51705.1
FT                   protein_id=mCP41363.1"
FT                   /db_xref="GOA:D3YVE8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="MGI:MGI:2685365"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3YVE8"
FT                   /protein_id="EDL21032.1"
FT                   /translation="MDTSPSKKYPIKKRVKIHPNTVMVKYTSHYPQPGDDGYEEINEDY
FT                   GRFMEENPKKSLLSEMRRKGRTLFGTMDTQPSSSEDPRASGMGQFQSFAEKNIFQSRKM
FT                   WLVLFGSALAHGCVALITRLISDRSKVPSLELIFIRSVLQVLSVIVVCYYQEAPFGPSG
FT                   YRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILAFLLVDEKMAYVD
FT                   MATVVCSILGVCLVMIPNIADEDNSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIREK
FT                   ISMWTALFTFGWTGTIWGLSTMFVLQEPIIPLDGATWSYLIAICLCSTAAFLGVYYALD
FT                   KFHPALVSTVQHLEIVVAMVLQLLVLHIFPSVYDVFGGVIIMISVFVLAGYKLYWRNVR
FT                   REDYQEILDSPIK"
FT   assembly_gap    11266108..11266342
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    11296837..11296856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11299810..11299829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11306939..11307362
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    11316527..11316628
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   gene            complement(11327285..11328276)
FT                   /pseudo
FT                   /locus_tag="mCG_19502"
FT                   /note="gene_id=mCG19502.2"
FT   mRNA            complement(11327285..11328276)
FT                   /pseudo
FT                   /locus_tag="mCG_19502"
FT                   /note="gene_id=mCG19502.2 transcript_id=mCT19765.2 created
FT                   on 22-JUL-2002"
FT   gene            11345631..11656780
FT                   /gene="Stag1"
FT                   /locus_tag="mCG_116377"
FT                   /note="gene_id=mCG116377.1"
FT   mRNA            join(11345631..11345852,11407226..11407327,
FT                   11414494..11414596,11440015..11440179,11459759..11459855,
FT                   11478656..11478732,11488389..11488593,11498569..11498720,
FT                   11505147..11505220,11536775..11536898,11547135..11547233,
FT                   11550779..11550858,11557917..11558024,11570031..11570145,
FT                   11584711..11584828,11591323..11591426,11591771..11591863,
FT                   11591968..11592057,11592192..11592395,11593508..11593578,
FT                   11594996..11595083,11612580..11612660,11640861..11640962,
FT                   11643001..11643149,11644088..11644216,11645314..11645519,
FT                   11649824..11649998,11651703..11651813,11652438..11652552,
FT                   11654611..11654691,11654777..11656780)
FT                   /gene="Stag1"
FT                   /locus_tag="mCG_116377"
FT                   /product="stromal antigen 1, transcript variant mCT117497"
FT                   /note="gene_id=mCG116377.1 transcript_id=mCT117497.1
FT                   created on 11-JUL-2002"
FT   mRNA            join(11345631..11345852,11365315..11365363,
FT                   11407226..11407327,11414494..11415166)
FT                   /gene="Stag1"
FT                   /locus_tag="mCG_116377"
FT                   /product="stromal antigen 1, transcript variant mCT170548"
FT                   /note="gene_id=mCG116377.1 transcript_id=mCT170548.0
FT                   created on 11-JUL-2002"
FT   assembly_gap    11345950..11346221
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    11364076..11364178
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    11376409..11376428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11378590..11378716
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   CDS             join(11407299..11407327,11414494..11414596,
FT                   11440015..11440179,11459759..11459855,11478656..11478732,
FT                   11488389..11488593,11498569..11498720,11505147..11505220,
FT                   11536775..11536898,11547135..11547233,11550779..11550858,
FT                   11557917..11558024,11570031..11570145,11584711..11584828,
FT                   11591323..11591426,11591771..11591863,11591968..11592057,
FT                   11592192..11592395,11593508..11593578,11594996..11595083,
FT                   11612580..11612660,11640861..11640962,11643001..11643149,
FT                   11644088..11644216,11645314..11645519,11649824..11649998,
FT                   11651703..11651813,11652438..11652552,11654611..11654691,
FT                   11654777..11654800)
FT                   /codon_start=1
FT                   /gene="Stag1"
FT                   /locus_tag="mCG_116377"
FT                   /product="stromal antigen 1, isoform CRA_a"
FT                   /note="gene_id=mCG116377.1 transcript_id=mCT117497.1
FT                   protein_id=mCP68808.1 isoform=CRA_a"
FT                   /protein_id="EDL21033.1"
FT                   /translation="MITSELPVLQDSTNETTAHSDAGSELEETEVKGKRKRGRPGRPPS
FT                   TNKKPRKSPGEKSRIEAGIRGAGRGRANGHPQQNGDGDPVTLFEVVKLGKSAMQSVVDD
FT                   WIELYKQDRDIALLDLINFFIQCSGCRGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYP
FT                   LTMPGPQWKKFRSNFCEFIGVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTS
FT                   TLAAMKLMTALVNVALNLSIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQ
FT                   DEIENMMNSIFKGIFVHRYRDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLH
FT                   DRQGEVRLKCLKALQSLYTNRELFPKLELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTL
FT                   ILHGSEEALSNEDCENVYHLVYSAHRPVAVAAGEFLHKKLFSRHDPQAEEALAKRRGRN
FT                   SPNGNLIRMLVLFFLESELHEHAAYLVDSLWESSQELLKDWECMTELLLEEPVQGEEAM
FT                   SDRQESALIELMVCTIRQAAEAHPPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLP
FT                   MLLSKYSADAEKVANLLQIPQYFDLEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEA
FT                   CSKTYSILCSEEYTIQNRVDIARSQLIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLST
FT                   LKRLTSFHNAHDLTKWDLFGNCYRLLKTGIEHGAMPEQIVVQALQCSHYSILWQLVKIT
FT                   DGSPSKYYNDYGDIIKETLSKTRQIDKIQCAKTLILSLQQLFNELVQEQGPNLDRTSAH
FT                   VSGIKELARRFALTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYPPPNLAFLEVL
FT                   SEFSSKLLRQDKKTVHSYLEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNSG
FT                   SSSSKTSSVRSKKGRPPLHRKRVEDESLDNTWLNRTDTMIQTPGPLPTPQLTSTVLREN
FT                   SRPMGEQIQEPESEHGSEPDFLHNPQMQISWLGQPKLEDLNRKDRTGMNYMKVRAGVRH
FT                   AVRGLMEEDAEPIFEDVMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDS
FT                   AAIIEDDSGFGMPMF"
FT   CDS             join(11407299..11407327,11414494..11414644)
FT                   /codon_start=1
FT                   /gene="Stag1"
FT                   /locus_tag="mCG_116377"
FT                   /product="stromal antigen 1, isoform CRA_b"
FT                   /note="gene_id=mCG116377.1 transcript_id=mCT170548.0
FT                   protein_id=mCP93467.0 isoform=CRA_b"
FT                   /protein_id="EDL21034.1"
FT                   /translation="MITSELPVLQDSTNETTAHSDAGSELEETEVKGKRKRGRPGRPPV
FT                   CIIFYLYASMLSHK"
FT   assembly_gap    11440629..11440648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11492291..11492310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11522113..11522132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11543061..11543080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11567762..11568020
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   gene            11579603..11581697
FT                   /pseudo
FT                   /locus_tag="mCG_140657"
FT                   /note="gene_id=mCG140657.0"
FT   mRNA            11579603..11581697
FT                   /pseudo
FT                   /locus_tag="mCG_140657"
FT                   /note="gene_id=mCG140657.0 transcript_id=mCT170549.0
FT                   created on 11-JUL-2002"
FT   assembly_gap    11599369..11599388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11627630..11634219
FT                   /estimated_length=6590
FT                   /gap_type="unknown"
FT   assembly_gap    11640064..11640083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11671286..11673889
FT                   /estimated_length=2604
FT                   /gap_type="unknown"
FT   gene            complement(11684551..11738974)
FT                   /gene="Pccb"
FT                   /locus_tag="mCG_19499"
FT                   /note="gene_id=mCG19499.2"
FT   mRNA            complement(join(11684551..11685319,11686881..11686980,
FT                   11687671..11687769,11688084..11688184,11688332..11688439,
FT                   11692082..11692205,11698909..11698990,11699915..11700035,
FT                   11703514..11703622,11717028..11717138,11727651..11727764,
FT                   11731597..11731653,11734785..11734853,11736459..11736578,
FT                   11738747..11738974))
FT                   /gene="Pccb"
FT                   /locus_tag="mCG_19499"
FT                   /product="propionyl Coenzyme A carboxylase, beta
FT                   polypeptide, transcript variant mCT19762"
FT                   /note="gene_id=mCG19499.2 transcript_id=mCT19762.2 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(11684551..11685319,11686881..11686980,
FT                   11687671..11687769,11688084..11688184,11688332..11688439,
FT                   11692082..11692205,11698909..11698990,11699915..11700035,
FT                   11703514..11703622,11717028..11717138,11727651..11727764,
FT                   11731597..11731653,11734785..11734853,11736459..11736518,
FT                   11738779..11738959))
FT                   /gene="Pccb"
FT                   /locus_tag="mCG_19499"
FT                   /product="propionyl Coenzyme A carboxylase, beta
FT                   polypeptide, transcript variant mCT170560"
FT                   /note="gene_id=mCG19499.2 transcript_id=mCT170560.0 created
FT                   on 11-JUL-2002"
FT   CDS             complement(join(11685198..11685319,11686881..11686980,
FT                   11687671..11687769,11688084..11688184,11688332..11688439,
FT                   11692082..11692205,11698909..11698990,11699915..11700035,
FT                   11703514..11703622,11717028..11717138,11727651..11727764,
FT                   11731597..11731653,11734785..11734853,11736459..11736578,
FT                   11738747..11738935))
FT                   /codon_start=1
FT                   /gene="Pccb"
FT                   /locus_tag="mCG_19499"
FT                   /product="propionyl Coenzyme A carboxylase, beta
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG19499.2 transcript_id=mCT19762.2
FT                   protein_id=mCP21272.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q7TMF4"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="MGI:MGI:1914154"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TMF4"
FT                   /protein_id="EDL21035.1"
FT                   /translation="MAAAIRIRAVAAGARLSVLNCGLGITTRGLCSQPVSVKERIDNKR
FT                   HAALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKF
FT                   PGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDS
FT                   GGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDT
FT                   SYLFITGPEVVKSVTNEDVTQEQLGGAKTHTTVSGVAHRAFDNDVDALCNLREFFNFLP
FT                   LSSQDPAPIRECHDPSDRLVPELDTVVPLESSKAYNMLDIIHAVIDEREFFEIMPSYAK
FT                   NIVVGFARMNGRTVGIVGNQPNVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGF
FT                   LPGTAQEYGGIIRHGAKLLYAFAEATVPKITVITRKAYGGAYDVMSSKHLLGDTNYAWP
FT                   TAEIAVMGAKGAVEIIFKGHQDVEAAQAEYVEKFANPFPAAVRGFVDDIIQPSSTRARI
FT                   CCDLEVLASKKVHRPWRKHANIPL"
FT   CDS             complement(join(11685198..11685319,11686881..11686980,
FT                   11687671..11687769,11688084..11688184,11688332..11688439,
FT                   11692082..11692205,11698909..11698990,11699915..11700035,
FT                   11703514..11703622,11717028..11717138,11727651..11727764,
FT                   11731597..11731653,11734785..11734853,11736459..11736518,
FT                   11738779..11738799))
FT                   /codon_start=1
FT                   /gene="Pccb"
FT                   /locus_tag="mCG_19499"
FT                   /product="propionyl Coenzyme A carboxylase, beta
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG19499.2 transcript_id=mCT170560.0
FT                   protein_id=mCP93478.0 isoform=CRA_b"
FT                   /protein_id="EDL21036.1"
FT                   /translation="MQRCWEESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLV
FT                   YVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYAD
FT                   IFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPEVVKSVTNE
FT                   DVTQEQLGGAKTHTTVSGVAHRAFDNDVDALCNLREFFNFLPLSSQDPAPIRECHDPSD
FT                   RLVPELDTVVPLESSKAYNMLDIIHAVIDEREFFEIMPSYAKNIVVGFARMNGRTVGIV
FT                   GNQPNVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAK
FT                   LLYAFAEATVPKITVITRKAYGGAYDVMSSKHLLGDTNYAWPTAEIAVMGAKGAVEIIF
FT                   KGHQDVEAAQAEYVEKFANPFPAAVRGFVDDIIQPSSTRARICCDLEVLASKKVHRPWR
FT                   KHANIPL"
FT   assembly_gap    11694209..11694421
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    11697623..11697642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11705590..11705609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11719721..11719740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11734282..11734301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11741328..11741347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11757723..11758052
FT                   /pseudo
FT                   /locus_tag="mCG_53673"
FT                   /note="gene_id=mCG53673.2"
FT   mRNA            11757723..11758052
FT                   /pseudo
FT                   /locus_tag="mCG_53673"
FT                   /note="gene_id=mCG53673.2 transcript_id=mCT53856.2 created
FT                   on 22-JUL-2002"
FT   assembly_gap    11777468..11778386
FT                   /estimated_length=919
FT                   /gap_type="unknown"
FT   gene            11778397..11802279
FT                   /locus_tag="mCG_15723"
FT                   /note="gene_id=mCG15723.2"
FT   mRNA            join(11778397..11779055,11800044..11802279)
FT                   /locus_tag="mCG_15723"
FT                   /product="mCG15723"
FT                   /note="gene_id=mCG15723.2 transcript_id=mCT19755.2 created
FT                   on 22-JUL-2002"
FT   CDS             join(11778914..11779055,11800044..11801635)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15723"
FT                   /product="mCG15723"
FT                   /note="gene_id=mCG15723.2 transcript_id=mCT19755.2
FT                   protein_id=mCP21401.1"
FT                   /protein_id="EDL21037.1"
FT                   /translation="MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCC
FT                   VCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYK
FT                   KLCEYITQTTLARDIIEAVDCSSDILALLNDGSLFCEETEKPSDSSFTLCLTHSPLPST
FT                   SEPTADPQASLSPMSESTLSIAIGSSVINGLPTYNGLSIDRFGINIPSPEHPNTIDVCN
FT                   TVDIKTEDLSDNLPPVCDTVATDLCSTGIDICSFSEDIKPGDSLLLSVEEVLRSLETVS
FT                   NTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKVAKLNR
FT                   KRSRSESDSEKVQPLPISTIIRGPTLGASAPVTVKRESKISLQPIATVPNGGTTPKISK
FT                   TVLLSTKSMKKSHEHGSKKSHSKSKPGILKKDKAVKEKMPSHHFMPGSPTKTVYKKPQE
FT                   KKGCKCGRATQNPSVLTCRGQRCPCYSNRKACLDCICRGCQNSYMANGEKKLEAFAVPE
FT                   KALEQTRLTLGINVTSIAVRNASTSTSVINVTGSPVTTFLAASTHDDKSLDEAIDMRFD
FT                   C"
FT   assembly_gap    11788904..11789681
FT                   /estimated_length=778
FT                   /gap_type="unknown"
FT   assembly_gap    11790788..11791107
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    11794049..11794301
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    11796637..11797080
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   gene            complement(11801940..11950461)
FT                   /locus_tag="mCG_15724"
FT                   /note="gene_id=mCG15724.2"
FT   mRNA            complement(join(11801940..11807442,11824507..11824613,
FT                   11825794..11825912,11826382..11826557,11842973..11843062,
FT                   11844137..11844185,11847244..11847400,11852446..11852532,
FT                   11873981..11874055,11878988..11879090,11884587..11884690,
FT                   11892815..11893081,11909780..11912211,11950326..11950461))
FT                   /locus_tag="mCG_15724"
FT                   /product="mCG15724, transcript variant mCT19756"
FT                   /note="gene_id=mCG15724.2 transcript_id=mCT19756.2 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(11801940..11807442,11824507..11824613,
FT                   11825794..11825912,11826382..11826557,11842973..11843062,
FT                   11844137..11844185,11847244..11847400,11852446..11852532,
FT                   11873981..11874055,11878988..11879090,11884587..11884690,
FT                   11892815..11893081,11897287..11897592))
FT                   /locus_tag="mCG_15724"
FT                   /product="mCG15724, transcript variant mCT171130"
FT                   /note="gene_id=mCG15724.2 transcript_id=mCT171130.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(11807316..11807442,11824507..11824613,
FT                   11825794..11825912,11826382..11826557,11842973..11843062,
FT                   11844137..11844185,11847244..11847400,11852446..11852532,
FT                   11873981..11874055,11878988..11879090,11884587..11884690,
FT                   11892815..11893081,11909780..11911771))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15724"
FT                   /product="mCG15724, isoform CRA_b"
FT                   /note="gene_id=mCG15724.2 transcript_id=mCT19756.2
FT                   protein_id=mCP21218.1 isoform=CRA_b"
FT                   /db_xref="GOA:B2RXC8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:2442104"
FT                   /db_xref="UniProtKB/TrEMBL:B2RXC8"
FT                   /protein_id="EDL21039.1"
FT                   /translation="MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGIDCI
FT                   VVHHSVCADLVHIPVSQFKDVDLNSVFLSHENGLSSAEDYPHQALTGLPRGKKASTFQN
FT                   TCNLKDIAGEAISFASGKIKEFSLEKLRNSNHAAYRKGRKVKSDSFNRRSVDFDLLCGH
FT                   YNNDGTSPPFGLLRSSSVEEKSLSHRNSLDTNLTSMLFQNLSEEDLVTQILEKHKIDHF
FT                   SSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGGSISEGSGNEVISNSETVYMNVM
FT                   TRLAYYLRKLPFEFMQSGNNETVDLTELINNIPNLQLTPFSPLYGTEQPPKYEDIVHLS
FT                   ALDSGQFQTVELQDDKHNFKQTDIVKTTPNNTDSLCSLEVNDPGTLKPVQLQSPLLTIN
FT                   HLENVSSGNLMETLYIEEESDGKKSLLDKEQKAENGQGQEPLQVNEHKEFSDHDTYLKK
FT                   CPVSMQNEIGKIFEKPIMVHPSKEDSKLEVPTTDLRDQRHFVNPNSQEEIDKLLMDLES
FT                   FSQKMETSLGEPLAKGKSINSLNSHSHLTAQSHKDLEPKPIASSAMEKVSPSCLTRIIE
FT                   NNGHKMEEEDRALLLRIMESIEDFAQELVECKSGRGSLSQEKEMMQILQETLTTSSQPT
FT                   PSVCRSPVGEKPKDSTSVVLIQQTPEVIKIQNKPEKKPATSFPPAATLPSSPQPASPVP
FT                   CVSDVVNTPLSINIPQFYFPEGLPDTCSNHEQILSRIETAFKDIEDQKADIHEMGRIAK
FT                   VCGCPLYWKAPMFRAAGGEKTGFVTAQSFIAMWKKLLSNRHDDAAKFIWLLAKPSCSYL
FT                   EQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVVQRIFYTVNRSWSGKITSTEIRK
FT                   SNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDGDHDLYISQADLSRYNDQAS
FT                   SNRIIERIFSGAVTRGKTVQKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDG
FT                   ILSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPASDGRITLRDLKRCRMAH
FT                   IFYDTFFNLEKYLDHEQRDPFAVQKDVENDGPEPSDWDRFAAEEYEALVTEESAQVQLQ
FT                   EGSFEDYESDEPVSPSELGNKGNKIVTSSLSEKCGKLQSVDEE"
FT   CDS             complement(join(11807316..11807442,11824507..11824613,
FT                   11825794..11825912,11826382..11826557,11842973..11843062,
FT                   11844137..11844185,11847244..11847400,11852446..11852532,
FT                   11873981..11874055,11878988..11879090,11884587..11884690,
FT                   11892815..11893081,11897287..11897418))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15724"
FT                   /product="mCG15724, isoform CRA_a"
FT                   /note="gene_id=mCG15724.2 transcript_id=mCT171130.0
FT                   protein_id=mCP94048.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9E8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:2442104"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9E8"
FT                   /protein_id="EDL21038.1"
FT                   /translation="MMIKETSLRRDPDLRGELAFLARGCDFVLPSRFKKRLKSFQQTQI
FT                   QNKPEKKPATSFPPAATLPSSPQPASPVPCVSDVVNTPLSINIPQFYFPEGLPDTCSNH
FT                   EQILSRIETAFKDIEDQKADIHEMGRIAKVCGCPLYWKAPMFRAAGGEKTGFVTAQSFI
FT                   AMWKKLLSNRHDDAAKFIWLLAKPSCSYLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHS
FT                   RYITTVVQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYV
FT                   IYCKFWELDGDHDLYISQADLSRYNDQASSNRIIERIFSGAVTRGKTVQKEGRMSYADF
FT                   VWFLISEEDKRNPTSIEYWFRCMDVDGDGILSMYELEYFYEEQCERMEAMGIEPLPFHD
FT                   LLCQMLDLVKPASDGRITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVEND
FT                   GPEPSDWDRFAAEEYEALVTEESAQVQLQEGSFEDYESDEPVSPSELGNKGNKIVTSSL
FT                   SEKCGKLQSVDEE"
FT   assembly_gap    11822645..11822844
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    11827863..11827882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11828988..11831334
FT                   /estimated_length=2347
FT                   /gap_type="unknown"
FT   assembly_gap    11834082..11834180
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    11939292..11939392
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   gene            complement(11980029..11980437)
FT                   /pseudo
FT                   /locus_tag="mCG_1032773"
FT                   /note="gene_id=mCG1032773.1"
FT   mRNA            complement(11980029..11980437)
FT                   /pseudo
FT                   /locus_tag="mCG_1032773"
FT                   /note="gene_id=mCG1032773.1 transcript_id=mCT150477.1
FT                   created on 22-JUL-2002"
FT   assembly_gap    11993133..11995203
FT                   /estimated_length=2071
FT                   /gap_type="unknown"
FT   assembly_gap    12001592..12001810
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    12015710..12015775
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   gene            complement(12016082..12046624)
FT                   /locus_tag="mCG_140729"
FT                   /note="gene_id=mCG140729.0"
FT   mRNA            complement(join(12016082..12016107,12046064..12046624))
FT                   /locus_tag="mCG_140729"
FT                   /product="mCG140729"
FT                   /note="gene_id=mCG140729.0 transcript_id=mCT171108.0
FT                   created on 22-JUL-2002"
FT   assembly_gap    12018767..12019137
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    12026914..12026933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12040819..>12045767
FT                   /locus_tag="mCG_1032889"
FT                   /note="gene_id=mCG1032889.1"
FT   mRNA            join(12040819..12041143,12041663..12041800,
FT                   12045559..>12045767)
FT                   /locus_tag="mCG_1032889"
FT                   /product="mCG1032889"
FT                   /note="gene_id=mCG1032889.1 transcript_id=mCT150593.1
FT                   created on 22-JUL-2002"
FT   CDS             join(12041773..12041800,12045559..12045767)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032889"
FT                   /product="mCG1032889"
FT                   /note="gene_id=mCG1032889.1 transcript_id=mCT150593.1
FT                   protein_id=mCP68686.1"
FT                   /protein_id="EDL21041.1"
FT                   /translation="MCSTELTAKDKYSSHPSPEKPPVCRRWRRLQKSTRAEFFSVPNSN
FT                   QYIYNQPLDPRLRGHHGRRARKTVKARGLGHLL"
FT   CDS             complement(12046144..12046449)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140729"
FT                   /product="mCG140729"
FT                   /note="gene_id=mCG140729.0 transcript_id=mCT171108.0
FT                   protein_id=mCP94026.0"
FT                   /protein_id="EDL21040.1"
FT                   /translation="MTKETWGGKGLFGLHFHITVHHQRKSEQELKQGRDLETGADAEAM
FT                   EQCRFLTCSCGLIACFLIESRSTRPEMPPLTIDWALPPSITCKETALLLDPMEASS"
FT   assembly_gap    12058473..12059345
FT                   /estimated_length=873
FT                   /gap_type="unknown"
FT   assembly_gap    12061986..12062005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12099755..12099856
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    12103950..12103969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12127432..12127451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12130550..12130920
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   gene            complement(12139457..>12143143)
FT                   /locus_tag="mCG_15722"
FT                   /note="gene_id=mCG15722.1"
FT   mRNA            complement(join(12139457..12140121,12142763..>12143143))
FT                   /locus_tag="mCG_15722"
FT                   /product="mCG15722"
FT                   /note="gene_id=mCG15722.1 transcript_id=mCT19754.2 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(12139657..12140121,12142763..12143143))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15722"
FT                   /product="mCG15722"
FT                   /note="gene_id=mCG15722.1 transcript_id=mCT19754.2
FT                   protein_id=mCP21400.2"
FT                   /protein_id="EDL21042.1"
FT                   /translation="MAVPETRPNHTIYINSLNEKIKKDELKKSPYAIFSQFGQILDILV
FT                   SQSLKMRGQSFVIFKEVSSTINALRSMQGFPFYGKPMHIQYAKTDSDIIAKMKGTFVER
FT                   DHKREKRKPKSQEKPAAKKRLFRWGSAPVVGAVQPVPGMPPMPQAPRVMHHMPGQPPYM
FT                   RPPGMILPPGLPPGQIPSRAMPPQQLIPGQMPHAQPLSENPPNHILFLTNLPEETNELM
FT                   LSMLFTQFPGFKEVRLVPGRHDIDFVEFDNEVQAGAARDVLQGFKITQNNAMKISFAKK
FT                   "
FT   assembly_gap    12140208..12140227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12141472..12142708
FT                   /estimated_length=1237
FT                   /gap_type="unknown"
FT   assembly_gap    12161126..12161145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12162605..12162624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12183566..12183585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12185068..12185585
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   assembly_gap    12188856..12188875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12200206..12200572
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    12273194..12274290
FT                   /estimated_length=1097
FT                   /gap_type="unknown"
FT   assembly_gap    12288588..12288915
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    12293289..12293308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12294359..12294378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12295526..12295545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12296619..12296740
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    12302307..12302326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12313138..12313481
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    12335831..12335953
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    12344869..12344888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12364476..12364656
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    12428107..12428126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12452564..12452583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12464451..>12556409)
FT                   /locus_tag="mCG_1032892"
FT                   /note="gene_id=mCG1032892.1"
FT   mRNA            complement(join(12464451..12464639,12464792..12464897,
FT                   12516158..12516321,12556251..>12556409))
FT                   /locus_tag="mCG_1032892"
FT                   /product="mCG1032892, transcript variant mCT150596"
FT                   /note="gene_id=mCG1032892.1 transcript_id=mCT150596.1
FT                   created on 22-JUL-2002"
FT   assembly_gap    12488031..12488062
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   CDS             complement(join(12516295..12516321,12556251..>12556409))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032892"
FT                   /product="mCG1032892, isoform CRA_a"
FT                   /note="gene_id=mCG1032892.1 transcript_id=mCT150596.1
FT                   protein_id=mCP68698.1 isoform=CRA_a"
FT                   /protein_id="EDL21043.1"
FT                   /translation="KSRRQCLHPILILHHFQGRDKDKHTPRSHAGRKAAWNLSPLRTVL
FT                   EEDKPAVEDFLFMEEL"
FT   mRNA            complement(join(12555934..12556161,12556251..>12556409))
FT                   /locus_tag="mCG_1032892"
FT                   /product="mCG1032892, transcript variant mCT171109"
FT                   /note="gene_id=mCG1032892.1 transcript_id=mCT171109.0
FT                   created on 22-JUL-2002"
FT   CDS             complement(join(12556018..12556161,12556251..>12556409))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032892"
FT                   /product="mCG1032892, isoform CRA_b"
FT                   /note="gene_id=mCG1032892.1 transcript_id=mCT171109.0
FT                   protein_id=mCP94027.0 isoform=CRA_b"
FT                   /protein_id="EDL21044.1"
FT                   /translation="KSRRQCLHPILILHHFQGRDKDKHTPRSHAGRKAAWNLSPLRTVL
FT                   EEDKPAVEGTSKEITCLCPPLWLAMSPVSDLLCPVFNGNTRRSWAVCSLPVKTGT"
FT   gene            12606668..12613169
FT                   /locus_tag="mCG_140741"
FT                   /note="gene_id=mCG140741.0"
FT   mRNA            join(12606668..12607177,12613107..12613169)
FT                   /locus_tag="mCG_140741"
FT                   /product="mCG140741"
FT                   /note="gene_id=mCG140741.0 transcript_id=mCT171140.0
FT                   created on 23-JUL-2002"
FT   CDS             12606774..12606869
FT                   /codon_start=1
FT                   /locus_tag="mCG_140741"
FT                   /product="mCG140741"
FT                   /note="gene_id=mCG140741.0 transcript_id=mCT171140.0
FT                   protein_id=mCP94058.0"
FT                   /protein_id="EDL21045.1"
FT                   /translation="MLLICGLYVAPHFTLTDKSISIPGHITAQCA"
FT   assembly_gap    12607279..12610111
FT                   /estimated_length=2833
FT                   /gap_type="unknown"
FT   gene            complement(12622048..>13066463)
FT                   /gene="Ephb1"
FT                   /locus_tag="mCG_140739"
FT                   /note="gene_id=mCG140739.1"
FT   mRNA            complement(join(12622048..12623513,12627480..12627635,
FT                   12629246..12629439,12635980..12636129,12669823..12670038,
FT                   12676977..12677224,12689961..12690083,12701779..12701843,
FT                   12702650..12702758,12707597..12707759,12715879..12716003,
FT                   12747597..12747932,12773416..12773571,12906758..12907439,
FT                   12935361..12935425,13066053..13066323))
FT                   /gene="Ephb1"
FT                   /locus_tag="mCG_140739"
FT                   /product="Eph receptor B1, transcript variant mCT171135"
FT                   /note="gene_id=mCG140739.1 transcript_id=mCT171135.0
FT                   created on 06-SEP-2002"
FT   mRNA            complement(join(12622489..12623513,12627480..12627635,
FT                   12629246..12629439,12635980..12636129,12669823..12670038,
FT                   12676977..12677224,12701779..12701843,12702650..12702758,
FT                   12707597..12707759,12715879..12716003,12747597..12747932,
FT                   12773416..12773571,12906758..12907439,12935361..12935425,
FT                   13066053..>13066463))
FT                   /gene="Ephb1"
FT                   /locus_tag="mCG_140739"
FT                   /product="Eph receptor B1, transcript variant mCT191533"
FT                   /note="gene_id=mCG140739.1 transcript_id=mCT191533.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(12623405..12623513,12627480..12627635,
FT                   12629246..12629439,12635980..12636129,12669823..12670038,
FT                   12676977..12677224,12701779..12701843,12702650..12702758,
FT                   12707597..12707759,12715879..12716003,12747597..12747932,
FT                   12773416..12773571,12906758..12907439,12935361..12935425,
FT                   13066053..>13066320))
FT                   /codon_start=1
FT                   /gene="Ephb1"
FT                   /locus_tag="mCG_140739"
FT                   /product="Eph receptor B1, isoform CRA_b"
FT                   /note="gene_id=mCG140739.1 transcript_id=mCT191533.0
FT                   protein_id=mCP112470.0 isoform=CRA_b"
FT                   /protein_id="EDL21047.1"
FT                   /translation="THTHTCTPTSTRARTAPRAHTPAHAHAALRGVRSRPERERTRRSH
FT                   PPGAQRRPGTRRVSAGARPGGRWPAMALDCLLLFLLASAVAAMEETLMDTRTATAELGW
FT                   TANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTV
FT                   RDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFG
FT                   GRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMT
FT                   GAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKAC
FT                   PAGTFKASQEAEGCSHCPSNSRSPSEASPICTCRTGYYRADFDPPEVACTSVPSGPRNV
FT                   ISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTE
FT                   CRVSISSLWAHTPYTFDIQAINGVSSKSPFPPQHVSVNITTNQAAPSTVPIMHQVSATM
FT                   RSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNSSMARSQTNTARIDGLRPGMVYVVQV
FT                   RARTVAGYGKFSGKMCFQTLTDDDYKSELREQLPLIAGSAAAGVVFVVSLVAISIVCSR
FT                   KRAYSKEAAYSDKLQHYSTGRGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDF
FT                   LSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGM
FT                   LRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLG
FT                   GKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYR
FT                   LPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQP
FT                   LLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGVTLAG
FT                   HQKKILSSIHSMRVQMNQSPSVMA"
FT   CDS             complement(join(12623405..12623513,12627480..12627635,
FT                   12629246..12629439,12635980..12636129,12669823..12670038,
FT                   12676977..12677224,12689961..12690083,12701779..12701843,
FT                   12702650..12702758,12707597..12707759,12715879..12716003,
FT                   12747597..12747932,12773416..12773571,12906758..12907439,
FT                   12935361..12935425,13066053..13066110))
FT                   /codon_start=1
FT                   /gene="Ephb1"
FT                   /locus_tag="mCG_140739"
FT                   /product="Eph receptor B1, isoform CRA_a"
FT                   /note="gene_id=mCG140739.1 transcript_id=mCT171135.0
FT                   protein_id=mCP94053.0 isoform=CRA_a"
FT                   /protein_id="EDL21046.1"
FT                   /translation="MALDCLLLFLLASAVAAMEETLMDTRTATAELGWTANPASGWEEV
FT                   SGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPG
FT                   SCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVR
FT                   SFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIAR
FT                   GTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEA
FT                   EGCSHCPSNSRSPSEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIIL
FT                   EWHPPRETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAH
FT                   TPYTFDIQAINGVSSKSPFPPQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPE
FT                   QPNGIILDYEIRYYEKEHNEFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKF
FT                   SGKMCFQTLTDDDYKSELREQLPLIAGSAAAGVVFVVSLVAISIVCSRKRAYSKEAAYS
FT                   DKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYK
FT                   GRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVM
FT                   IITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVN
FT                   SNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGI
FT                   VMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRF
FT                   AEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRD
FT                   SFLTAGFTSLQLVTQMTSEDLLRIGVTLAGHQKKILSSIHSMRVQMNQSPSVMA"
FT   gene            12638391..12643147
FT                   /gene="9630041A04Rik"
FT                   /locus_tag="mCG_147718"
FT                   /note="gene_id=mCG147718.0"
FT   mRNA            join(12638391..12638734,12639518..12639611,
FT                   12642611..12643147)
FT                   /gene="9630041A04Rik"
FT                   /locus_tag="mCG_147718"
FT                   /product="RIKEN cDNA 9630041A04"
FT                   /note="gene_id=mCG147718.0 transcript_id=mCT187981.0
FT                   created on 13-JAN-2004"
FT   CDS             join(12638529..12638734,12639518..12639611,
FT                   12642611..12642928)
FT                   /codon_start=1
FT                   /gene="9630041A04Rik"
FT                   /locus_tag="mCG_147718"
FT                   /product="RIKEN cDNA 9630041A04"
FT                   /note="gene_id=mCG147718.0 transcript_id=mCT187981.0
FT                   protein_id=mCP108544.0"
FT                   /protein_id="EDL21048.1"
FT                   /translation="MLASQPRGPGFDSQKQYKEGQICWPALVIPMLDKGICLGLMVSQP
FT                   KLLGGLVANNRPHLKTVWTTPELRKSIRLEDADQPHEGTEQEVDDIAAGKAFTSQIRPE
FT                   SVKLLLAPSLPALNSQWKRLLLAAELQLSLCNKEVLPRMPGNCRKNGLSTFGKSSSGPA
FT                   AAFLLEAKLLLETLQFISLLRTMMQEMEKEKDSEHLVGCWDW"
FT   assembly_gap    12651771..12651790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12662267..12666107
FT                   /estimated_length=3841
FT                   /gap_type="unknown"
FT   assembly_gap    12687754..12688223
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    12723169..12723285
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    12739444..12739513
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    12790409..12790428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12799743..12800023
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    12807750..12807822
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    12818226..12818473
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    12830748..12831048
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    12832316..12832390
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    12839144..12839171
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    12849568..12849587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12875071..12875090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12890206..12890225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12930046..12930065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12951456..12951528
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    12992390..12994625
FT                   /estimated_length=2236
FT                   /gap_type="unknown"
FT   assembly_gap    13007398..13007417
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13010254..13010273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13016986..13017092
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    13022644..13022855
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    13063258..13063320
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    13067365..13067624
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    13069785..13069804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13071063..13071082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13112628..13112647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13182230..13182249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <13210348..13250547
FT                   /gene="Ky"
FT                   /locus_tag="mCG_116015"
FT                   /note="gene_id=mCG116015.2"
FT   mRNA            join(<13210348..13210879,13213712..13213774,
FT                   13217577..13217639,13225893..13225967,13227922..13227984,
FT                   13230002..13230084,13231300..13231408,13232504..13232621,
FT                   13242205..13242393,13243602..13243792,13246490..13247662)
FT                   /gene="Ky"
FT                   /locus_tag="mCG_116015"
FT                   /product="kyphoscoliosis peptidase, transcript variant
FT                   mCT191546"
FT                   /note="gene_id=mCG116015.2 transcript_id=mCT191546.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(13210351..13210879,13213712..13213774,
FT                   13217577..13217639,13225893..13225967,13227922..13227984,
FT                   13230002..13230084,13231300..13231408,13232504..13232621,
FT                   13242205..13242334,13243585..13243792,13246490..13250547)
FT                   /gene="Ky"
FT                   /locus_tag="mCG_116015"
FT                   /product="kyphoscoliosis peptidase, transcript variant
FT                   mCT117131"
FT                   /note="gene_id=mCG116015.2 transcript_id=mCT117131.1
FT                   created on 11-JUL-2002"
FT   CDS             join(<13210576..13210879,13213712..13213774,
FT                   13217577..13217639,13225893..13225967,13227922..13227984,
FT                   13230002..13230084,13231300..13231408,13232504..13232621,
FT                   13242205..13242393,13243602..13243792,13246490..13247385)
FT                   /codon_start=1
FT                   /gene="Ky"
FT                   /locus_tag="mCG_116015"
FT                   /product="kyphoscoliosis peptidase, isoform CRA_a"
FT                   /note="gene_id=mCG116015.2 transcript_id=mCT191546.0
FT                   protein_id=mCP112463.0 isoform=CRA_a"
FT                   /protein_id="EDL21049.1"
FT                   /translation="IWQSQRNCARRTWRRGSALSRALALSRARQQRARGHLQPRQPREQ
FT                   PLRAGREGGGTMELKKDSNAVAIDMLLIVHSEKRRAAQATHLDPQANPGALLQNRGGFQ
FT                   GVRNGIRKWQELEENSFQGNLPEKQCLQQPQVITSYDNQGTQLTVEIHPQDAMPQLLKK
FT                   FSLAKRLQGDKNGNMRPRQPGGKDAHAYPWDRSSLKSMPLDLRLFEKLDASASQVTVKS
FT                   GLNELVSDLLQEAHSDLERVRAIWIWICHHIEYDVEAAQEKDRQAFKPTDILRTQKTNC
FT                   DGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFSGEFDHAWNAVYLEGRWHLVDST
FT                   WGSGLVDTTTSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHK
FT                   SEFYNKGMLSAHPETSMIRTVNGKATITIESRAPTLFMFMLNGKQEHGLLSLRKNGMKL
FT                   EVYPPTMGTHKLQIFAKGNSEIYSSVLEYTLKCNYVDFSVQLPSELHQPVGPSWFSEQM
FT                   GITKPSHSDPIIHTSDGRCAISFSVEEGVSVLASLHGDDGPITEETQRRYIFQLNRGKR
FT                   TELKVQLPHAGKFALKIFVKKRQEQGNFIFVFNYLLCCANTKVNWPMFPESFGNWGQDN
FT                   ELLEPLSGVLPANRNIAFKLKLHGIAKALVKGQDTWPLTLNPEGYWEGSCNTAGCQEVY
FT                   VMVLENANHNFYSYILKYKVNDQ"
FT   CDS             join(13210744..13210879,13213712..13213774,
FT                   13217577..13217639,13225893..13225967,13227922..13227984,
FT                   13230002..13230084,13231300..13231408,13232504..13232621,
FT                   13242205..13242334,13243585..13243792,13246490..13247385)
FT                   /codon_start=1
FT                   /gene="Ky"
FT                   /locus_tag="mCG_116015"
FT                   /product="kyphoscoliosis peptidase, isoform CRA_b"
FT                   /note="gene_id=mCG116015.2 transcript_id=mCT117131.1
FT                   protein_id=mCP68754.1 isoform=CRA_b"
FT                   /protein_id="EDL21050.1"
FT                   /translation="MELKKDSNAVAIDMLLIVHSEKRRAAQATHLDPQANPGALLQNRG
FT                   GFQGVRNGIRKWQELEENSFQGNLPEKQCLQQPQVITSYDNQGTQLTVEIHPQDAMPQL
FT                   LKKFSLAKRLQGDKNGNMRPRQPGGKDAHAYPWDRSSLKSMPLDLRLFEKLDASASQVT
FT                   VKSGLNELVSDLLQEAHSDLERVRAIWIWICHHIEYDVEAAQEKDRQAFKPTDILRTQK
FT                   TNCDGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFSGEFDHAWNAVYLEGRWHLV
FT                   FLYSSYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHKSEFYNKGMLSA
FT                   HPETSMIRTVNGKATITIESRAPTLFMFMLNGKQEHGLLSLRKNGMKLEVYPPTMGTHK
FT                   LQIFAKGNSEIYSSVLEYTLKCNYVDFSVQLPSELHQPVGPSWFSEQMGITKPSHSDPI
FT                   IHTSDGRCAISFSVEEGVSVLASLHGDDGPITEETQRRYIFQLNRGKRTELKVQLPHAG
FT                   KFALKIFVKKRQEQGNFIFVFNYLLCCANTKVNWPMFPESFGNWGQDNELLEPLSGVLP
FT                   ANRNIAFKLKLHGIAKALVKGQDTWPLTLNPEGYWEGSCNTAGCQEVYVMVLENANHNF
FT                   YSYILKYKVNDQ"
FT   gene            13256307..13257603
FT                   /pseudo
FT                   /locus_tag="mCG_116021"
FT                   /note="gene_id=mCG116021.1"
FT   mRNA            13256307..13257603
FT                   /pseudo
FT                   /locus_tag="mCG_116021"
FT                   /note="gene_id=mCG116021.1 transcript_id=mCT117137.1
FT                   created on 23-JUL-2002"
FT   gene            13260739..13260915
FT                   /pseudo
FT                   /locus_tag="mCG_1032798"
FT                   /note="gene_id=mCG1032798.1"
FT   mRNA            13260739..13260915
FT                   /pseudo
FT                   /locus_tag="mCG_1032798"
FT                   /note="gene_id=mCG1032798.1 transcript_id=mCT150502.1
FT                   created on 23-JUL-2002"
FT   gene            complement(13291190..13331250)
FT                   /locus_tag="mCG_116019"
FT                   /note="gene_id=mCG116019.1"
FT   mRNA            complement(join(13291190..13291617,13299120..13299206,
FT                   13300734..13300931,13302782..13302896,13305930..13306067,
FT                   13307028..13307158,13307452..13307685,13311959..13312072,
FT                   13317951..13318073,13319927..13320022,13323467..13323644,
FT                   13324348..13324416,13330968..13331250))
FT                   /locus_tag="mCG_116019"
FT                   /product="mCG116019, transcript variant mCT117135"
FT                   /note="gene_id=mCG116019.1 transcript_id=mCT117135.1
FT                   created on 23-JUL-2002"
FT   mRNA            complement(join(13291190..13291617,13293314..13293593,
FT                   13294936..13295141,13299120..13299206,13300734..13300931,
FT                   13302782..13302896,13305930..13306067,13307028..13307158,
FT                   13307452..13307685,13311959..13312072,13317951..13318073,
FT                   13319927..13320022,13323467..13323644,13324348..13324416,
FT                   13326352..13326384,13328251..13328288,13330599..>13330798))
FT                   /locus_tag="mCG_116019"
FT                   /product="mCG116019, transcript variant mCT191547"
FT                   /note="gene_id=mCG116019.1 transcript_id=mCT191547.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(13291190..13291617,13299120..13299206,
FT                   13300734..13300931,13302782..13302896,13305930..13306067,
FT                   13307028..13307158,13307452..13307685,13311959..13312072,
FT                   13317951..13318073,13319927..13320022,13323467..13323644,
FT                   13324348..13324416,13325929..13325950,13326352..13326384,
FT                   13328251..13328288,13330599..13330798))
FT                   /locus_tag="mCG_116019"
FT                   /product="mCG116019, transcript variant mCT171116"
FT                   /note="gene_id=mCG116019.1 transcript_id=mCT171116.0
FT                   created on 23-JUL-2002"
FT   CDS             complement(join(13291459..13291617,13293314..13293593,
FT                   13294936..13295141,13299120..13299206,13300734..13300931,
FT                   13302782..13302896,13305930..13306067,13307028..13307158,
FT                   13307452..13307685,13311959..13312072,13317951..13318073,
FT                   13319927..13320022,13323467..13323644,13324348..13324416,
FT                   13326352..13326384,13328251..13328288,13330599..>13330796))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116019"
FT                   /product="mCG116019, isoform CRA_b"
FT                   /note="gene_id=mCG116019.1 transcript_id=mCT191547.0
FT                   protein_id=mCP112464.0 isoform=CRA_b"
FT                   /protein_id="EDL21052.1"
FT                   /translation="GRAAANCGAVSALATVVPLGSRPHGPRPQLVAAHLPRGFPMPGCG
FT                   CPVVAPLGSSSSLWDSGLAGQTTAMNWWPSNLQRWKSRSSRTQSCCQNKEDLEMEALLE
FT                   GIQNRGHSGGFLTSCEAELQELMKQIDIMVAHKKSEWEGQTHALETCLDIRDRELKALR
FT                   SQLDMKHKEVGILHQQIEEHEKTKQEMAMEYKEELLKLQEELSRLKRSYEKLQKKQLRE
FT                   FRGNTKSFREDRSEIERLTGKIEEFRQKSLDWEKQRLIYQQQVSSLEAQRKALAEQSEI
FT                   IQAQLANRKQKLESVELSSQSEIQHLNSKLERAKDTICANELEIERLNIRVNDLMGTNM
FT                   TILQDHRQKEEKLRESEKLLEALQEEQKELKASLQSQETFILEAKMQEKLQTTLKAVGT
FT                   QQSVERPLEDCQKERKYSSPGQGVLDNVLSQLDFSHSSEELLQAEVTRLEGSLESVSAT
FT                   CKQLSQELMEKYEELKRMEGHNNEYRTEIKKLKEQILQADQTYSSALEGMKMEISQLTR
FT                   ELHQRDITIASAKCSSSDMEKQLKAEMQKAEEKAVEHKEILSQLESLKLENHRLSETVM
FT                   KLELGLHEAKEISLADLQENYIEALNKLVSENQQLQKDLMSTKSELEHATNMCKKKDGE
FT                   IFNPAHSRAAGFKNAELKPIHGQHRHDGIKTEQYKTGHHSPRGQTLDSIDPVARGPSPL
FT                   SSHISPGSSTVSLPSNFLFETHCLPSVLDINDVNFSDSLSDCMNDQEEFVSSGSLPTSP
FT                   LGSIATRFLEEEELRSHHILERLDAHIEELKRESEKTVRQFTALV"
FT   CDS             complement(join(13291459..13291617,13299120..13299206,
FT                   13300734..13300931,13302782..13302896,13305930..13306067,
FT                   13307028..13307158,13307452..13307685,13311959..13312072,
FT                   13317951..13318073,13319927..13320022,13323467..13323644,
FT                   13324348..13324391))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116019"
FT                   /product="mCG116019, isoform CRA_a"
FT                   /note="gene_id=mCG116019.1 transcript_id=mCT117135.1
FT                   protein_id=mCP68554.1 isoform=CRA_a"
FT                   /protein_id="EDL21051.1"
FT                   /translation="MEALLEGIQNRGHSGGFLTSCEAELQELMKQIDIMVAHKKSEWEG
FT                   QTHALETCLDIRDRELKALRSQLDMKHKEVGILHQQIEEHEKTKQEMAMEYKEELLKLQ
FT                   EELSRLKRSYEKLQKKQLREFRGNTKSFREDRSEIERLTGKIEEFRQKSLDWEKQRLIY
FT                   QQQVSSLEAQRKALAEQSEIIQAQLANRKQKLESVELSSQSEIQHLNSKLERAKDTICA
FT                   NELEIERLNIRVNDLMGTNMTILQDHRQKEEKLRESEKLLEALQEEQKELKASLQSQET
FT                   FILEAKMQEKLQTTLKAVGTQQSVERPLEDCQKERKYSSPGQGVLDNVLSQLDFSHSSE
FT                   ELLQAEVTRLEGSLESVSATCKQLSQELMEKYEELKRMEGHNNEYRTEIKKLKEQILQA
FT                   DQTYSSALEGMKMEISQLTRELHQRDITIASAKCSSSDMEKQLKAEMQKAEEKAVEHKE
FT                   ILSQLESLKLENHRLSETVMKLELGLHEGSLPTSPLGSIATRFLEEEELRSHHILERLD
FT                   AHIEELKRESEKTVRQFTALV"
FT   CDS             complement(join(13291459..13291617,13299120..13299206,
FT                   13300734..13300931,13302782..13302896,13305930..13306067,
FT                   13307028..13307158,13307452..13307685,13311959..13312072,
FT                   13317951..13318073,13319927..13320022,13323467..13323644,
FT                   13324348..13324391))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116019"
FT                   /product="mCG116019, isoform CRA_a"
FT                   /note="gene_id=mCG116019.1 transcript_id=mCT171116.0
FT                   protein_id=mCP94034.0 isoform=CRA_a"
FT                   /protein_id="EDL21053.1"
FT                   /translation="MEALLEGIQNRGHSGGFLTSCEAELQELMKQIDIMVAHKKSEWEG
FT                   QTHALETCLDIRDRELKALRSQLDMKHKEVGILHQQIEEHEKTKQEMAMEYKEELLKLQ
FT                   EELSRLKRSYEKLQKKQLREFRGNTKSFREDRSEIERLTGKIEEFRQKSLDWEKQRLIY
FT                   QQQVSSLEAQRKALAEQSEIIQAQLANRKQKLESVELSSQSEIQHLNSKLERAKDTICA
FT                   NELEIERLNIRVNDLMGTNMTILQDHRQKEEKLRESEKLLEALQEEQKELKASLQSQET
FT                   FILEAKMQEKLQTTLKAVGTQQSVERPLEDCQKERKYSSPGQGVLDNVLSQLDFSHSSE
FT                   ELLQAEVTRLEGSLESVSATCKQLSQELMEKYEELKRMEGHNNEYRTEIKKLKEQILQA
FT                   DQTYSSALEGMKMEISQLTRELHQRDITIASAKCSSSDMEKQLKAEMQKAEEKAVEHKE
FT                   ILSQLESLKLENHRLSETVMKLELGLHEGSLPTSPLGSIATRFLEEEELRSHHILERLD
FT                   AHIEELKRESEKTVRQFTALV"
FT   assembly_gap    13330799..13330818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13331029..13338962
FT                   /locus_tag="mCG_51921"
FT                   /note="gene_id=mCG51921.2"
FT   mRNA            join(13331029..13331392,13334470..13334595,
FT                   13338735..13338962)
FT                   /locus_tag="mCG_51921"
FT                   /product="mCG51921, transcript variant mCT52104"
FT                   /note="gene_id=mCG51921.2 transcript_id=mCT52104.1 created
FT                   on 23-JUL-2002"
FT   mRNA            join(13331513..13331624,13334470..13334595,
FT                   13338735..13338962)
FT                   /locus_tag="mCG_51921"
FT                   /product="mCG51921, transcript variant mCT171136"
FT                   /note="gene_id=mCG51921.2 transcript_id=mCT171136.0 created
FT                   on 23-JUL-2002"
FT   mRNA            join(13333218..13334595,13338735..13338962)
FT                   /locus_tag="mCG_51921"
FT                   /product="mCG51921, transcript variant mCT171137"
FT                   /note="gene_id=mCG51921.2 transcript_id=mCT171137.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(13334497..13334595,13338735..13338860)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51921"
FT                   /product="mCG51921, isoform CRA_a"
FT                   /note="gene_id=mCG51921.2 transcript_id=mCT171137.0
FT                   protein_id=mCP94054.0 isoform=CRA_a"
FT                   /protein_id="EDL21054.1"
FT                   /translation="MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGG
FT                   TTESVKEQEMKWTDLALQGLHENVPPAGN"
FT   CDS             join(13334497..13334595,13338735..13338860)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51921"
FT                   /product="mCG51921, isoform CRA_a"
FT                   /note="gene_id=mCG51921.2 transcript_id=mCT52104.1
FT                   protein_id=mCP41321.0 isoform=CRA_a"
FT                   /protein_id="EDL21055.1"
FT                   /translation="MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGG
FT                   TTESVKEQEMKWTDLALQGLHENVPPAGN"
FT   CDS             join(13334497..13334595,13338735..13338860)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51921"
FT                   /product="mCG51921, isoform CRA_a"
FT                   /note="gene_id=mCG51921.2 transcript_id=mCT171136.0
FT                   protein_id=mCP94055.0 isoform=CRA_a"
FT                   /protein_id="EDL21056.1"
FT                   /translation="MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGG
FT                   TTESVKEQEMKWTDLALQGLHENVPPAGN"
FT   assembly_gap    13365362..13365434
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    13367190..13367301
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    13375918..13375992
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    13377392..13377411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13384251..13384366
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    13385784..13385832
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    13387189..13387208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13388284..13388639
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    13390323..13390342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13393456..13393475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13394540..13394559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13395789..13395808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13397680..13397717
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   gene            13398026..13398917
FT                   /locus_tag="mCG_147720"
FT                   /note="gene_id=mCG147720.0"
FT   mRNA            join(13398026..13398088,13398252..13398917)
FT                   /locus_tag="mCG_147720"
FT                   /product="mCG147720"
FT                   /note="gene_id=mCG147720.0 transcript_id=mCT187983.0
FT                   created on 13-JAN-2004"
FT   CDS             13398619..13398741
FT                   /codon_start=1
FT                   /locus_tag="mCG_147720"
FT                   /product="mCG147720"
FT                   /note="gene_id=mCG147720.0 transcript_id=mCT187983.0
FT                   protein_id=mCP108546.0"
FT                   /protein_id="EDL21057.1"
FT                   /translation="MLTLQGRFSTPGLFSARELNFLRARRALYQLSPSPRFFES"
FT   assembly_gap    13398936..13399007
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    13409790..13409884
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    13416288..13416367
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   gene            13422857..13438405
FT                   /gene="Amotl2"
FT                   /locus_tag="mCG_6207"
FT                   /note="gene_id=mCG6207.2"
FT   mRNA            join(13422857..13422944,13425117..13425912,
FT                   13428548..13428842,13429678..13429822,13430094..13430186,
FT                   13433310..13433605,13434261..13434571,13434961..13435169,
FT                   13435787..13435963,13436642..13438405)
FT                   /gene="Amotl2"
FT                   /locus_tag="mCG_6207"
FT                   /product="angiomotin like 2, transcript variant mCT170575"
FT                   /note="gene_id=mCG6207.2 transcript_id=mCT170575.0 created
FT                   on 11-JUL-2002"
FT   CDS             join(13425179..13425912,13428548..13428842,
FT                   13429678..13429822,13430094..13430186,13433310..13433605,
FT                   13434261..13434571,13434961..13435169,13435787..13435963,
FT                   13436642..13436700)
FT                   /codon_start=1
FT                   /gene="Amotl2"
FT                   /locus_tag="mCG_6207"
FT                   /product="angiomotin like 2, isoform CRA_a"
FT                   /note="gene_id=mCG6207.2 transcript_id=mCT170575.0
FT                   protein_id=mCP93493.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8K371"
FT                   /db_xref="InterPro:IPR009114"
FT                   /db_xref="InterPro:IPR024646"
FT                   /db_xref="MGI:MGI:1929286"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K371"
FT                   /protein_id="EDL21058.1"
FT                   /translation="MRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGA
FT                   GGTGSPQASLEIGAPEDSQVLQQATRQEPQGQEHQGGETHLAENRLYRLCPQPSKGEEL
FT                   PTYEEAKAHSQYYAAQQAGSRPHVGDRDPRGGVSGGGRRQDEALRELRHGHVRSLSERL
FT                   LQLSLERNGARVPSHMSSSHSFPQLARSQQGPQPRGPPAEGPEPRGPPPQYPHAVMAQE
FT                   TAAVTDPRYRPRSSPHFQHAEVRILQAQVPPVFLQQQQYQYLPQPQEHSPPLHPAALGH
FT                   GPPSSFGPPAVEGPPSAQATLGSAHLAQMETVLRENARLQRDNERLQRELESTSEKAGR
FT                   IEKLENEIQRLSEAHESLMRTSSKREALEKTMRNKMDGEMRRLQDFNRDLRERLESANR
FT                   HLASKTQEAQAGSQDMVAKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRHAELLEQAL
FT                   GNAQSRAARAEEELRKKQAYVEKVERLQQALGQLQAACEKREQLELRLRTRLEQELKAL
FT                   RAQQRQTGTLAGGGGSHGGSAELSALRLSEQLREKEEQILALEADMTKWEQKYLEERAM
FT                   RQFAMDAAATAAAQRDTTLIRHSPQPSPSSSFNEGLLPGNHRHQEMESRLKVLHAQILE
FT                   KDAVIKVLQQRSRKDPGKATQGTLRPAKSVPSIFAAAVGTQGWQGLVSSERQTDARPAG
FT                   DRVPAEEPPATAPLPAHTKHGSRDGSTQTDGPADNTSACLASEPDGLLGCNSSQRTPSL
FT                   DSIAATRVQDLSDMVEILI"
FT   assembly_gap    13426793..13427628
FT                   /estimated_length=836
FT                   /gap_type="unknown"
FT   mRNA            join(13427629..13428842,13429678..13429822,
FT                   13430094..13430186,13433310..13433605,13434261..13434571,
FT                   13434961..13435169,13435787..13435963,13436642..13438405)
FT                   /gene="Amotl2"
FT                   /locus_tag="mCG_6207"
FT                   /product="angiomotin like 2, transcript variant mCT5836"
FT                   /note="gene_id=mCG6207.2 transcript_id=mCT5836.1 created on
FT                   11-JUL-2002"
FT   CDS             join(13428741..13428842,13429678..13429822,
FT                   13430094..13430186,13433310..13433605,13434261..13434571,
FT                   13434961..13435169,13435787..13435963,13436642..13436700)
FT                   /codon_start=1
FT                   /gene="Amotl2"
FT                   /locus_tag="mCG_6207"
FT                   /product="angiomotin like 2, isoform CRA_b"
FT                   /note="gene_id=mCG6207.2 transcript_id=mCT5836.1
FT                   protein_id=mCP21283.1 isoform=CRA_b"
FT                   /protein_id="EDL21059.1"
FT                   /translation="METVLRENARLQRDNERLQRELESTSEKAGRIEKLENEIQRLSEA
FT                   HESLMRTSSKREALEKTMRNKMDGEMRRLQDFNRDLRERLESANRHLASKTQEAQAGSQ
FT                   DMVAKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRHAELLEQALGNAQSRAARAEEEL
FT                   RKKQAYVEKVERLQQALGQLQAACEKREQLELRLRTRLEQELKALRAQQRQTGTLAGGG
FT                   GSHGGSAELSALRLSEQLREKEEQILALEADMTKWEQKYLEERAMRQFAMDAAATAAAQ
FT                   RDTTLIRHSPQPSPSSSFNEGLLPGNHRHQEMESRLKVLHAQILEKDAVIKVLQQRSRK
FT                   DPGKATQGTLRPAKSVPSIFAAAVGTQGWQGLVSSERQTDARPAGDRVPAEEPPATAPL
FT                   PAHTKHGSRDGSTQTDGPADNTSACLASEPDGLLGCNSSQRTPSLDSIAATRVQDLSDM
FT                   VEILI"
FT   assembly_gap    13462384..13462403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13468951..13469269
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    13479425..13479565
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    13487028..13487047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13495777..13495853
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    13504261..13504280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13515609..13515628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13532328..13532347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13533810..13533829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <13539017..13621650
FT                   /locus_tag="mCG_6211"
FT                   /note="gene_id=mCG6211.2"
FT   mRNA            join(<13539017..13539115,13539263..13539349,
FT                   13575570..13575691,13581267..13581366,13582986..13583120,
FT                   13585443..13585496,13589324..13589468,13595241..13595341,
FT                   13599416..13599541,13601845..13601931,13604591..13604660,
FT                   13610554..13610686,13611829..13611938,13612061..13612220,
FT                   13619382..13619518,13620195..13621650)
FT                   /locus_tag="mCG_6211"
FT                   /product="mCG6211"
FT                   /note="gene_id=mCG6211.2 transcript_id=mCT5831.2 created on
FT                   23-JUL-2002"
FT   assembly_gap    13539116..13539262
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   CDS             join(<13539265..13539349,13575570..13575691,
FT                   13581267..13581366,13582986..13583120,13585443..13585496,
FT                   13589324..13589468,13595241..13595341,13599416..13599541,
FT                   13601845..13601931,13604591..13604660,13610554..13610686,
FT                   13611829..13611938,13612061..13612220,13619382..13619518,
FT                   13620195..13620306)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6211"
FT                   /product="mCG6211"
FT                   /note="gene_id=mCG6211.2 transcript_id=mCT5831.2
FT                   protein_id=mCP21317.2"
FT                   /protein_id="EDL21060.1"
FT                   /translation="PRSPALAAAPAGPSVSLYLSEDEVRRLLGLDAELYYVRNDLISHY
FT                   ALSFNLLVPSETNFLHFTWHAKSKVEYKLGFQVDNFVAMGMPQVNISAQGEVPRTLSVF
FT                   RVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNTSR
FT                   TIYDPVHAAPTTSTRVFYISVGVCCAVIFLVAIILAVLHLHSMKRIELDDSISASSSSQ
FT                   GLSQPSTQTTQYLRADTPNNATPITSYPTLRIEKNDLRSVTLLEAKAKVKDIAISRERI
FT                   TLKDVLQEGTFGRIFHGILVDEKDPNKEKQTFVKTVKDQASEVQVTMMLTESCKLRGLH
FT                   HRNLLPITHVCIEEGEKPMVVLPYMNWGNLKLFLRQCKLVEANNPQAISQQDLVHMAIQ
FT                   IACGMSYLARREVIHRDLAARNCVIDDTLQVKITDNALSRDLFPMDYHCLGDNENRPVR
FT                   WMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPIN
FT                   CPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALGAYV"
FT   assembly_gap    13541457..13541863
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    13554471..13555919
FT                   /estimated_length=1449
FT                   /gap_type="unknown"
FT   assembly_gap    13558134..13558153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13560197..13561064
FT                   /estimated_length=868
FT                   /gap_type="unknown"
FT   assembly_gap    13563558..13563577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13565236..13565255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13568888..13568907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13570276..13571336
FT                   /estimated_length=1061
FT                   /gap_type="unknown"
FT   assembly_gap    13576652..13576761
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    13587516..13587801
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    13596060..13596941
FT                   /estimated_length=882
FT                   /gap_type="unknown"
FT   assembly_gap    13609901..13609942
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    13650021..13650040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13658426..13658536
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    13674680..13675183
FT                   /estimated_length=504
FT                   /gap_type="unknown"
FT   assembly_gap    13680776..13680847
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    13684991..13685365
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    13697082..13697136
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    13703222..13703640
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   gene            13722438..13810098
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /note="gene_id=mCG1040582.3"
FT   mRNA            join(13722438..13722719,13760797..13760934,
FT                   13764252..13764414,13781930..13782157,13783250..13783348,
FT                   13784333..13784469,13786664..13786739,13787253..13787417,
FT                   13788481..13788670,13791029..13791194,13793554..13793717,
FT                   13796434..13796498,13798923..13799046,13799864..13800058,
FT                   13809843..13810029)
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 2a1, transcript variant mCT161074"
FT                   /note="gene_id=mCG1040582.3 transcript_id=mCT161074.2
FT                   created on 11-JUL-2002"
FT   mRNA            join(13722438..13722719,13760797..13760934,
FT                   13764252..13764414,13781930..13782157,13783250..13783348,
FT                   13784333..13784469,13786664..13786739,13787253..13787417,
FT                   13788481..13788670,13791029..13791194,13793554..13793717,
FT                   13796434..13796498,13798923..13799046,13799864..13802372)
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 2a1, transcript variant mCT117130"
FT                   /note="gene_id=mCG1040582.3 transcript_id=mCT117130.1
FT                   created on 11-JUL-2002"
FT   mRNA            join(<13722503..13722719,13760797..13760934,
FT                   13764252..13764414,13781930..13782157,13783250..13783348,
FT                   13784333..13784469,13786664..13786739,13787253..13787417,
FT                   13791029..13791194,13793554..13793717,13796434..13796498,
FT                   13798923..13799046,13799864..13800058,13809843..13810098)
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 2a1, transcript variant mCT191506"
FT                   /note="gene_id=mCG1040582.3 transcript_id=mCT191506.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<13722570..13722719,13760797..13760934,
FT                   13764252..13764414,13781930..13782157,13783250..13783348,
FT                   13784333..13784469,13786664..13786739,13787253..13787417,
FT                   13791029..13791171)
FT                   /codon_start=1
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 2a1, isoform CRA_b"
FT                   /note="gene_id=mCG1040582.3 transcript_id=mCT191506.0
FT                   protein_id=mCP112462.0 isoform=CRA_b"
FT                   /protein_id="EDL21062.1"
FT                   /translation="PRPVATTLARSGDVASVTMGLLPKPGARQGSGTSSVPARRCSRSV
FT                   FNNIKVFVLCHGLLQLCQLLYSAYFKSSLTTIEKRFGLSSSSSGLISSLNEISNAILII
FT                   FVSYFGSRVNRPRMIGIGGLLLAAGAFVLTLPHFLSEPYQYASTTAGNSSHFQTDLCQK
FT                   HLPGLLPSKCHSTVPDTQKETSSMWSLMVVAQLLAGVGTVPIQPFGISYVDDFAEPTNS
FT                   PLYISILFAIAVFGPAFGYLLGSVMLRIFVDYGRVDTATVNLSPGDPRWIGAWWLGLLI
FT                   SSGFLIVTSLPFFFFPRAMSRGAERSVIAEETMKMEEDKSRGSLMDFIKRFPRIFLRLL
FT                   MNPLFMLVVLSQCTFSSVIAGLSTFLNKFLEKQYDASAAYANLLIAHQVLYIRSLPPAA
FT                   GTACAQIPSSTLSAETMESSTSPPAMLAAAAST"
FT   CDS             join(13722624..13722719,13760797..13760934,
FT                   13764252..13764414,13781930..13782157,13783250..13783348,
FT                   13784333..13784469,13786664..13786739,13787253..13787417,
FT                   13788481..13788670,13791029..13791194,13793554..13793717,
FT                   13796434..13796498,13798923..13799046,13799864..13799984)
FT                   /codon_start=1
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 2a1, isoform CRA_a"
FT                   /note="gene_id=mCG1040582.3 transcript_id=mCT117130.1
FT                   protein_id=mCP68753.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TED0"
FT                   /db_xref="InterPro:IPR002350"
FT                   /db_xref="InterPro:IPR004156"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1346021"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TED0"
FT                   /protein_id="EDL21061.1"
FT                   /translation="MGLLPKPGARQGSGTSSVPARRCSRSVFNNIKVFVLCHGLLQLCQ
FT                   LLYSAYFKSSLTTIEKRFGLSSSSSGLISSLNEISNAILIIFVSYFGSRVNRPRMIGIG
FT                   GLLLAAGAFVLTLPHFLSEPYQYASTTAGNSSHFQTDLCQKHLPGLLPSKCHSTVPDTQ
FT                   KETSSMWSLMVVAQLLAGVGTVPIQPFGISYVDDFAEPTNSPLYISILFAIAVFGPAFG
FT                   YLLGSVMLRIFVDYGRVDTATVNLSPGDPRWIGAWWLGLLISSGFLIVTSLPFFFFPRA
FT                   MSRGAERSVIAEETMKMEEDKSRGSLMDFIKRFPRIFLRLLMNPLFMLVVLSQCTFSSV
FT                   IAGLSTFLNKFLEKQYDASAAYANLLIGAVNLPAAALGMLFGGILMKRFVFPLQTIPRV
FT                   AATIMTISIILCAPLFFMGCSTPAVAEVYPPSTPSSIHPQPPACRRDCLCPDSVFHPVC
FT                   GDNGVEYLSPCHAGCSSLNVSSAASKQPIYLNCSCVTGGSASAKTGSCPTSCAQLLLPS
FT                   IFLISFVALIACVSHNPLYMMVLRVVNQDEKSFAIGVQFLLMRLLAWLPSPSLYGLLID
FT                   SSCIRWNYLCSGRRGACAYYDNDALRNRYLGLQVIYKVLGTLLLFFISWRVKKNREYSL
FT                   QENASGLI"
FT   CDS             join(13722624..13722719,13760797..13760934,
FT                   13764252..13764414,13781930..13782157,13783250..13783348,
FT                   13784333..13784469,13786664..13786739,13787253..13787417,
FT                   13788481..13788670,13791029..13791194,13793554..13793717,
FT                   13796434..13796498,13798923..13799046,13799864..13799984)
FT                   /codon_start=1
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 2a1, isoform CRA_a"
FT                   /note="gene_id=mCG1040582.3 transcript_id=mCT161074.2
FT                   protein_id=mCP90082.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TED0"
FT                   /db_xref="InterPro:IPR002350"
FT                   /db_xref="InterPro:IPR004156"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1346021"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TED0"
FT                   /protein_id="EDL21063.1"
FT                   /translation="MGLLPKPGARQGSGTSSVPARRCSRSVFNNIKVFVLCHGLLQLCQ
FT                   LLYSAYFKSSLTTIEKRFGLSSSSSGLISSLNEISNAILIIFVSYFGSRVNRPRMIGIG
FT                   GLLLAAGAFVLTLPHFLSEPYQYASTTAGNSSHFQTDLCQKHLPGLLPSKCHSTVPDTQ
FT                   KETSSMWSLMVVAQLLAGVGTVPIQPFGISYVDDFAEPTNSPLYISILFAIAVFGPAFG
FT                   YLLGSVMLRIFVDYGRVDTATVNLSPGDPRWIGAWWLGLLISSGFLIVTSLPFFFFPRA
FT                   MSRGAERSVIAEETMKMEEDKSRGSLMDFIKRFPRIFLRLLMNPLFMLVVLSQCTFSSV
FT                   IAGLSTFLNKFLEKQYDASAAYANLLIGAVNLPAAALGMLFGGILMKRFVFPLQTIPRV
FT                   AATIMTISIILCAPLFFMGCSTPAVAEVYPPSTPSSIHPQPPACRRDCLCPDSVFHPVC
FT                   GDNGVEYLSPCHAGCSSLNVSSAASKQPIYLNCSCVTGGSASAKTGSCPTSCAQLLLPS
FT                   IFLISFVALIACVSHNPLYMMVLRVVNQDEKSFAIGVQFLLMRLLAWLPSPSLYGLLID
FT                   SSCIRWNYLCSGRRGACAYYDNDALRNRYLGLQVIYKVLGTLLLFFISWRVKKNREYSL
FT                   QENASGLI"
FT   assembly_gap    13745364..13745433
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    13747145..13747385
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    13825755..13826076
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   gene            13826077..13899649
FT                   /gene="Rab6b"
FT                   /locus_tag="mCG_16153"
FT                   /note="gene_id=mCG16153.2"
FT   mRNA            join(13826077..13826354,13854911..13854969,
FT                   13875192..13875245,13875436..13875541,13876913..13877024,
FT                   13878189..13878282,13881485..13881551,13895563..13899649)
FT                   /gene="Rab6b"
FT                   /locus_tag="mCG_16153"
FT                   /product="RAB6B, member RAS oncogene family"
FT                   /note="gene_id=mCG16153.2 transcript_id=mCT15896.2 created
FT                   on 16-SEP-2002"
FT   CDS             join(13826285..13826354,13854911..13854969,
FT                   13875192..13875245,13875436..13875541,13876913..13877024,
FT                   13878189..13878282,13881485..13881551,13895563..13895627)
FT                   /codon_start=1
FT                   /gene="Rab6b"
FT                   /locus_tag="mCG_16153"
FT                   /product="RAB6B, member RAS oncogene family"
FT                   /note="gene_id=mCG16153.2 transcript_id=mCT15896.2
FT                   protein_id=mCP21219.2"
FT                   /db_xref="GOA:Q0PD53"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:107283"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PD53"
FT                   /protein_id="EDL21064.1"
FT                   /translation="MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQAT
FT                   IGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQT
FT                   SKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEEGEQRAKELSVMFIETSAKTGYNV
FT                   KQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCSC"
FT   assembly_gap    13843877..13843896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13846004..13846023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13850903..13851568
FT                   /estimated_length=666
FT                   /gap_type="unknown"
FT   assembly_gap    13866159..13866325
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    13870040..13870223
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    13871405..13871545
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   gene            complement(13902382..13916408)
FT                   /gene="Srprb"
FT                   /locus_tag="mCG_16157"
FT                   /note="gene_id=mCG16157.2"
FT   mRNA            complement(join(13902382..13904623,13905271..13905325,
FT                   13906416..13906552,13911802..13911884,13913053..13913130,
FT                   13915558..13915652,13916183..13916408))
FT                   /gene="Srprb"
FT                   /locus_tag="mCG_16157"
FT                   /product="signal recognition particle receptor, B subunit"
FT                   /note="gene_id=mCG16157.2 transcript_id=mCT16044.2 created
FT                   on 11-JUL-2002"
FT   CDS             complement(join(13904410..13904623,13905271..13905325,
FT                   13906416..13906552,13911802..13911884,13913053..13913130,
FT                   13915558..13915652,13916183..13916330))
FT                   /codon_start=1
FT                   /gene="Srprb"
FT                   /locus_tag="mCG_16157"
FT                   /product="signal recognition particle receptor, B subunit"
FT                   /note="gene_id=mCG16157.2 transcript_id=mCT16044.2
FT                   protein_id=mCP21240.2"
FT                   /protein_id="EDL21065.1"
FT                   /translation="MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVALLAV
FT                   LLTLVFWKFIWSRKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVN
FT                   NNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLID
FT                   SMALKNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQ
FT                   LGKKGKEFEFSQLPLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA"
FT   assembly_gap    13909735..13909985
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   gene            complement(13923141..13944785)
FT                   /gene="Trf"
FT                   /locus_tag="mCG_16156"
FT                   /note="gene_id=mCG16156.2"
FT   mRNA            complement(join(13923141..13923342,13924730..13924913,
FT                   13926047..13926231,13929428..13929492,13930049..13930178,
FT                   13931602..13931772,13933472..13933504,13934051..13934141,
FT                   13935142..13935293,13936300..13936477,13937186..13937364,
FT                   13937835..13937890,13939294..13939426,13940214..13940390,
FT                   13941091..13941199,13942149..13942321,13944430..13944785))
FT                   /gene="Trf"
FT                   /locus_tag="mCG_16156"
FT                   /product="transferrin"
FT                   /note="gene_id=mCG16156.2 transcript_id=mCT16045.2 created
FT                   on 19-JUL-2002"
FT   CDS             complement(join(13923308..13923342,13924730..13924913,
FT                   13926047..13926231,13929428..13929492,13930049..13930178,
FT                   13931602..13931772,13933472..13933504,13934051..13934141,
FT                   13935142..13935293,13936300..13936477,13937186..13937364,
FT                   13937835..13937890,13939294..13939426,13940214..13940390,
FT                   13941091..13941199,13942149..13942321,13944430..13944472))
FT                   /codon_start=1
FT                   /gene="Trf"
FT                   /locus_tag="mCG_16156"
FT                   /product="transferrin"
FT                   /note="gene_id=mCG16156.2 transcript_id=mCT16045.2
FT                   protein_id=mCP21269.2"
FT                   /protein_id="EDL21066.1"
FT                   /translation="MRLTVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHM
FT                   KTVLPPDGPRLACVKKTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFY
FT                   GSVEHPQTYYYAVAVVKKGTDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRS
FT                   PLEKAVSSFFSGSCVPCADPVAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVA
FT                   FVKHTTIFEVLPEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKEDL
FT                   IWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVT
FT                   AIRNQQEGVCPEGSIDNSPVKWCALSHLERTKCDEWSIISEGKIECESAETTEDCIEKI
FT                   VNGEADAMTLDGGHAYIAGQCGLVPVMAEYYESSNCAIPSQQGIFPKGYYAVAVVKASD
FT                   TSITWNNLKGKKSCHTGVDRTAGWNIPMGMLYNRINHCKFDEFFSQGCAPGYEKNSTLC
FT                   DLCIGPLKCAPNNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLDNTEGKNPAEWAKNLKQ
FT                   EDFELLCPDGTRKPVKDFASCHLAQAPNHVVVSRKEKAARVKAVLTSQETLFGGSDCTG
FT                   NFCLFKSTTKDLLFRDDTKCFVKLPEGTTPEKYLGAEYMQSVGNMRKCSTSRLLEACTF
FT                   HKH"
FT   gene            complement(13964782..14003187)
FT                   /gene="1300017J02Rik"
FT                   /locus_tag="mCG_16155"
FT                   /note="gene_id=mCG16155.2"
FT   mRNA            complement(join(13964782..13964923,13966052..13966238,
FT                   13968901..13969085,13970831..13970895,13973636..13973777,
FT                   13977287..13977442,13980460..13980516,13981889..13981979,
FT                   13982569..13982711,13983869..13984040,13986744..13986922,
FT                   13988969..13989024,13991484..13991631,13993407..13993568,
FT                   13995069..13995177,13996579..13996751,14003062..14003187))
FT                   /gene="1300017J02Rik"
FT                   /locus_tag="mCG_16155"
FT                   /product="RIKEN cDNA 1300017J02"
FT                   /note="gene_id=mCG16155.2 transcript_id=mCT16043.2 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(13964889..13964923,13966052..13966238,
FT                   13968901..13969085,13970831..13970895,13973636..13973777,
FT                   13977287..13977442,13980460..13980516,13981889..13981979,
FT                   13982569..13982711,13983869..13984040,13986744..13986922,
FT                   13988969..13989024,13991484..13991631,13993407..13993568,
FT                   13995069..13995177,13996579..13996751,14003062..14003104))
FT                   /codon_start=1
FT                   /gene="1300017J02Rik"
FT                   /locus_tag="mCG_16155"
FT                   /product="RIKEN cDNA 1300017J02"
FT                   /note="gene_id=mCG16155.2 transcript_id=mCT16043.2
FT                   protein_id=mCP21252.2"
FT                   /protein_id="EDL21067.1"
FT                   /translation="MRLLICALLCLGTLGLCLALPEKTIRWCVVSDHEATKCSSFRDNM
FT                   KKVLPAGGPAVTCVRKMSHPECIRDISANKVDAVTVDGALVAEADLPHHSLKPIMAEYY
FT                   GSKDDPKTHYYVVAMAKKGTGFQLNQLRGKKSCHTGLGWSAGWYVPLSTLLPSGSRETA
FT                   AATFFSSSCVPCADGKMFPSLCQLCAGKGTDKCACSSREPYFGSWGALKCLQDGTADVS
FT                   FVKHLTVFEAMPTKADRDQYELLCMDNTRRPVEEYEQCYLARVPSHVVVARSVDGKEDS
FT                   IQELLRVAQEHFGKDKSSPFQLFGSPHGEDLLFTDAAHGLLRVPRKMDISLYLGYEFLS
FT                   AFRNLKRGLEDSQRVKWCAVGQQERTKCDQWSAVSGGALACATEETPEDCIAATMKGEA
FT                   DAMSLDGGFAYVAGHCGLVPVLAENYLSTHSSGRLGSKCVNAPLEGYYVVAVVKKSDVG
FT                   ITWKSLQGKKSCHTAVGTSEGWNVPMGLIYNQTGSCKFDAFFSRSCAPGSDPDSPLCAL
FT                   CVGGNNPAHMCAANNAEGYHGSSGALRCLVEKGDVAFMKHPTVLQNTDGKNPEPWAKGL
FT                   KHEDFELLCLDGTRKPVTEAQSCHLARVPNRAVFSRKDKADFVRRILFNQQELFGRNGF
FT                   EYMMFQMFESSAKDLLFSDDTECLSNLQNKTTYKTYLGPQYLTLMDNFRQCLSSELLDA
FT                   CTFHKY"
FT   assembly_gap    13987876..13987895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13995216..13995527
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    13998112..13998131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14001096..14001161
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    14007212..14007487
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   gene            14017643..14065196
FT                   /gene="Topbp1"
FT                   /locus_tag="mCG_16151"
FT                   /note="gene_id=mCG16151.2"
FT   mRNA            join(14017643..14017823,14018549..14018639,
FT                   14021183..14021317,14022255..14022398,14023960..14024141,
FT                   14025238..14025434,14027515..14027691,14030437..14030603,
FT                   14032619..14032782,14032924..14033171,14035718..14036076,
FT                   14036777..14036949,14038052..14038263,14040818..14041104,
FT                   14045094..14045264,14045354..14045463,14046465..14046588,
FT                   14050686..14050832,14050938..14051040,14053055..14053247,
FT                   14056692..14056912,14058312..14058460,14058689..14058800,
FT                   14059554..14059717,14060505..14060642,14061447..14061536,
FT                   14061690..14061851,14064551..14065196)
FT                   /gene="Topbp1"
FT                   /locus_tag="mCG_16151"
FT                   /product="topoisomerase (DNA) II beta binding protein"
FT                   /note="gene_id=mCG16151.2 transcript_id=mCT15895.2 created
FT                   on 02-AUG-2002"
FT   CDS             join(14018556..14018639,14021183..14021317,
FT                   14022255..14022398,14023960..14024141,14025238..14025434,
FT                   14027515..14027691,14030437..14030603,14032619..14032782,
FT                   14032924..14033171,14035718..14036076,14036777..14036949,
FT                   14038052..14038263,14040818..14041104,14045094..14045264,
FT                   14045354..14045463,14046465..14046588,14050686..14050832,
FT                   14050938..14051040,14053055..14053247,14056692..14056912,
FT                   14058312..14058460,14058689..14058800,14059554..14059717,
FT                   14060505..14060642,14061447..14061536,14061690..14061851,
FT                   14064551..14064685)
FT                   /codon_start=1
FT                   /gene="Topbp1"
FT                   /locus_tag="mCG_16151"
FT                   /product="topoisomerase (DNA) II beta binding protein"
FT                   /note="gene_id=mCG16151.2 transcript_id=mCT15895.2
FT                   protein_id=mCP21355.2"
FT                   /protein_id="EDL21068.1"
FT                   /translation="MSRNDQEPFLVKFLKSSDNSECFFKALESIKELQSEDYLQIITDE
FT                   EALKIRENDKSLYICDRFSGTVFDHLKQLGCRIVGPQVVTFCMRHQQCVPRAEHPVYNM
FT                   IMSDVTVSCTSLDKDKREEVHKYVQMMGGRVYRDLNVSVTHLIAGEVGSKKYLVAANLK
FT                   KPILLPSWIKTLWEKSQEKKITKYTDVNMEDFKCPIFLGCIICVTGLNGIHRKTVQQLT
FT                   AKHGGQYMGQLKMNECTHLIVQEPKGQKYECARRWNVHCVTLQWFHDSIEKGFCQDESI
FT                   YKAETRVEAKMVPDTSTPTAQSNAESHTLADVSHISNINGSCVNETMFGSTTSKLECSL
FT                   ENLENLDISMFQAPEDLLDGCRIYLCGFSGRKLDKLRRLINSGGGVRFNQLNEDVTHVI
FT                   VGDYDDDVRQFWSKSSHRPHVVGAKWLLECFTKGYILPEESYIHTNYQPAGIAVSDQPG
FT                   NQTAVLDKSGSFSKSALVPAERLQQADEDLLAQYGNDDSTMVEAKLSEALEPEVGPCPG
FT                   SAHREPCDDSTHISVQEENKSSVSHCILDDSTVREEGLFSQKSFLVLGFSVENKCNIVD
FT                   IIREHAGKIVSLPSRIVADYAVVPLLGCEVDVTVGEVVTNTWLVTCIDNQTLVDPKSNP
FT                   LFTPVSVMSGVTPLEDCVISFSQCVGAERDSLVFLANHLGASVQEFFVRKANAKKGMLA
FT                   STHLIVKEPTGSKYEAAKKWSLPAVNISWLLETARIGKRADENHFLVDNAPKQEQVLET
FT                   KIPNGVSSNPDLPAHPDAHLEIHRKKAVTPLDMNRFQSRAFRAVISQQRGQDPTFPPVR
FT                   QPLTKEPSLHLDTPSKFLSKDKLFKPSFDVTDALAALETPNAASQKRKLSSPLSEVIVR
FT                   NLTVALANSSRNTDSHSASPQLKGAHLEEEETRKPLDSVVVCVSKKLSKKQSELNGVAA
FT                   SLGAEYRWSFDETVTHFIYQGRANDSNREYKSAKERGVHIVSEHWLLECAQEYKHLPES
FT                   LYPHTYNPKMSLDINTVQDGRLCNSRAPLAVSASKDDGPDHLSVEGNETNTMGTNDKES
FT                   PLLNGSGRDDCKGALTQALEMRENFQKQLQEIMSATCIVKTPAQKTCMSRSSCNSASST
FT                   PDSARSVRSGRSRVLEALRQSRQAVPDVNTEPSQNEQIIWDDPTAREERARLASNLQWP
FT                   SDPTQHSELQVEIKMPDDSPSRKPVYHSEIAEQASCVTQAPGHPGSEEPEPPVAERPLI
FT                   PEPQAPAVASPLAKPPVAPQPADKIETQEETHRKVKKQYVFQMSSLNSQERIDYCRLIK
FT                   DLGGSVIEKQCSDPSCTHMVVGYPLRNEKYLASMAAGKWVLHRSYLDACKTAGRFVQEE
FT                   DYEWGSSSILDALPDVTEHQQKLALAAMRWRKRIQQSQESGIVEGAFSGWKAILRVDRP
FT                   REAGFKRLLQAGGAKVLSGHPEPLLKDATHLFCDFNKLKPDDCRVFIAEATAQNMVCLK
FT                   TEYIADYLMLESPPCADNYRVSEAALFHNKKGGPGLPQKRKTPAENVVKRPRVH"
FT   assembly_gap    14049793..14049812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14067871..14080348)
FT                   /gene="Cdv3"
FT                   /locus_tag="mCG_115601"
FT                   /note="gene_id=mCG115601.0"
FT   mRNA            complement(join(14067871..14070082,14071049..14071208,
FT                   14074641..14074783,14078743..14078819,14079818..14080348))
FT                   /gene="Cdv3"
FT                   /locus_tag="mCG_115601"
FT                   /product="carnitine deficiency-associated gene expressed in
FT                   ventricle 3, transcript variant mCT116709"
FT                   /note="gene_id=mCG115601.0 transcript_id=mCT116709.1
FT                   created on 02-AUG-2002"
FT   mRNA            complement(join(14067877..14070798,14071049..14071208,
FT                   14074641..14074783,14078743..14078819,14079818..14080348))
FT                   /gene="Cdv3"
FT                   /locus_tag="mCG_115601"
FT                   /product="carnitine deficiency-associated gene expressed in
FT                   ventricle 3, transcript variant mCT171371"
FT                   /note="gene_id=mCG115601.0 transcript_id=mCT171371.0
FT                   created on 02-AUG-2002"
FT   CDS             complement(join(14069932..14070082,14071049..14071208,
FT                   14074641..14074783,14078743..14078819,14079818..14080045))
FT                   /codon_start=1
FT                   /gene="Cdv3"
FT                   /locus_tag="mCG_115601"
FT                   /product="carnitine deficiency-associated gene expressed in
FT                   ventricle 3, isoform CRA_a"
FT                   /note="gene_id=mCG115601.0 transcript_id=mCT116709.1
FT                   protein_id=mCP68833.1 isoform=CRA_a"
FT                   /protein_id="EDL21069.1"
FT                   /translation="MAETEERSLDNFFAKRDKKKKKERSSRAANAASGAGGSSAAAGSR
FT                   PGDGGSLGSGARSGDGGSLGSGSRSGDGGSSDENEWKEFEQREVDYSGLRVQAMQISEK
FT                   EDDDNEKREDPGDNWEEGGGGSGAEKSSGPWNKTAPVQAPPAPVTVTETPEPAMPSGVY
FT                   RPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRKDKEMEKSFEVVRHKNRDRE
FT                   EVSKNQALKLQLDNQYAVLENQKYSHTQYS"
FT   CDS             complement(join(14070783..14070798,14071049..14071208,
FT                   14074641..14074783,14078743..14078819,14079818..14080045))
FT                   /codon_start=1
FT                   /gene="Cdv3"
FT                   /locus_tag="mCG_115601"
FT                   /product="carnitine deficiency-associated gene expressed in
FT                   ventricle 3, isoform CRA_b"
FT                   /note="gene_id=mCG115601.0 transcript_id=mCT171371.0
FT                   protein_id=mCP94290.0 isoform=CRA_b"
FT                   /protein_id="EDL21070.1"
FT                   /translation="MAETEERSLDNFFAKRDKKKKKERSSRAANAASGAGGSSAAAGSR
FT                   PGDGGSLGSGARSGDGGSLGSGSRSGDGGSSDENEWKEFEQREVDYSGLRVQAMQISEK
FT                   EDDDNEKREDPGDNWEEGGGGSGAEKSSGPWNKTAPVQAPPAPVTVTETPEPAMPSGVY
FT                   RPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRNRYLK"
FT   assembly_gap    14079363..14079817
FT                   /estimated_length=455
FT                   /gap_type="unknown"
FT   assembly_gap    14080370..14080389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14083928..14084208
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    14087981..14088207
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   gene            14095796..14115289
FT                   /locus_tag="mCG_1032900"
FT                   /note="gene_id=mCG1032900.0"
FT   mRNA            join(14095796..14095894,14114938..14115289)
FT                   /locus_tag="mCG_1032900"
FT                   /product="mCG1032900"
FT                   /note="gene_id=mCG1032900.0 transcript_id=mCT150604.1
FT                   created on 02-AUG-2002"
FT   assembly_gap    14096464..14097010
FT                   /estimated_length=547
FT                   /gap_type="unknown"
FT   assembly_gap    14105749..14105805
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    14108956..14109098
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    14114222..14114937
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   CDS             14114969..14115193
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032900"
FT                   /product="mCG1032900"
FT                   /note="gene_id=mCG1032900.0 transcript_id=mCT150604.1
FT                   protein_id=mCP68897.1"
FT                   /protein_id="EDL21071.1"
FT                   /translation="MKAFPSQKRELYPRSNSYPRSPLHPGQAKPCPCHGGRLKAKSVGA
FT                   QPFHLYNGAAQGYLVDFCLQSWCKDLSLK"
FT   assembly_gap    14116715..14116734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14122840..14122859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14126256..14126336
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   gene            complement(14127103..14137933)
FT                   /locus_tag="mCG_1032901"
FT                   /note="gene_id=mCG1032901.1"
FT   mRNA            complement(join(14127103..14127700,14137860..14137933))
FT                   /locus_tag="mCG_1032901"
FT                   /product="mCG1032901"
FT                   /note="gene_id=mCG1032901.1 transcript_id=mCT150605.1
FT                   created on 02-AUG-2002"
FT   CDS             complement(14127207..14127641)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032901"
FT                   /product="mCG1032901"
FT                   /note="gene_id=mCG1032901.1 transcript_id=mCT150605.1
FT                   protein_id=mCP68503.1"
FT                   /protein_id="EDL21072.1"
FT                   /translation="MRKTVPFSTLSTCGCVSAKARREKRELFPEAPPLDDQGSHPGSLW
FT                   CQVALEELHLCVFSGNEFSCQLHKPRGGSQCSTPLGTLLTARAMYSTPASLLLETAPAP
FT                   EVLVDRKSIVCRSASQWLRGKEKTKHSVQECKCGKKNIYI"
FT   gene            complement(14139643..14195935)
FT                   /gene="Bfsp2"
FT                   /locus_tag="mCG_16146"
FT                   /note="gene_id=mCG16146.2"
FT   mRNA            complement(join(14139643..14139865,14141278..14141498,
FT                   14147557..14147688,14163502..14163663,14164746..14164902,
FT                   14168010..14168092,14195251..14195935))
FT                   /gene="Bfsp2"
FT                   /locus_tag="mCG_16146"
FT                   /product="beaded filament structural protein 2, phakinin,
FT                   transcript variant mCT15890"
FT                   /note="gene_id=mCG16146.2 transcript_id=mCT15890.2 created
FT                   on 02-AUG-2002"
FT   mRNA            complement(join(14139643..14139865,14141278..14141498,
FT                   14147557..14147688,14163502..14163663,14164002..14164037))
FT                   /gene="Bfsp2"
FT                   /locus_tag="mCG_16146"
FT                   /product="beaded filament structural protein 2, phakinin,
FT                   transcript variant mCT171384"
FT                   /note="gene_id=mCG16146.2 transcript_id=mCT171384.0 created
FT                   on 02-AUG-2002"
FT   CDS             complement(join(14139862..14139865,14141278..14141498,
FT                   14147557..14147688,14163502..14163663,14164746..14164902,
FT                   14168010..14168092,14195251..14195868))
FT                   /codon_start=1
FT                   /gene="Bfsp2"
FT                   /locus_tag="mCG_16146"
FT                   /product="beaded filament structural protein 2, phakinin,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16146.2 transcript_id=mCT15890.2
FT                   protein_id=mCP21391.2 isoform=CRA_a"
FT                   /protein_id="EDL21073.1"
FT                   /translation="MEGSRQRTRDREASREAHDQAGAGNQKPLDPVNLPGTTEAERMSK
FT                   RRVAADLPSGTNSSMPVQRHRVSSLRGTHSPSSLDSPPASRTSAVGSLVRAPGVYVGVA
FT                   PSGGIGGLGARVTRRALGISSVFLQGLRSSGLANVPAPGPERDHTTVEDLGGCLVEYMT
FT                   KVHALEQVSQELETQLRAHLESKAKSSGGWDALRASWASSYQQVGEAVLENARLLLQME
FT                   TIQAGADDFKERYENEQPFRKAAEEEVSSLYKVIDEANLTKTDLEHQIESLKEELGFLS
FT                   RSYEEDVKVLYKQLAGSELEQADVPMGTGLDDVLETIRVQWERDVEKNRAEAGALLQAK
FT                   QQTEVVHVSQTQEEKLAAALSVELHDTSRQVQSLQAETESLRALKRGLENSLHDAQHWH
FT                   DMELQNLGAVVGRLEAELAEIRSETEQQQQERAHLLACKSQLQKDVASYHALLDREENN
FT                   "
FT   CDS             complement(join(14139862..14139865,14141278..14141498,
FT                   14147557..14147688,14163502..14163603))
FT                   /codon_start=1
FT                   /gene="Bfsp2"
FT                   /locus_tag="mCG_16146"
FT                   /product="beaded filament structural protein 2, phakinin,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16146.2 transcript_id=mCT171384.0
FT                   protein_id=mCP94303.0 isoform=CRA_b"
FT                   /protein_id="EDL21074.1"
FT                   /translation="MGTGLDDVLETIRVQWERDVEKNRAEAGALLQAKQQTEVVHVSQT
FT                   QEEKLAAALSVELHDTSRQVQSLQAETESLRALKRGLENSLHDAQHWHDMELQNLGAVV
FT                   GRLEAELAEIRSETEQQQQERAHLLACKSQLQKDVASYHALLDREENN"
FT   gene            <14141393..14176217
FT                   /locus_tag="mCG_145984"
FT                   /note="gene_id=mCG145984.0"
FT   mRNA            join(<14141393..14141536,14141871..14142107,
FT                   14142419..14142517,14143128..14143236,14174776..14176217)
FT                   /locus_tag="mCG_145984"
FT                   /product="mCG145984"
FT                   /note="gene_id=mCG145984.0 transcript_id=mCT186092.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<14141879..14142107,14142419..14142517,
FT                   14143128..14143171)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145984"
FT                   /product="mCG145984"
FT                   /note="gene_id=mCG145984.0 transcript_id=mCT186092.0
FT                   protein_id=mCP107616.0"
FT                   /protein_id="EDL21075.1"
FT                   /translation="LSDHDSCIGTSGADVYVGYGCFGWGSWEKMHPRLPFLSSRPWMDR
FT                   VPAFTPPVKLSHPHCLFSPNTVAWDWMFITQDRVSLYSSGHLLCRPDWLRTHRAPSACQ
FT                   AAGMKEAHRGQKRHWNPWN"
FT   assembly_gap    14144708..14144884
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    14147958..14147977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14177315..14177366
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   gene            14187605..>14208545
FT                   /locus_tag="mCG_1051020"
FT                   /note="gene_id=mCG1051020.0"
FT   mRNA            join(14187605..14187687,14188264..14188467,
FT                   14207715..14207878,14208141..>14208545)
FT                   /locus_tag="mCG_1051020"
FT                   /product="mCG1051020"
FT                   /note="gene_id=mCG1051020.0 transcript_id=mCT194809.0
FT                   created on 27-JAN-2005"
FT   gene            complement(14198452..>14223039)
FT                   /locus_tag="mCG_16148"
FT                   /note="gene_id=mCG16148.2"
FT   mRNA            complement(join(14198452..14200299,14204804..14204958,
FT                   14214626..14214837,14215181..14216176,14222982..>14223039))
FT                   /locus_tag="mCG_16148"
FT                   /product="mCG16148"
FT                   /note="gene_id=mCG16148.2 transcript_id=mCT15892.2 created
FT                   on 02-AUG-2002"
FT   assembly_gap    14201928..14202112
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   CDS             14208470..>14208545
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051020"
FT                   /product="mCG1051020"
FT                   /note="gene_id=mCG1051020.0 transcript_id=mCT194809.0
FT                   protein_id=mCP115838.0"
FT                   /protein_id="EDL21076.1"
FT                   /translation="MRSLLGSLYSSRLPPTQQKHADVVP"
FT   assembly_gap    14214863..14215178
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   CDS             complement(join(14215548..14216176,14222982..14223039))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16148"
FT                   /product="mCG16148"
FT                   /note="gene_id=mCG16148.2 transcript_id=mCT15892.2
FT                   protein_id=mCP21221.2"
FT                   /protein_id="EDL21077.1"
FT                   /translation="MDLSPAVEPVISGHFWNPPGFLLTLALTKALVLAVHEPSPRESLQ
FT                   TLPSGSPPGTMVTAPHSPTRLSSVLTLNPTPDGPSSQAAATLETTVSHPEGHPPTDTTS
FT                   TVMGTAAVPHPESPLPTGSPPAAMTTTPSHSESLPPGGCYPHHYPANKASRNHQPPHSG
FT                   PTGHHSSAPQTPGLFQEGGWWFDSHSHTRTGWPLGQEGKPEGTKPELSTSGAEASSGED
FT                   LPNLQG"
FT   gene            14237723..>14259191
FT                   /locus_tag="mCG_1032902"
FT                   /note="gene_id=mCG1032902.1"
FT   mRNA            join(14237723..14238033,14256839..14256950,
FT                   14258998..>14259191)
FT                   /locus_tag="mCG_1032902"
FT                   /product="mCG1032902"
FT                   /note="gene_id=mCG1032902.1 transcript_id=mCT150606.1
FT                   created on 02-AUG-2002"
FT   assembly_gap    14246661..14246680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14249875..14252251
FT                   /estimated_length=2377
FT                   /gap_type="unknown"
FT   CDS             14259064..>14259191
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032902"
FT                   /product="mCG1032902"
FT                   /note="gene_id=mCG1032902.1 transcript_id=mCT150606.1
FT                   protein_id=mCP68505.1"
FT                   /protein_id="EDL21078.1"
FT                   /translation="MRLLGGSCDPGRGREGEGCGDSCFQLDWLIKSVFGSYQRTKHR"
FT   gene            14272361..14279077
FT                   /locus_tag="mCG_1032760"
FT                   /note="gene_id=mCG1032760.1"
FT   mRNA            join(14272361..14272695,14275554..14275632,
FT                   14278798..14279077)
FT                   /locus_tag="mCG_1032760"
FT                   /product="mCG1032760"
FT                   /note="gene_id=mCG1032760.1 transcript_id=mCT150464.1
FT                   created on 02-AUG-2002"
FT   CDS             join(14272588..14272695,14275554..14275632,
FT                   14278798..14278847)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032760"
FT                   /product="mCG1032760"
FT                   /note="gene_id=mCG1032760.1 transcript_id=mCT150464.1
FT                   protein_id=mCP68507.1"
FT                   /protein_id="EDL21079.1"
FT                   /translation="MESLEVRKEYMNWHWEPSTAYPKLRAPENPLFSKFMAASSGKDLV
FT                   SILLLFLQQKSVHHLWRTIASHWNGSTHQLHKT"
FT   assembly_gap    14296682..14298048
FT                   /estimated_length=1367
FT                   /gap_type="unknown"
FT   assembly_gap    14299678..14299697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14300518..14300934
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   assembly_gap    14302044..14302063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14303138..14303157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14304281..14304300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14308855..14310904
FT                   /estimated_length=2050
FT                   /gap_type="unknown"
FT   assembly_gap    14323877..14324542
FT                   /estimated_length=666
FT                   /gap_type="unknown"
FT   assembly_gap    14359654..14359673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14363796..14363815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14367979..14368311
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    14370415..14370434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14372526..14373105
FT                   /estimated_length=580
FT                   /gap_type="unknown"
FT   assembly_gap    14443082..14443101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14450500..14450519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14470267..14477955)
FT                   /locus_tag="mCG_56775"
FT                   /note="gene_id=mCG56775.2"
FT   mRNA            complement(join(14470267..14471188,14477919..14477955))
FT                   /locus_tag="mCG_56775"
FT                   /product="mCG56775"
FT                   /note="gene_id=mCG56775.2 transcript_id=mCT56958.2 created
FT                   on 02-AUG-2002"
FT   CDS             complement(14470992..14471129)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56775"
FT                   /product="mCG56775"
FT                   /note="gene_id=mCG56775.2 transcript_id=mCT56958.2
FT                   protein_id=mCP41333.2"
FT                   /protein_id="EDL21080.1"
FT                   /translation="MGCEDVRSSEGFHTLSSRVRQMRSVSLASLSHRCSCLSRVLELVQ
FT                   "
FT   assembly_gap    14474926..14476035
FT                   /estimated_length=1110
FT                   /gap_type="unknown"
FT   assembly_gap    14505291..14505310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14514745..14514764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14516712..14518391
FT                   /estimated_length=1680
FT                   /gap_type="unknown"
FT   assembly_gap    14566820..14566943
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    14568534..14568618
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    14575419..14575463
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    14603844..14603863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14604371..14604756
FT                   /pseudo
FT                   /locus_tag="mCG_1032776"
FT                   /note="gene_id=mCG1032776.1"
FT   mRNA            14604371..14604756
FT                   /pseudo
FT                   /locus_tag="mCG_1032776"
FT                   /note="gene_id=mCG1032776.1 transcript_id=mCT150480.1
FT                   created on 02-AUG-2002"
FT   assembly_gap    14658418..14658437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14681696..14681715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14682986..14683054
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    14689558..14689615
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    14699827..14699847
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    14713163..14713182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14716371..14717049
FT                   /estimated_length=679
FT                   /gap_type="unknown"
FT   gene            14719058..14733280
FT                   /locus_tag="mCG_140767"
FT                   /note="gene_id=mCG140767.0"
FT   mRNA            join(14719058..14719673,14721226..14721351,
FT                   14721969..14722119,14724632..14724784,14728112..14728199,
FT                   14731764..14731920,14732517..14732638,14732837..14733280)
FT                   /locus_tag="mCG_140767"
FT                   /product="mCG140767"
FT                   /note="gene_id=mCG140767.0 transcript_id=mCT171367.0
FT                   created on 02-AUG-2002"
FT   CDS             join(14719293..14719673,14721226..14721351,
FT                   14721969..14722119,14724632..14724784,14728112..14728199,
FT                   14731764..14731920,14732517..14732638,14732837..14732840)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140767"
FT                   /product="mCG140767"
FT                   /note="gene_id=mCG140767.0 transcript_id=mCT171367.0
FT                   protein_id=mCP94286.0"
FT                   /protein_id="EDL21081.1"
FT                   /translation="MGTASSLVSPTGGEVIEDTYGAGGGEACEIPVEVKPKARLLRSSF
FT                   RRGAGAGPGSLPRAAGGGGLLGASFKSTGSSVPELEYAAAEFERLKKEYEIFRVSKNQE
FT                   LLSMGRREAKLDTENKRLRAELQALQKTYQKILREKEGALEAKYQAMERAVTFEHDRDR
FT                   VKRQFKIFRETKENEIQDLLRAKRELESKLQRLQAQGIQVFDPGESDSDDNCTDVTAAG
FT                   TQCEYWASRALGSEHSIGSMIQLPQPFRGPEFAHSSIDVEGPFANINRDVENQYLTVRK
FT                   WEIEKSSLVILFLHSTLPSFLLEDCEEAFLQNPEGKPGLIYHRLEDGKVTCDSVQQFLD
FT                   QVSNLGKTTKAKIIEHSGDPAEGVCKIYVGVEKIIKQVNMRFSVKFSSKIASW"
FT   gene            14734730..>14740220
FT                   /locus_tag="mCG_115611"
FT                   /note="gene_id=mCG115611.1"
FT   mRNA            join(14734730..14734903,14737416..14737519,
FT                   14737941..14738055,14739298..14739441,14740056..>14740220)
FT                   /locus_tag="mCG_115611"
FT                   /product="mCG115611"
FT                   /note="gene_id=mCG115611.1 transcript_id=mCT116719.1
FT                   created on 02-AUG-2002"
FT   CDS             join(14734850..14734903,14737416..14737519,
FT                   14737941..14738055,14739298..14739441,14740056..14740220)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115611"
FT                   /product="mCG115611"
FT                   /note="gene_id=mCG115611.1 transcript_id=mCT116719.1
FT                   protein_id=mCP68702.1"
FT                   /protein_id="EDL21082.1"
FT                   /translation="MEAFQQASSSAHELGFEKYYQRLDDLVVAPAPIPPLLVSGGPGSG
FT                   KSLLLSKWIQLQQKHFPNTLILSHFVGRPMSTSSESSLIIKRLTLKLMQHFWAVSALTL
FT                   DPAKLLEEFPHWLEKLSARHQGSIIIIIDSIDQVQQVEKHMKWLIDPLPVNVRVIVSVN
FT                   VETCPTAWRYGQIQKFQNRSCFTGQARKGS"
FT   assembly_gap    14736411..14736526
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   gene            14746609..14760554
FT                   /locus_tag="mCG_16149"
FT                   /note="gene_id=mCG16149.2"
FT   mRNA            join(14746609..14746703,14748595..14748759,
FT                   14750027..14750121,14751074..14751196,14752402..14752588,
FT                   14752735..14752976,14754058..14754133,14755161..14755288,
FT                   14756060..14756300,14757348..14757473,14757865..14757980,
FT                   14758677..14760554)
FT                   /locus_tag="mCG_16149"
FT                   /product="mCG16149"
FT                   /note="gene_id=mCG16149.2 transcript_id=mCT15893.2 created
FT                   on 02-AUG-2002"
FT   CDS             join(14746668..14746703,14748595..14748759,
FT                   14750027..14750121,14751074..14751196,14752402..14752588,
FT                   14752735..14752976,14754058..14754133,14755161..14755288,
FT                   14756060..14756300,14757348..14757473,14757865..14757980,
FT                   14758677..14758857)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16149"
FT                   /product="mCG16149"
FT                   /note="gene_id=mCG16149.2 transcript_id=mCT15893.2
FT                   protein_id=mCP21253.2"
FT                   /protein_id="EDL21083.1"
FT                   /translation="MPSDRDKEWMTQILCLINVSHNGVSESELMELYPEMSWLSLTSII
FT                   HSLHKMHLLTYSCGLLRFQHLQAWETVRLQYLEDPALVSSYREKLISYFTSQLSQDRVT
FT                   WRSADELPWLFQQQGSKQKLHSCLLNLLVAQNLYKRGHFAELLSYWQFVGKDKGAMATE
FT                   YFESLKQYENSEGEENMLCLADLYETLGRFLKDLGLLSQAVVPLQRSLEIRETALDPDH
FT                   PRVAQSLHQLAGVYVQWKKFGDAEQLYKQALEISENAYGADHPHAARELEALATLYHKQ
FT                   NKYEQAEHFRKKSVIIRQQATRRKGSLYGFALLRRRALQLEELTLGKDKPENARTLNEL
FT                   GVLYFLQNNLETAEQFLKRSLEMRERVLGPDHPDCAQSLNNLAALCNEKKQYEKAEELY
FT                   ERALDIRRRALAPDHPSLAYTVKHLAILYKKTGKVDKAVPLYELAVEIRQKSFGPKHPS
FT                   VATALVNLAVLHSQMKKHSEALPLYERALKIYEDSLGRMHPRVGETLKNLAVLSYEEGN
FT                   FEKAAELYKRAMEIKEAETSLLGGKAPSRQSSSGDTFLFKTTHSPNVFLPQGQS"
FT   gene            14762469..14763096
FT                   /pseudo
FT                   /locus_tag="mCG_1032802"
FT                   /note="gene_id=mCG1032802.1"
FT   mRNA            14762469..14763096
FT                   /pseudo
FT                   /locus_tag="mCG_1032802"
FT                   /note="gene_id=mCG1032802.1 transcript_id=mCT150506.1
FT                   created on 02-AUG-2002"
FT   gene            complement(14763354..14779633)
FT                   /gene="Ube1dc1"
FT                   /locus_tag="mCG_16152"
FT                   /note="gene_id=mCG16152.2"
FT   mRNA            complement(join(14763354..14764435,14765983..14766089,
FT                   14766272..14766350,14766584..14766719,14770620..14770747,
FT                   14770911..14771015,14771747..14771831,14772360..14772446,
FT                   14773431..14773540,14776748..14776837,14776924..14776969,
FT                   14779321..14779633))
FT                   /gene="Ube1dc1"
FT                   /locus_tag="mCG_16152"
FT                   /product="ubiquitin-activating enzyme E1-domain containing
FT                   1"
FT                   /note="gene_id=mCG16152.2 transcript_id=mCT16041.2 created
FT                   on 02-AUG-2002"
FT   CDS             complement(join(14764352..14764435,14765983..14766089,
FT                   14766272..14766350,14766584..14766719,14770620..14770747,
FT                   14770911..14771015,14771747..14771831,14772360..14772446,
FT                   14773431..14773540,14776748..14776837,14776924..14776969,
FT                   14779321..14779475))
FT                   /codon_start=1
FT                   /gene="Ube1dc1"
FT                   /locus_tag="mCG_16152"
FT                   /product="ubiquitin-activating enzyme E1-domain containing
FT                   1"
FT                   /note="gene_id=mCG16152.2 transcript_id=mCT16041.2
FT                   protein_id=mCP21390.2"
FT                   /db_xref="GOA:Q8VE47"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="MGI:MGI:1913913"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VE47"
FT                   /protein_id="EDL21084.1"
FT                   /translation="MADSVERLRQRVEELEQELARERTRRSGGDGHCGRTRIQEMSDEV
FT                   LDSNPYSRLMALKRMGIVSDYKKIRTYAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYD
FT                   KVELANMNRLFFQPYQAGLSKVHAAEHTLRNINPDVLFEVHNYNITTVEHFEHFMNRIS
FT                   NGGLEEGQPVDLVLSCVDNFEARMAINTACNELGQTWMESGVSENAVSGHIQLMIPGES
FT                   ACFACAPPLVVASNIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLKFGTVSFYL
FT                   GYNAMQDFFPTMFMKPNPQCDDKNCRKQQEEYKKRAAALPTQEAEPQEEAEVVHEDNEW
FT                   GIELVSEVSEEELKNSSGPVPTLPEGITVAYTVPKKTEDSASEVTVEDSGESLEDLMAR
FT                   MKNM"
FT   gene            14780263..14844459
FT                   /gene="Acad11"
FT                   /locus_tag="mCG_16154"
FT                   /note="gene_id=mCG16154.2"
FT   mRNA            join(14780263..14780433,14790185..14790284,
FT                   14792377..14792502,14792890..14793051,14795125..14795289,
FT                   14797789..14797930,14798256..14798377,14799349..14799455,
FT                   14800719..14800845,14806824..14806901,14808247..14808385,
FT                   14812162..14812269,14813995..14814093,14830124..14830190,
FT                   14831049..14831134,14831874..14831945,14832757..14832911,
FT                   14839628..14839744,14840831..14840940,14843396..14844459)
FT                   /gene="Acad11"
FT                   /locus_tag="mCG_16154"
FT                   /product="acyl-Coenzyme A dehydrogenase family, member 11"
FT                   /note="gene_id=mCG16154.2 transcript_id=mCT16042.2 created
FT                   on 02-AUG-2002"
FT   CDS             join(14780291..14780433,14790185..14790284,
FT                   14792377..14792502,14792890..14793051,14795125..14795289,
FT                   14797789..14797930,14798256..14798377,14799349..14799455,
FT                   14800719..14800845,14806824..14806901,14808247..14808385,
FT                   14812162..14812269,14813995..14814093,14830124..14830190,
FT                   14831049..14831134,14831874..14831945,14832757..14832911,
FT                   14839628..14839744,14840831..14840940,14843396..14843510)
FT                   /codon_start=1
FT                   /gene="Acad11"
FT                   /locus_tag="mCG_16154"
FT                   /product="acyl-Coenzyme A dehydrogenase family, member 11"
FT                   /note="gene_id=mCG16154.2 transcript_id=mCT16042.2
FT                   protein_id=mCP21236.2"
FT                   /protein_id="EDL21085.1"
FT                   /translation="METDVTSDTVEVLPQHKFDLRSLEAYLNQHLPGFGSDSRAVLTVT
FT                   QYRSGQSNPTFFLQKGSQAYVLRKKPPGSLLPKAHKIDREFKIQKALFSIGFPVAKPLL
FT                   YCRDASVIGTEFYVMEHVQGRIFRDFSIPGVSSAERAAIYVSVAETLAWLHSLDIRSLK
FT                   LDKYGTGVGYCKRQVSTWTKQYQASAHQSIPAMDQLSTWLMKNLPDSDSEECLVHGDFK
FT                   LDNIVFHPKECRVIAVLDWELSTFGHPLTDLAHLSLFYYWPRTLPMINRGSHIPENTGI
FT                   PLMEELISIYCHRRGIDPNLPNWNFFMALSFFKLAGISQGVYRRYLMGNNSSEDSFLTA
FT                   NTVQPLAETGLQLSKRTLRTTPPQADAKSQLFAQSRRGQEVLTRVKQFMKQHVFPAEKE
FT                   VAEYYAQSGNSAEKWGHPLVIEKLKEMAKAEGLWNLFLPAVSGLSQVDYALIAEETGKC
FT                   FFAPDVFNCQAPDTGNMEVLHLYGSEQQKKQWLEPLLRGDITSVFCMTEPNVSSSDATN
FT                   IECTIQRDGGGYIVNGKKWWSSGAGNPKCKIAIVLGRMESPSASRHRQHSMILVPMDTP
FT                   GVELIRPLSVFGYMDNMHGGHWEVHFNHVRVPASNLILGEGRGFEISQGRLGPGRIHHC
FT                   MRTVGLAERILQIMCDRAVQREAFKKKLYEHEVVAHWIAKSRIAIEEIRLLTLKAAHSI
FT                   DTLGSASARKEIAMIKVAAPKAVCKIADWAIQVHGGAGVSQDYPLANMYAIIRTLRLAD
FT                   GPDEVHLSAIAKMELQDQARRLTARM"
FT   assembly_gap    14807538..14807689
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            complement(14814784..14843747)
FT                   /gene="Ccrl1"
FT                   /locus_tag="mCG_52492"
FT                   /note="gene_id=mCG52492.2"
FT   mRNA            complement(join(14814784..14816414,14818939..14819204,
FT                   14843233..14843747))
FT                   /gene="Ccrl1"
FT                   /locus_tag="mCG_52492"
FT                   /product="chemokine (C-C motif) receptor-like 1, transcript
FT                   variant mCT171389"
FT                   /note="gene_id=mCG52492.2 transcript_id=mCT171389.0 created
FT                   on 02-AUG-2002"
FT   mRNA            complement(join(14814784..14816414,14818939..14819681))
FT                   /gene="Ccrl1"
FT                   /locus_tag="mCG_52492"
FT                   /product="chemokine (C-C motif) receptor-like 1, transcript
FT                   variant mCT52675"
FT                   /note="gene_id=mCG52492.2 transcript_id=mCT52675.2 created
FT                   on 02-AUG-2002"
FT   CDS             complement(14815353..14816405)
FT                   /codon_start=1
FT                   /gene="Ccrl1"
FT                   /locus_tag="mCG_52492"
FT                   /product="chemokine (C-C motif) receptor-like 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG52492.2 transcript_id=mCT171389.0
FT                   protein_id=mCP94308.0 isoform=CRA_a"
FT                   /protein_id="EDL21086.1"
FT                   /translation="MALELNQSAEYYYEENEMNYTHDYSQYEVICIKEEVRQFAKVFLP
FT                   AFFTVAFVTGLAGNSVVVAIYAYYKKQRTKTDVYILNLAVADLLLLITLPFWAVNAVHG
FT                   WILGKMMCKVTSALYTVNFVSGMQFLACISIDRYWAITKAPSQSGAGRPCWIICCCVWM
FT                   AAILLSIPQLVFYTVNQNARCTPIFPHHLGTSLKASIQMLEIGIGFVVPFLIMGVCYAS
FT                   TARALIKMPNIKKSRPLRVLLAVVVVFIVTQLPYNVVKFCQAIDAIYLLITSCDMSKRM
FT                   DVAIQVTESIALFHSCLNPILYVFMGASFKNYIMKVAKKYGSWRRQRQNVEEIPFDSEG
FT                   PTEPTSSFTI"
FT   CDS             complement(14815353..14816405)
FT                   /codon_start=1
FT                   /gene="Ccrl1"
FT                   /locus_tag="mCG_52492"
FT                   /product="chemokine (C-C motif) receptor-like 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG52492.2 transcript_id=mCT52675.2
FT                   protein_id=mCP41394.2 isoform=CRA_a"
FT                   /protein_id="EDL21087.1"
FT                   /translation="MALELNQSAEYYYEENEMNYTHDYSQYEVICIKEEVRQFAKVFLP
FT                   AFFTVAFVTGLAGNSVVVAIYAYYKKQRTKTDVYILNLAVADLLLLITLPFWAVNAVHG
FT                   WILGKMMCKVTSALYTVNFVSGMQFLACISIDRYWAITKAPSQSGAGRPCWIICCCVWM
FT                   AAILLSIPQLVFYTVNQNARCTPIFPHHLGTSLKASIQMLEIGIGFVVPFLIMGVCYAS
FT                   TARALIKMPNIKKSRPLRVLLAVVVVFIVTQLPYNVVKFCQAIDAIYLLITSCDMSKRM
FT                   DVAIQVTESIALFHSCLNPILYVFMGASFKNYIMKVAKKYGSWRRQRQNVEEIPFDSEG
FT                   PTEPTSSFTI"
FT   assembly_gap    14830578..14830597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14867991..14978919)
FT                   /locus_tag="mCG_115602"
FT                   /note="gene_id=mCG115602.1"
FT   mRNA            complement(join(14867991..14869132,14873523..14873622,
FT                   14877188..14877331,14878982..14879122,14879364..14879543,
FT                   14881665..14881838,14882222..14882264,14882399..14882568,
FT                   14883676..14883788,14884119..14884193,14887420..14887519,
FT                   14889226..14889317,14891054..14891231,14892353..14892469,
FT                   14893362..14893475,14895506..14895673,14896773..14896952,
FT                   14897703..14897822,14898732..14898806,14899209..14899393,
FT                   14901287..14901422,14903289..14903367,14904126..14904241,
FT                   14905624..14905825,14906901..14907055,14908686..14908731,
FT                   14909194..14909348,14912603..14912687,14913739..14913941,
FT                   14915210..14915314,14917016..14917117,14918467..14918529,
FT                   14919751..14919910,14919994..14920097,14924332..14924485,
FT                   14925884..14925966,14929369..14929512,14930425..14930520,
FT                   14930731..14930806,14932287..14932408,14934353..14934409,
FT                   14935168..14935323,14936512..14936619,14938041..14938140,
FT                   14944421..14944590,14944679..14944758,14944873..14945039,
FT                   14946008..14946099,14946639..14946734,14946829..14947035,
FT                   14949532..14949732,14953134..14953175,14953575..14953724,
FT                   14954463..14954538,14962759..14962841,14978737..14978919))
FT                   /locus_tag="mCG_115602"
FT                   /product="mCG115602"
FT                   /note="gene_id=mCG115602.1 transcript_id=mCT116710.1
FT                   created on 05-AUG-2002"
FT   CDS             complement(join(14869026..14869132,14873523..14873622,
FT                   14877188..14877331,14878982..14879122,14879364..14879543,
FT                   14881665..14881838,14882222..14882264,14882399..14882568,
FT                   14883676..14883788,14884119..14884193,14887420..14887519,
FT                   14889226..14889317,14891054..14891231,14892353..14892469,
FT                   14893362..14893475,14895506..14895673,14896773..14896952,
FT                   14897703..14897822,14898732..14898806,14899209..14899393,
FT                   14901287..14901422,14903289..14903367,14904126..14904241,
FT                   14905624..14905825,14906901..14907055,14908686..14908731,
FT                   14909194..14909348,14912603..14912687,14913739..14913941,
FT                   14915210..14915314,14917016..14917117,14918467..14918529,
FT                   14919751..14919910,14919994..14920097,14924332..14924485,
FT                   14925884..14925966,14929369..14929512,14930425..14930520,
FT                   14930731..14930806,14932287..14932408,14934353..14934409,
FT                   14935168..14935323,14936512..14936619,14938041..14938140,
FT                   14944421..14944590,14944679..14944758,14944873..14945039,
FT                   14946008..14946099,14946639..14946734,14946829..14947035,
FT                   14949532..14949732,14953134..14953175,14953575..14953724,
FT                   14954463..14954538,14962759..14962826))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115602"
FT                   /product="mCG115602"
FT                   /note="gene_id=mCG115602.1 transcript_id=mCT116710.1
FT                   protein_id=mCP68839.1"
FT                   /db_xref="GOA:G3X922"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="InterPro:IPR035445"
FT                   /db_xref="MGI:MGI:2676368"
FT                   /db_xref="UniProtKB/TrEMBL:G3X922"
FT                   /protein_id="EDL21088.1"
FT                   /translation="MNIIRENKDLACFYTTKHSWRGKYKRVFSVGTHAVTTYNPNTLEV
FT                   TNQWPYGDICSISPVGKGQGTEFNLTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDF
FT                   AEGKITGRRYNCYKHHWSDAKKPVVLEVTPGGFDQINPVTNRVLCSYDYRNIEGFVDLS
FT                   DYQGGFCILYGGFSRLHLFSSEQREEIIKSAIEHAGNYIGISLRIRKEPLEFEQYLNLR
FT                   FGKYSTDESITSLAEFVVQKISPRHSEPVKRVLAVTETCLVERDPATYNIATLKPLGEV
FT                   FALVCDSENPQLFTIEFIKGQVRKYSSTERDSLLASLLDGVRASGNRDVCVKMAPTHKG
FT                   QRWGLLSMPIDEEVESLHLRFLAAPPNGNFADAVFRFNANISYSGVLHAVTQDGLFSEN
FT                   KEKLINNAITALLSQEGDVVASNAELESQFQAVRRLVASKAGFLAFTQLPKFRERLGMK
FT                   VVKALKRSNNGVIHAAVDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNS
FT                   HVDHGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMA
FT                   IVKGAGLVMKAIIEEGDREIATKMQELALSEGALPRHLHTAMFTISSDQRMLTNRQLSR
FT                   HLVGLWTADNTTATNLLKRILPPGLLAYLDSSDPVPEKDADRMHVRDNVKIAMDQYGKF
FT                   NKVPEWQRLAGKAAKEVEKFAKEKVDLVLMHWRDRMGIAQKENINQKPVVLRKRRQRIK
FT                   IEANWDLFYYRFSQDHARSNLIWNFKTREELKDALESEMRTFNIDRELGSASVISWNHH
FT                   EFEVKYECLAEEIKIGDYYLRLLLEEDENEESGSIKRSYEFFNELYHRFLLTPKVNMKC
FT                   LCLQALAIVYGRCHEEIGPFTDTRYIIGMLERCTDKLERDRLILFLNKLILNKKNVKDL
FT                   MDSNGIRILVDLLTLAHLHVSRATVPLQSNVIEASPDMKRESEKEWYFGNADKERSGPY
FT                   GFHEMQELWAKGMLNAKTRCWAQGMDGWRPLQAIPQLKWCLLASGQAVLNETDLATLIL
FT                   NMLITMCGYFPSRDQDNAIIRPLPRVKRLLSDSTCLPHVIQLLLTFDPILVEKVAILLH
FT                   HIMQDNPQLPRLYLSGVFFFIMMYTGSNVLPVARFLKYTHSKQAFKSEETKGQDIFQRS
FT                   ILGHILPEAMVCYLENYEPEKFSEIFLGEFDTPEAIWSSEMRRLMIEKIAAHLADFTPR
FT                   LQSNTRALYQYCPIPVINYPQLENELFCNIYYLKQLCDTLRFPDWPIKDPVKLLKDSLD
FT                   AWKKEVEKKPPMMSIDDAYEVLNLPIGQGLHDESKIRKAYFRLAQKYHPDKNPEGRDMF
FT                   EKVNKAYEFLCTKSTKIVDGPDPENIILILKTQSILFNRHKEELQPYKYAGYPMLIRTI
FT                   TMETSDDLLFSKESPLLPAAAELAFHTVNCSALNAEELRRENGLEVLQEAFSRCVAVLN
FT                   RSSKPSDMSVQVCGHISRCYSVAAQFEECREKITEMPGIIKDLCRVLYFGKCIPRVAAL
FT                   AVECVSSFAVDFWLQTHLFQAGILWYLLVYLFNYDYTLEESGIQKNEETNQQEVANSLA
FT                   KLSVHALSRLGGYLSEDQATPENPTVRKSLAGMLTPYIARKLAVASATETLKMLNSNTE
FT                   SPYLMWNNSTRAELLEFLESQQENMIKKGDCDKTYGAEFVYSEHAKELIVGEIFVRVYN
FT                   EVPTFQLEVPKEFAASLLDYIGSQAQYLHTFMAITHAAKVESEQHGDRLPRVEMALEAL
FT                   RNVIKYNPGSESECIGHFKLIFSLLRVHGAGQVQQLALEVVNIVTSNQDCVNNIAESMV
FT                   LSNLLALLHSLPSSRQLVLETLYALASNTKIIKEAMAKGALIYLLDMFCNSTHPQVRSQ
FT                   TAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFEGTHENPELIWNDS
FT                   SRDKVSTTVREMMLEHFKNQRDNPDVNWKLPEDFAVVFGEAEGELAVGGVFLRIFIAQP
FT                   AWVLRKPREFLIALLEKLTELLEKNNPHGETLETLTMATVCLFSAQPQLADQVPPLGHL
FT                   PKVIQAMNHRNNAIPKSAIRVIHVLSDNELCVRAMASLETIGPLMNGMRKRADTVGLAC
FT                   EAINRMFQKEQSELVAQALKAELVPYLLKLLEGVGLENLDSPAATKAQIVKALKAMTRS
FT                   LQYGEQVSEILSRSSVWSAFKDQKHDLFISDSQTAGYLTGPGVAGYLTAGTSSSAMSNL
FT                   PPPVDHEAGDLGYQT"
FT   gene            complement(14885541..14886516)
FT                   /pseudo
FT                   /locus_tag="mCG_115606"
FT                   /note="gene_id=mCG115606.1"
FT   mRNA            complement(14885541..14886516)
FT                   /pseudo
FT                   /locus_tag="mCG_115606"
FT                   /note="gene_id=mCG115606.1 transcript_id=mCT116714.1
FT                   created on 05-AUG-2002"
FT   assembly_gap    14902938..14902957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14928961..14929142
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    14931599..14931807
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    14938843..14943660
FT                   /estimated_length=4818
FT                   /gap_type="unknown"
FT   assembly_gap    14978700..14978736
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            complement(15004224..>15053774)
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /note="gene_id=mCG14747.3"
FT   mRNA            complement(join(15004224..15007504,15016791..15016960,
FT                   15022881..15022984,15025410..15025492,15030304..15030436,
FT                   15032222..15032314,15035976..15036074,15040055..15040207,
FT                   15040646..15040732,15042842..15042937,15053587..>15053774))
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /product="acid phosphatase, prostate, transcript variant
FT                   mCT191535"
FT                   /note="gene_id=mCG14747.3 transcript_id=mCT191535.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(15004224..15007504,15016791..15016960,
FT                   15022881..15022984,15025410..15025492,15030304..15030436,
FT                   15032222..15032314,15035976..15036032,15040055..15040207,
FT                   15040646..15040732,15042842..15042937,15053587..15053751))
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /product="acid phosphatase, prostate, transcript variant
FT                   mCT170552"
FT                   /note="gene_id=mCG14747.3 transcript_id=mCT170552.0 created
FT                   on 11-JUL-2002"
FT   CDS             complement(join(15007386..15007504,15016791..15016960,
FT                   15022881..15022984,15025410..15025492,15030304..15030436,
FT                   15032222..15032314,15035976..15036074,15040055..15040207,
FT                   15040646..15040732,15042842..15042937,15053587..>15053772))
FT                   /codon_start=1
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /product="acid phosphatase, prostate, isoform CRA_b"
FT                   /note="gene_id=mCG14747.3 transcript_id=mCT191535.0
FT                   protein_id=mCP112474.0 isoform=CRA_b"
FT                   /protein_id="EDL21090.1"
FT                   /translation="TSLPKASEVQHLLRLPEAALSPTMGAVPLPLSPTASLSLGFLLLL
FT                   SLCLDPGQAKELKFVTLVFRHGDRGPIETFPTDPITESSWPQGFGQLTQWGMEQHYELG
FT                   SYIRKRYGRFLNDTYKHDQIYIRSTDVDRTLMSAMTNLAALFPPEGISIWNPRLLWQPI
FT                   PVHTVSLSEDRLLYLPFRDCPRFEELKSETLESEEFLKRLHPYKSFLDTLSSLSGFDDQ
FT                   DLFGIWSKVYDPLFCESVHNFTLPSWATEDAMIKLKELSELSLLSLYGIHKQKEKSRLQ
FT                   GGVLVNEILKNMKLATQPQKYKKLVMYSAHDTTVSGLQMALDVYNGVLPPYASCHMMEL
FT                   YHDKGGHFVEMYYRNETQNEPYPLTLPGCTHSCPLEKFAELLDPVISQDWATECMATSS
FT                   HQVLRVILATTFCLVTGILVILLLVLIRHGPCWQRDVYRNI"
FT   CDS             complement(join(15007386..15007504,15016791..15016960,
FT                   15022881..15022984,15025410..15025492,15030304..15030436,
FT                   15032222..15032314,15035976..15036032,15040055..15040207,
FT                   15040646..15040732,15042842..15042937,15053587..15053703))
FT                   /codon_start=1
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /product="acid phosphatase, prostate, isoform CRA_a"
FT                   /note="gene_id=mCG14747.3 transcript_id=mCT170552.0
FT                   protein_id=mCP93470.0 isoform=CRA_a"
FT                   /protein_id="EDL21089.1"
FT                   /translation="MGAVPLPLSPTASLSLGFLLLLSLCLDPGQAKELKFVTLVFRHGD
FT                   RGPIETFPTDPITESSWPQGFGQLTQWGMEQHYELGSYIRKRYGRFLNDTYKHDQIYIR
FT                   STDVDRTLMSAMTNLAALFPPEGISIWNPRLLWQPIPVHTVSLSEDRLKSETLESEEFL
FT                   KRLHPYKSFLDTLSSLSGFDDQDLFGIWSKVYDPLFCESVHNFTLPSWATEDAMIKLKE
FT                   LSELSLLSLYGIHKQKEKSRLQGGVLVNEILKNMKLATQPQKYKKLVMYSAHDTTVSGL
FT                   QMALDVYNGVLPPYASCHMMELYHDKGGHFVEMYYRNETQNEPYPLTLPGCTHSCPLEK
FT                   FAELLDPVISQDWATECMATSSHQVLRVILATTFCLVTGILVILLLVLIRHGPCWQRDV
FT                   YRNI"
FT   mRNA            complement(join(15014975..15016443,15016791..15016960,
FT                   15022881..15022984,15025410..15025492,15030304..15030436,
FT                   15032222..15032314,15035976..15036074,15040055..15040207,
FT                   15040646..15040732,15042842..15042937,15053587..15053751))
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /product="acid phosphatase, prostate, transcript variant
FT                   mCT19812"
FT                   /note="gene_id=mCG14747.3 transcript_id=mCT19812.2 created
FT                   on 11-JUL-2002"
FT   CDS             complement(join(15016433..15016443,15016791..15016960,
FT                   15022881..15022984,15025410..15025492,15030304..15030436,
FT                   15032222..15032314,15035976..15036074,15040055..15040207,
FT                   15040646..15040732,15042842..15042937,15053587..15053703))
FT                   /codon_start=1
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /product="acid phosphatase, prostate, isoform CRA_c"
FT                   /note="gene_id=mCG14747.3 transcript_id=mCT19812.2
FT                   protein_id=mCP21324.2 isoform=CRA_c"
FT                   /protein_id="EDL21091.1"
FT                   /translation="MGAVPLPLSPTASLSLGFLLLLSLCLDPGQAKELKFVTLVFRHGD
FT                   RGPIETFPTDPITESSWPQGFGQLTQWGMEQHYELGSYIRKRYGRFLNDTYKHDQIYIR
FT                   STDVDRTLMSAMTNLAALFPPEGISIWNPRLLWQPIPVHTVSLSEDRLLYLPFRDCPRF
FT                   EELKSETLESEEFLKRLHPYKSFLDTLSSLSGFDDQDLFGIWSKVYDPLFCESVHNFTL
FT                   PSWATEDAMIKLKELSELSLLSLYGIHKQKEKSRLQGGVLVNEILKNMKLATQPQKYKK
FT                   LVMYSAHDTTVSGLQMALDVYNGVLPPYASCHMMELYHDKGGHFVEMYYRNETQNEPYP
FT                   LTLPGCTHSCPLEKFAELLDPVISQDWATECMATSSHQGRN"
FT   assembly_gap    15020149..15020168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15026269..15026288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15051749..15051851
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    15060885..15060942
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    15066994..15070420
FT                   /estimated_length=3427
FT                   /gap_type="unknown"
FT   assembly_gap    15072892..15073049
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    15074671..15074780
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    15077459..15077954
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   assembly_gap    15103242..15103325
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    15103739..15103780
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    15119780..15120618
FT                   /estimated_length=839
FT                   /gap_type="unknown"
FT   assembly_gap    15126973..15126992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15146688..15146802
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    15158706..15159014
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    15160442..15160461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15170611..15170630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15196519..15196538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15199297..15199316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15200337..15200356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15202104..15203203
FT                   /estimated_length=1100
FT                   /gap_type="unknown"
FT   assembly_gap    15207190..15207209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15210353..15212067
FT                   /estimated_length=1715
FT                   /gap_type="unknown"
FT   gene            complement(15227119..15227560)
FT                   /pseudo
FT                   /locus_tag="mCG_14744"
FT                   /note="gene_id=mCG14744.2"
FT   mRNA            complement(15227119..15227560)
FT                   /pseudo
FT                   /locus_tag="mCG_14744"
FT                   /note="gene_id=mCG14744.2 transcript_id=mCT19809.2 created
FT                   on 05-AUG-2002"
FT   assembly_gap    15228940..15228959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15240816..15240873
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    15249151..15250372
FT                   /estimated_length=1222
FT                   /gap_type="unknown"
FT   assembly_gap    15256060..15256079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15276027..15781786
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /note="gene_id=mCG14749.2"
FT   mRNA            join(15276027..15276430,15281156..15281239,
FT                   15281934..15282085,15283387..15283599,15414917..15415097,
FT                   15609120..15609299,15638302..15638373,15639514..15639588,
FT                   15660128..15660211,15663139..15663228,15735307..15735405,
FT                   15738856..15738942,15739556..15739615,15754914..15755047,
FT                   15765774..15765828,15767065..15767116,15769541..15769674,
FT                   15773936..15774172,15779985..15781786)
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, transcript variant mCT19814"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT19814.2 created
FT                   on 05-AUG-2002"
FT   mRNA            join(15276027..15276430,15281156..15281239,
FT                   15281934..15282085,15283387..15283599,15414917..15415097,
FT                   15609120..15609511)
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, transcript variant mCT50638"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT50638.2 created
FT                   on 05-AUG-2002"
FT   assembly_gap    15288781..15288800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15290887..15292767
FT                   /estimated_length=1881
FT                   /gap_type="unknown"
FT   mRNA            join(<15298047..15298356,15414917..15415097,
FT                   15609120..15609299,15638302..15638373,15639514..15639588,
FT                   15660128..15660211,15663139..15663228,15754914..15755047,
FT                   15765774..15765828,15767065..15767116,15769541..15769674,
FT                   15773936..15774172,15779985..15781782)
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, transcript variant mCT191541"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT191541.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<15298049..15298356,15414917..15415097,
FT                   15609120..15609299,15638302..15638373,15639514..15639588,
FT                   15660128..15660211,15663139..15663228,15735307..15735405,
FT                   15738856..15738942,15739556..15739615,15754914..15755047,
FT                   15765774..15765828,15767065..15767116,15769541..15769674,
FT                   15773936..15774172,15779985..15781782)
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, transcript variant mCT191540"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT191540.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<15298322..15298356,15414917..15415097,
FT                   15609120..15609299,15638302..15638373,15639514..15639588,
FT                   15660128..15660211,15663139..15663228,15735307..15735405,
FT                   15738856..15738942,15739556..15739615,15754914..15755047,
FT                   15765774..15765828,15767065..15767116,15769541..15769674,
FT                   15773936..15774172,15779985..15780119)
FT                   /codon_start=1
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, isoform CRA_a"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT191540.0
FT                   protein_id=mCP112476.0 isoform=CRA_a"
FT                   /protein_id="EDL21092.1"
FT                   /translation="ILFLVSEAGTPRMKKMSNIYESAANTLGIFNSPCLTKVELRVACK
FT                   GISDRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTCINPVYSKLFTVDFYFEEVQRLR
FT                   FEVHDISSNHNGLKEADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELS
FT                   GNDDYVELAFNARKLDDKDFFSKSDPFLEIFRMNDDATQQLVHRTEVVMNNLSPAWKSF
FT                   KVSVNSLCSGDPDRRLKCIVWDWDSNGKHDFIGEFTSTFKEMRGAMEGKQVQWECINPK
FT                   YKAKKKNYKNSGMVILNQCKIHKMHSFLDYIMGGCQIQFTVAIDFTASNGDPRNSCSLH
FT                   YIHPYQPNEYLKALVAVGEICQDYDSDKMFPAFGFGARIPPEYTVSHDFAINFNEDNPE
FT                   CAGIQGVVEAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQYFILLILTDGV
FT                   ITDMADTREAIVHASHLPMSVIIVGVGNADFSDMQMLDGDDGILRSPKGEPVLRDIVQF
FT                   VPFRNFKHASPAALAKSVLAEVPNQVVDYYNGKGIKPKCSSEVYESSRTLAP"
FT   CDS             join(<15298322..15298356,15414917..15415097,
FT                   15609120..15609299,15638302..15638373,15639514..15639588,
FT                   15660128..15660211,15663139..15663228,15754914..15755047,
FT                   15765774..15765828,15767065..15767116,15769541..15769674,
FT                   15773936..15774172,15779985..15780119)
FT                   /codon_start=1
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, isoform CRA_b"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT191541.0
FT                   protein_id=mCP112477.0 isoform=CRA_b"
FT                   /protein_id="EDL21093.1"
FT                   /translation="ILFLVSEAGTPRMKKMSNIYESAANTLGIFNSPCLTKVELRVACK
FT                   GISDRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTCINPVYSKLFTVDFYFEEVQRLR
FT                   FEVHDISSNHNGLKEADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELS
FT                   GNDDYVELAFNARKLDDKDFFSKSDPFLEIFRMNDDATQQLVHRTEVVMNNLSPAWKSF
FT                   KVSVNSLCSGDPDRRLKVAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALVAVGEICQD
FT                   YDSDKMFPAFGFGARIPPEYTVSHDFAINFNEDNPECAGIQGVVEAYQSCLPKLQLYGP
FT                   TNIAPIIQKVAKSASEETNTKEASQYFILLILTDGVITDMADTREAIVHASHLPMSVII
FT                   VGVGNADFSDMQMLDGDDGILRSPKGEPVLRDIVQFVPFRNFKHASPAALAKSVLAEVP
FT                   NQVVDYYNGKGIKPKCSSEVYESSRTLAP"
FT   assembly_gap    15311837..15312071
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    15324359..15324378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15330402..15330429
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    15332863..15333149
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    15340008..15341251
FT                   /estimated_length=1244
FT                   /gap_type="unknown"
FT   assembly_gap    15349542..15349731
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    15356461..15356480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15413986..15414005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(15414918..15415097,15609120..15609299,
FT                   15638302..15638373,15639514..15639588,15660128..15660211,
FT                   15663139..15663228,15735307..15735405,15738856..15738942,
FT                   15739556..15739615,15754914..15755047,15765774..15765828,
FT                   15767065..15767116,15769541..15769674,15773936..15774172,
FT                   15779985..15780119)
FT                   /codon_start=1
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, isoform CRA_c"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT19814.2
FT                   protein_id=mCP21367.2 isoform=CRA_c"
FT                   /protein_id="EDL21094.1"
FT                   /translation="MKKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPD
FT                   PCVILKMQSHGQWFEVDRTEVIRTCINPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNG
FT                   LKEADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELSGNDDYVELAFNA
FT                   RKLDDKDFFSKSDPFLEIFRMNDDATQQLVHRTEVVMNNLSPAWKSFKVSVNSLCSGDP
FT                   DRRLKCIVWDWDSNGKHDFIGEFTSTFKEMRGAMEGKQVQWECINPKYKAKKKNYKNSG
FT                   MVILNQCKIHKMHSFLDYIMGGCQIQFTVAIDFTASNGDPRNSCSLHYIHPYQPNEYLK
FT                   ALVAVGEICQDYDSDKMFPAFGFGARIPPEYTVSHDFAINFNEDNPECAGIQGVVEAYQ
FT                   SCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQYFILLILTDGVITDMADTREAIV
FT                   HASHLPMSVIIVGVGNADFSDMQMLDGDDGILRSPKGEPVLRDIVQFVPFRNFKHASPA
FT                   ALAKSVLAEVPNQVVDYYNGKGIKPKCSSEVYESSRTLAP"
FT   CDS             join(15414918..15415097,15609120..15609377)
FT                   /codon_start=1
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, isoform CRA_d"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT50638.2
FT                   protein_id=mCP41400.2 isoform=CRA_d"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="MGI:MGI:1921270"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CEQ2"
FT                   /protein_id="EDL21095.1"
FT                   /translation="MKKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPD
FT                   PCVILKMQSHGQWFEVDRTEVIRTCINPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNG
FT                   LKEADFLGGMECTLGQVDRRCLLSPPLQAFLPSSDPCSLFL"
FT   assembly_gap    15419719..15419738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15427624..15427643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15428781..15428800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15433831..15433850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15442545..15442728
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    15469500..15469519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15501853..15501877
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    15536528..15536547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15583719..15583805
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    15614533..15614688
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    15621789..15621886
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    15626465..15626539
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    15661438..15661523
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    15682345..15699990
FT                   /estimated_length=17646
FT                   /gap_type="unknown"
FT   assembly_gap    15710900..15711264
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    15727423..15727442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15731923..15731942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15733921..15734077
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    15755256..15755276
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   gene            15800483..15824683
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /note="gene_id=mCG14748.2"
FT   mRNA            join(15800483..15800756,15801666..15801850,
FT                   15802814..15802905,15804244..15804342,15808931..15809030,
FT                   15811082..15811142,15818431..15818539,15820829..15820906,
FT                   15822278..15822355,15824111..15824683)
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /product="mitochondrial ribosomal protein L3, transcript
FT                   variant mCT19813"
FT                   /note="gene_id=mCG14748.2 transcript_id=mCT19813.2 created
FT                   on 19-JUL-2002"
FT   mRNA            join(15800483..15800756,15801666..15801850,
FT                   15802814..15802905,15804244..15804342,15808931..15809030,
FT                   15811082..15811142,15818431..15818539,15820829..15820906,
FT                   15822278..15822761)
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /product="mitochondrial ribosomal protein L3, transcript
FT                   variant mCT170745"
FT                   /note="gene_id=mCG14748.2 transcript_id=mCT170745.0 created
FT                   on 19-JUL-2002"
FT   mRNA            join(<15800545..15800756,15801760..15801850,
FT                   15802814..15802905,15804244..15804342,15808931..15809030,
FT                   15811082..15811142,15818431..15818539,15820829..15820906,
FT                   15822278..15822355,15824111..15824584)
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /product="mitochondrial ribosomal protein L3, transcript
FT                   variant mCT191536"
FT                   /note="gene_id=mCG14748.2 transcript_id=mCT191536.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(15800665..15800756,15801666..15801850,
FT                   15802814..15802905,15804244..15804342,15808931..15809030,
FT                   15811082..15811142,15818431..15818539,15820829..15820906,
FT                   15822278..15822355,15824111..15824263)
FT                   /codon_start=1
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /product="mitochondrial ribosomal protein L3, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG14748.2 transcript_id=mCT19813.2
FT                   protein_id=mCP21350.2 isoform=CRA_c"
FT                   /protein_id="EDL21098.1"
FT                   /translation="MPGWRLLAQAGARVLGCGARGLGADPGLERRKNILFFVRNLHSKS
FT                   STWWDEHLSEENLSFVKQLVSDENKTQLTSKLNPLKDEPWPLHPWEPGSFRVGLIALKL
FT                   GMMPLWTKDGQKHAVTLLQVQDCHVLKYTPKEDHNGKIAALTVGGKTVSRFYKPDSRLE
FT                   FYRDLGLPPKQIHKIFHVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRW
FT                   GFKGQPASHGQTKTHRRPGAISTGDIARVWPGTKMPGRMGNQNRTVYGLKVWRVNTKHN
FT                   IIYVNGSVPGHKNCLVKIKDSTLPAYKDSCKNLPFPTYFPDGDEEELPEDLFDESVWQP
FT                   SEPSITFA"
FT   CDS             join(15800665..15800756,15801666..15801850,
FT                   15802814..15802905,15804244..15804342,15808931..15809030,
FT                   15811082..15811142,15818431..15818539,15820829..15820906,
FT                   15822278..15822376)
FT                   /codon_start=1
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /product="mitochondrial ribosomal protein L3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG14748.2 transcript_id=mCT170745.0
FT                   protein_id=mCP93663.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3Z456"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="MGI:MGI:2137204"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z456"
FT                   /protein_id="EDL21096.1"
FT                   /translation="MPGWRLLAQAGARVLGCGARGLGADPGLERRKNILFFVRNLHSKS
FT                   STWWDEHLSEENLSFVKQLVSDENKTQLTSKLNPLKDEPWPLHPWEPGSFRVGLIALKL
FT                   GMMPLWTKDGQKHAVTLLQVQDCHVLKYTPKEDHNGKIAALTVGGKTVSRFYKPDSRLE
FT                   FYRDLGLPPKQIHKIFHVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRW
FT                   GFKGQPASHGQTKTHRRPGAISTGDIARVWPGTKMPGRMGNQNRTVYGLKVWRVNTKHN
FT                   IIYVNGSVPGHKNCLVKVCTAVC"
FT   CDS             join(<15800739..15800756,15801760..15801850,
FT                   15802814..15802905,15804244..15804342,15808931..15809030,
FT                   15811082..15811142,15818431..15818539,15820829..15820906,
FT                   15822278..15822355,15824111..15824263)
FT                   /codon_start=1
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /product="mitochondrial ribosomal protein L3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG14748.2 transcript_id=mCT191536.0
FT                   protein_id=mCP112475.0 isoform=CRA_b"
FT                   /protein_id="EDL21097.1"
FT                   /translation="PRLREKQLVSDENKTQLTSKLNPLKDEPWPLHPWEPGSFRVGLIA
FT                   LKLGMMPLWTKDGQKHAVTLLQVQDCHVLKYTPKEDHNGKIAALTVGGKTVSRFYKPDS
FT                   RLEFYRDLGLPPKQIHKIFHVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVM
FT                   KRWGFKGQPASHGQTKTHRRPGAISTGDIARVWPGTKMPGRMGNQNRTVYGLKVWRVNT
FT                   KHNIIYVNGSVPGHKNCLVKIKDSTLPAYKDSCKNLPFPTYFPDGDEEELPEDLFDESV
FT                   WQPSEPSITFA"
FT   gene            complement(15811795..15815073)
FT                   /locus_tag="mCG_147712"
FT                   /note="gene_id=mCG147712.0"
FT   mRNA            complement(join(15811795..15812151,15812187..15815073))
FT                   /locus_tag="mCG_147712"
FT                   /product="mCG147712"
FT                   /note="gene_id=mCG147712.0 transcript_id=mCT187975.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(15812443..15812829)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147712"
FT                   /product="mCG147712"
FT                   /note="gene_id=mCG147712.0 transcript_id=mCT187975.0
FT                   protein_id=mCP108539.0"
FT                   /protein_id="EDL21099.1"
FT                   /translation="MKQNPTRQNPPPPFLSIQEDWNYQKGERKTLRSSAAVYELKASTE
FT                   HRPGKTKLYTKPVTSLATSHLLTKASDSMPSQSSLYVLQGMECDSHSTVYKLTGLMHGI
FT                   LGLVVIHKFKSKIIWSVTESSLAS"
FT   assembly_gap    15832312..15832331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15835029..15837273
FT                   /estimated_length=2245
FT                   /gap_type="unknown"
FT   assembly_gap    15846972..15846991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15852062..15852081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15854710..15854939
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    15856226..15856245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15859989..15860809
FT                   /estimated_length=821
FT                   /gap_type="unknown"
FT   gene            complement(15878225..15881122)
FT                   /gene="Nudt16"
FT                   /locus_tag="mCG_4793"
FT                   /note="gene_id=mCG4793.1"
FT   mRNA            complement(join(15878225..15878321,15879608..15879827,
FT                   15880610..15880879,15880960..15881122))
FT                   /gene="Nudt16"
FT                   /locus_tag="mCG_4793"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 16, transcript variant mCT170570"
FT                   /note="gene_id=mCG4793.1 transcript_id=mCT170570.0 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(15878660..15879827,15880610..15880879,
FT                   15880960..15881122))
FT                   /gene="Nudt16"
FT                   /locus_tag="mCG_4793"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 16, transcript variant mCT3740"
FT                   /note="gene_id=mCG4793.1 transcript_id=mCT3740.1 created on
FT                   11-JUL-2002"
FT   CDS             complement(join(15879648..15879827,15880610..15880879,
FT                   15880960..15881097))
FT                   /codon_start=1
FT                   /gene="Nudt16"
FT                   /locus_tag="mCG_4793"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 16, isoform CRA_a"
FT                   /note="gene_id=mCG4793.1 transcript_id=mCT170570.0
FT                   protein_id=mCP93488.0 isoform=CRA_a"
FT                   /protein_id="EDL21100.1"
FT                   /translation="MEGHRKVELSEALALGPDWRHACHALLYAPDPRKLFGRIPMRFAV
FT                   LMQMRFDGRLGFPGGFVDAQDSCLEDGLNRELREELGEAMSAFRVERSDYRSSHIAARP
FT                   RVVAHFYAKRLTLEQLQAVEARAPQAKDHGLEVLGLVRVPLYVLRDGEGGLPAFLENSF
FT                   IGAAREQLLEALQDLKLLDPGIIAKLKIPDSK"
FT   CDS             complement(join(15879648..15879827,15880610..15880879,
FT                   15880960..15881097))
FT                   /codon_start=1
FT                   /gene="Nudt16"
FT                   /locus_tag="mCG_4793"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 16, isoform CRA_a"
FT                   /note="gene_id=mCG4793.1 transcript_id=mCT3740.1
FT                   protein_id=mCP21241.1 isoform=CRA_a"
FT                   /protein_id="EDL21101.1"
FT                   /translation="MEGHRKVELSEALALGPDWRHACHALLYAPDPRKLFGRIPMRFAV
FT                   LMQMRFDGRLGFPGGFVDAQDSCLEDGLNRELREELGEAMSAFRVERSDYRSSHIAARP
FT                   RVVAHFYAKRLTLEQLQAVEARAPQAKDHGLEVLGLVRVPLYVLRDGEGGLPAFLENSF
FT                   IGAAREQLLEALQDLKLLDPGIIAKLKIPDSK"
FT   assembly_gap    15886274..15888759
FT                   /estimated_length=2486
FT                   /gap_type="unknown"
FT   assembly_gap    15890286..15890305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15892962..15894697)
FT                   /gene="1700080E11Rik"
FT                   /locus_tag="mCG_4454"
FT                   /note="gene_id=mCG4454.1"
FT   mRNA            complement(join(15892962..15893267,15894049..15894318,
FT                   15894402..15894697))
FT                   /gene="1700080E11Rik"
FT                   /locus_tag="mCG_4454"
FT                   /product="RIKEN cDNA 1700080E11"
FT                   /note="gene_id=mCG4454.1 transcript_id=mCT3728.1 created on
FT                   11-JUL-2002"
FT   CDS             complement(join(15893058..15893267,15894049..15894318,
FT                   15894402..15894542))
FT                   /codon_start=1
FT                   /gene="1700080E11Rik"
FT                   /locus_tag="mCG_4454"
FT                   /product="RIKEN cDNA 1700080E11"
FT                   /note="gene_id=mCG4454.1 transcript_id=mCT3728.1
FT                   protein_id=mCP21238.2"
FT                   /protein_id="EDL21102.1"
FT                   /translation="MATPTKIDLEDALALGPSWRHLCHVMLYAPDPGVLFGGRILLNYA
FT                   VLMSMRFDGRLGFPGGFVDDRSPSLEEGLNKELLKKLGEGVSTFSILSTDYRSSLAESK
FT                   SKVVAHFYVKCLTLEQLQAVEAGAPQAKDHGLEVLGLVRVPLYTLRDGMGGLPAFLENS
FT                   FIGVAREQLLEALQDLGILAPETASDLKERTVQRKQTLRLIGT"
FT   assembly_gap    15895394..15895774
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    15897304..15897465
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    15904394..15904734
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    15927419..15927438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15949776..15949795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15954221..15954422
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   gene            15958953..15965893
FT                   /locus_tag="mCG_1032909"
FT                   /note="gene_id=mCG1032909.0"
FT   mRNA            join(15958953..15959114,15965745..15965893)
FT                   /locus_tag="mCG_1032909"
FT                   /product="mCG1032909"
FT                   /note="gene_id=mCG1032909.0 transcript_id=mCT150613.0
FT                   created on 05-AUG-2002"
FT   assembly_gap    15960066..15960085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15963125..15963144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             15965756..15965779
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032909"
FT                   /product="mCG1032909"
FT                   /note="gene_id=mCG1032909.0 transcript_id=mCT150613.0
FT                   protein_id=mCP68527.1"
FT                   /protein_id="EDL21103.1"
FT                   /translation="MTWIDTE"
FT   assembly_gap    15968533..15968808
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    15969208..15969240
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    15970318..15971989
FT                   /estimated_length=1672
FT                   /gap_type="unknown"
FT   assembly_gap    15974659..15974678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15977290..15977309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15979069..15979088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15980101..15980120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15982852..15982871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15999177..15999839)
FT                   /locus_tag="mCG_1032910"
FT                   /note="gene_id=mCG1032910.0"
FT   mRNA            complement(join(15999177..15999382,15999408..15999839))
FT                   /locus_tag="mCG_1032910"
FT                   /product="mCG1032910"
FT                   /note="gene_id=mCG1032910.0 transcript_id=mCT150614.0
FT                   created on 05-AUG-2002"
FT   CDS             complement(join(15999355..15999382,15999408..15999544))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032910"
FT                   /product="mCG1032910"
FT                   /note="gene_id=mCG1032910.0 transcript_id=mCT150614.0
FT                   protein_id=mCP68701.1"
FT                   /protein_id="EDL21104.1"
FT                   /translation="MTYTGGEGPRKISKNAGQKRGGVPKATTSRFLMLILLSPQGAPGK
FT                   GVPSTTSQK"
FT   gene            complement(16000102..16156738)
FT                   /gene="Nek11"
FT                   /locus_tag="mCG_56220"
FT                   /note="gene_id=mCG56220.3"
FT   mRNA            complement(join(16000102..16000936,16043502..16043616,
FT                   16049532..16049625,16051247..16051366,16054016..16054101,
FT                   16055817..16055895,16056006..16056155,16070423..16070487,
FT                   16078817..16078935,16101149..16101314,16154064..16154375,
FT                   16156409..>16156502))
FT                   /gene="Nek11"
FT                   /locus_tag="mCG_56220"
FT                   /product="NIMA (never in mitosis gene a)-related expressed
FT                   kinase 11, transcript variant mCT191505"
FT                   /note="gene_id=mCG56220.3 transcript_id=mCT191505.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(16000106..16000936,16043502..16043616,
FT                   16049532..16049625,16051247..16051366,16054016..16054101,
FT                   16055817..16055895,16056006..16056155,16069151..16069277,
FT                   16070423..16070487,16078817..16078935,16101149..16101314,
FT                   16154064..16154375,16156409..16156738))
FT                   /gene="Nek11"
FT                   /locus_tag="mCG_56220"
FT                   /product="NIMA (never in mitosis gene a)-related expressed
FT                   kinase 11, transcript variant mCT56403"
FT                   /note="gene_id=mCG56220.3 transcript_id=mCT56403.2 created
FT                   on 05-AUG-2002"
FT   CDS             complement(join(16000740..16000936,16043502..16043616,
FT                   16049532..16049625,16051247..16051366,16054016..16054101,
FT                   16055817..16055895,16056006..16056155,16069151..16069277,
FT                   16070423..16070487,16078817..16078935,16101149..16101314,
FT                   16154064..16154236))
FT                   /codon_start=1
FT                   /gene="Nek11"
FT                   /locus_tag="mCG_56220"
FT                   /product="NIMA (never in mitosis gene a)-related expressed
FT                   kinase 11, isoform CRA_b"
FT                   /note="gene_id=mCG56220.3 transcript_id=mCT56403.2
FT                   protein_id=mCP41308.2 isoform=CRA_b"
FT                   /protein_id="EDL21106.1"
FT                   /translation="MLKFQETAKYVGGRPTVIPMYPTALIARRYVLQQKLGSGSFGTVY
FT                   LVSDKKAKPGEELKVLKEISVGELNPNETVQANVEAQLLSRLHHPAIVRFHASFMEQET
FT                   FCIITEYCEGRDLDYRIQEYKEAGKVFAENQIVEWFIQLLLGVDYMHERRILHRDLKSK
FT                   NIFLKNNLLKIGDFGVSRLLMGSCELATTLTGTPHYMSPEALKHQGYDAKSDIWSLACI
FT                   LYEMCCLDHAFAGSSFLSVVLNIVEGNTPSLPDRYPRELNTIMERMLNKSPSLRPSAAD
FT                   ILKAPYMEEQLQLLMCKYPEMTLEDKNSVCQKEAAHTINAVQKKLHLQTLQALSDTQKT
FT                   TPRERMRLRKLQAADERARRLKKIAEENYKENDKRMQALRSQNVGSVHAHVLHELDERT
FT                   LESLPEPQSLPCLDLDELEPSLEDTIVDLGHYEIPEDPLVAEQYYSDVFDSCSEDSEEQ
FT                   EEEMIFSEAGGDTKEEESPSVYRTNQQVQPLLLWPEDV"
FT   CDS             complement(join(16000740..16000936,16043502..16043616,
FT                   16049532..16049625,16051247..16051366,16054016..16054101,
FT                   16055817..16055895,16056006..16056155,16070423..>16070436))
FT                   /codon_start=1
FT                   /gene="Nek11"
FT                   /locus_tag="mCG_56220"
FT                   /product="NIMA (never in mitosis gene a)-related expressed
FT                   kinase 11, isoform CRA_a"
FT                   /note="gene_id=mCG56220.3 transcript_id=mCT191505.0
FT                   protein_id=mCP112511.0 isoform=CRA_a"
FT                   /protein_id="EDL21105.1"
FT                   /translation="STQNRSLACILYEMCCLDHAFAGSSFLSVVLNIVEGNTPSLPDRY
FT                   PRELNTIMERMLNKSPSLRPSAADILKAPYMEEQLQLLMCKYPEMTLEDKNSVCQKEAA
FT                   HTINAVQKKLHLQTLQALSDTQKTTPRERMRLRKLQAADERARRLKKIAEENYKENDKR
FT                   MQALRSQNVGSVHAHVLHELDERTLESLPEPQSLPCLDLDELEPSLEDTIVDLGHYEIP
FT                   EDPLVAEQYYSDVFDSCSEDSEEQEEEMIFSEAGGDTKEEESPSVYRTNQQVQPLLLWP
FT                   EDV"
FT   assembly_gap    16002735..16002908
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    16003371..16004889
FT                   /estimated_length=1519
FT                   /gap_type="unknown"
FT   assembly_gap    16009740..16009824
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    16013592..16013709
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    16081252..16081271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16082370..16082389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16085375..16085394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16092438..16092457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16093549..16097879
FT                   /estimated_length=4331
FT                   /gap_type="unknown"
FT   assembly_gap    16102862..16103021
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    16106866..16106974
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    16110053..16110072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16124112..16124131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16127865..16127884
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16129055..16129074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16134383..16134402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16137121..16137140
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16142930..16142949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16143923..16143942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16146888..16146907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16148107..16148126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16152751..16152852
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   gene            16156623..16166628
FT                   /gene="Aste1"
FT                   /locus_tag="mCG_4452"
FT                   /note="gene_id=mCG4452.2"
FT   mRNA            join(16156623..16156878,16157762..16159075,
FT                   16162692..16162902,16164563..16164758,16166166..16166628)
FT                   /gene="Aste1"
FT                   /locus_tag="mCG_4452"
FT                   /product="asteroid homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG4452.2 transcript_id=mCT3725.1 created on
FT                   11-JUL-2002"
FT   CDS             join(16157780..16159075,16162692..16162902,
FT                   16164563..16164758,16166166..16166481)
FT                   /codon_start=1
FT                   /gene="Aste1"
FT                   /locus_tag="mCG_4452"
FT                   /product="asteroid homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG4452.2 transcript_id=mCT3725.1
FT                   protein_id=mCP21237.1"
FT                   /protein_id="EDL21107.1"
FT                   /translation="MGIRGLMSFVEDYSNEFFVDLKLRNTKLIIDGYSLFHRLCFNSDL
FT                   ELRYGGDYDLFADVVQKFFESLFACHICPYVVLDGGCDISDKKLTTLKDRAKEKIQAAR
FT                   SLSLGGGGNVCPLLIREVFIQVLIRLEVCFVQSFSEADRDIMTLANHWNCPVLSSDSDF
FT                   CIFDLRSGFCSLNSFQWRNLNTIKDTQDYYIPARSFSLDAFCHYFNNMNKALLPLFAVL
FT                   CGNDHVNLPIMDTFISKVRLPLSSKGRRYHRVLGLLNWLSHFDDPTEALDNVLKSLPKK
FT                   SRENVKELLCCSMEEYQQSPVKLQDFFQYGSYVCTDASDLGLPEWVLGALAKGQLPPFI
FT                   SDALVLRRTFLHTQVENMQRPNAHRISQPIRQIIYGLLLNGPSHAEDIAQNTLPSQLLA
FT                   FNEVERIDTNIKTSTVYAKQLLKDQCDLSKLAELPLARRQMLLLEALKVKQVVLESIPT
FT                   FLKLPIAVTCYWLQSTEAKAKLHHLQALLLGMLREPLHAIVNSPGTEDPQRGGAKMLYE
FT                   ELCQVKAPMRPGPRVDLDTAHVFCQWQSCLQMGLYLNQLLSTPLPEPNLTWLYNGSLVH
FT                   RLCQQLPASSSVESLLSLCPEAKQLYEHLFNATKSYAPAELFLPKTKSKSKKKRQKKKV
FT                   ASLGTTAGAKHWYDRSNRFGPLMPESLEEHVENSELE"
FT   gene            complement(16170876..16279337)
FT                   /gene="Atp2c1"
FT                   /locus_tag="mCG_4445"
FT                   /note="gene_id=mCG4445.2"
FT   mRNA            complement(join(16170876..16172704,16174133..16174274,
FT                   16177477..16177572,16177972..16178119,16179610..16179726,
FT                   16180999..16181067,16182362..16182528,16183589..16183639,
FT                   16190965..16191062,16192106..16192276,16194509..16194665,
FT                   16198758..16198862,16201386..16201475,16201566..16201661,
FT                   16203843..16203940,16204705..16204829,16207477..16207543,
FT                   16210764..16210839,16211712..16211780,16212471..16212623,
FT                   16218205..16218313,16219614..16219675,16223205..16223240,
FT                   16225161..16225250,16226248..16226364,16228586..16228696,
FT                   16279120..16279337))
FT                   /gene="Atp2c1"
FT                   /locus_tag="mCG_4445"
FT                   /product="ATPase, Ca++-sequestering"
FT                   /note="gene_id=mCG4445.2 transcript_id=mCT3737.2 created on
FT                   05-AUG-2002"
FT   CDS             complement(join(16172574..16172704,16174133..16174274,
FT                   16177477..16177572,16177972..16178119,16179610..16179726,
FT                   16180999..16181067,16182362..16182528,16183589..16183639,
FT                   16190965..16191062,16192106..16192276,16194509..16194665,
FT                   16198758..16198862,16201386..16201475,16201566..16201661,
FT                   16203843..16203940,16204705..16204829,16207477..16207543,
FT                   16210764..16210839,16211712..16211780,16212471..16212623,
FT                   16218205..16218313,16219614..16219675,16223205..16223240,
FT                   16225161..16225250,16226248..16226364,16228586..16228696,
FT                   16279120..16279227))
FT                   /codon_start=1
FT                   /gene="Atp2c1"
FT                   /locus_tag="mCG_4445"
FT                   /product="ATPase, Ca++-sequestering"
FT                   /note="gene_id=mCG4445.2 transcript_id=mCT3737.2
FT                   protein_id=mCP21264.2"
FT                   /db_xref="GOA:Q3UZR5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006413"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR030336"
FT                   /db_xref="MGI:MGI:1889008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UZR5"
FT                   /protein_id="EDL21108.1"
FT                   /translation="MENLLPPSGFSYLKKYPLHSIRKYLSTLRSQRAEEQVARFQKIPN
FT                   VENETMIPVLTSKRASELAVSEVAGLLQADLQNGLNKSEVSHRRAFHGWNEFDISEDEP
FT                   LWKKYISQFKNPLIMLLLASAVISILMRQFDDAVSITVAIVIVVTVAFVQEYRSEKSLE
FT                   ELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSVDESSL
FT                   TGETAPCSKVTAPQPAANGDLASRSNIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMM
FT                   QAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIP
FT                   EGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIL
FT                   TSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNNTLMGKP
FT                   TEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDRPEICFMKGAYE
FT                   QVIKYCTTYNSKGQTLALTQQQRDLYQQEKARMGSAGLRVLALASGPELGQLTFLGLVG
FT                   IIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAIAIASRLGLYSKTSQSVSGEEVDTM
FT                   EVQHLSQIVPKVAVFYRASPRHKMKIIKSLQKNGAVVAMTGDGVNDAVALKAADIGVAM
FT                   GQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLA
FT                   TLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKI
FT                   LVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGL
FT                   CSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVSEIIKK
FT                   VERSREKVQKNAGSASSSFLEV"
FT   assembly_gap    16189034..16189113
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    16210284..16210303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16246845..16246864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16252751..16256331
FT                   /estimated_length=3581
FT                   /gap_type="unknown"
FT   assembly_gap    16257757..16257776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16265556..16265605
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    16275777..16275796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16280691..16280710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16298460..16298479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16304517..16304983)
FT                   /pseudo
FT                   /locus_tag="mCG_4450"
FT                   /note="gene_id=mCG4450.1"
FT   mRNA            complement(16304517..16304983)
FT                   /pseudo
FT                   /locus_tag="mCG_4450"
FT                   /note="gene_id=mCG4450.1 transcript_id=mCT3735.1 created on
FT                   11-JUL-2002"
FT   gene            complement(16318818..16319569)
FT                   /pseudo
FT                   /locus_tag="mCG_4451"
FT                   /note="gene_id=mCG4451.2"
FT   mRNA            complement(16318818..16319569)
FT                   /pseudo
FT                   /locus_tag="mCG_4451"
FT                   /note="gene_id=mCG4451.2 transcript_id=mCT3727.2 created on
FT                   07-AUG-2002"
FT   assembly_gap    16326561..16326724
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    16330729..16331381
FT                   /estimated_length=653
FT                   /gap_type="unknown"
FT   assembly_gap    16342071..16342090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16343176..16343195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16345243..16345262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16348235..16348254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16349475..16349494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16351061..16351731
FT                   /estimated_length=671
FT                   /gap_type="unknown"
FT   assembly_gap    16356215..16356863
FT                   /estimated_length=649
FT                   /gap_type="unknown"
FT   assembly_gap    16368270..16368289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16393832..16393851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16401776..16448486
FT                   /locus_tag="mCG_4618"
FT                   /note="gene_id=mCG4618.2"
FT   mRNA            join(16401776..16402547,16406067..16406200,
FT                   16407719..16408301,16411556..16411690,16413096..16413317,
FT                   16416714..16416887,16419877..16420022,16421581..16421784,
FT                   16426261..16426462,16427530..16427717,16428290..16428500,
FT                   16431209..16431374,16435592..16435756,16439158..16439369,
FT                   16443247..16443378,16446206..16446225,16446968..16447056,
FT                   16447185..16447293,16447954..16448486)
FT                   /locus_tag="mCG_4618"
FT                   /product="mCG4618"
FT                   /note="gene_id=mCG4618.2 transcript_id=mCT3741.2 created on
FT                   16-SEP-2002"
FT   CDS             join(16401815..16402547,16406067..16406200,
FT                   16407719..16408301,16411556..16411690,16413096..16413317,
FT                   16416714..16416887,16419877..16420022,16421581..16421784,
FT                   16426261..16426462,16427530..16427717,16428290..16428500,
FT                   16431209..16431374,16435592..16435756,16439158..16439369,
FT                   16443247..16443378,16446206..16446225,16446968..16447056,
FT                   16447185..16447293,16447954..16448124)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4618"
FT                   /product="mCG4618"
FT                   /note="gene_id=mCG4618.2 transcript_id=mCT3741.2
FT                   protein_id=mCP21255.2"
FT                   /protein_id="EDL21109.1"
FT                   /translation="MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKH
FT                   REGLVVVKVFAIQDPTLPLTSYKQELEELKIRLHSAQNCLPFQKAAEKASEKAAMLFRQ
FT                   YVRDNLYDRISTRPFLNNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVL
FT                   LTDFASFKPTYLPEDNPADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPL
FT                   VDLNSNQRARGELKRAMDIFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKI
FT                   EDRSIRDLVTQMINREPEKRLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSAD
FT                   ERILVIRKDLGNIIHNLCGHDLPEKAEGESRASGLVVLVSVITSCLQTLKSCDSKLAAL
FT                   ELILHLAPRLSVEILLDRITPYLLHFSNDSVPRVRAEALRTLTKVLALVQEVPRNDVNI
FT                   YPEYILPGIAHLAQDDATIVRLAYAENIALLAETALRFLELVQLKTLNMENEPDSEEVD
FT                   EATRPNGDYDTELQALHEMVQQKVVTLLSDPENIVKQTLMESGITRLCVFFGRQKANDV
FT                   LLSHMITFLNDKNDWHLRGAFFDSIVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKA
FT                   LNALTCMCQLGLLQKPHVYEFASDIAPFLCHPNLWIRYGAVGFITVVAHQISTADVYCK
FT                   LMPYLDPYITQPVIQIERKLVLLSVLKEPVSRSIFDYALRSKDIASLFRHLHMRQKKRN
FT                   GSLLDCPPPEDPTIAQLLKKLLSQGMTEEEEDKLLALKDFMMKSNRAKANAVDQSHLHD
FT                   SSQKGVIDLAALGITGRQVDLVKTKQEPDEKRARKHVKQDSNVNEEWKSMFGSLEPPNI
FT                   PQALPKTSDHEVVQPGKPPRSESSAGICVPLSTSPQVSEAAHIPSKKPVIPVVSSTVLP
FT                   STYQIRITTCKTELQQLIQQKREQCNAERIAKQMMENAEWESKPPPPGWRPKGLLVAHL
FT                   HEHKSAVNRIRVSDEHLLFATCSNDGTVKIWNSQKMEGKTTTTRSILTYSRIGGRVKTL
FT                   TFCQGSHYLAIASDNGAVQLLGIEASKLPKSPKIHPLQSRILDQKEDGCVVDMHHFNSG
FT                   AQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLKSGLITSFAVDIHQCWLCIGTSSGAMA
FT                   CWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWVIAAVQGNNEPSPHSVHGIYCSPADG
FT                   NPILLTAGSDMKIRFWDLVSPERSYVVAGSTGSPSVSYYKKIIEGTEVVQEIQNKQKVG
FT                   PSDDTPRRGPESLPVGHHDIITDIATFQTTQGFIVTASRDGIVKVWK"
FT   assembly_gap    16419241..16419260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16446228..16446511
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   gene            complement(16449213..16462562)
FT                   /locus_tag="mCG_140811"
FT                   /note="gene_id=mCG140811.0"
FT   mRNA            complement(join(16449213..16450551,16458928..16459021,
FT                   16461891..16462562))
FT                   /locus_tag="mCG_140811"
FT                   /product="mCG140811"
FT                   /note="gene_id=mCG140811.0 transcript_id=mCT171631.0
FT                   created on 05-AUG-2002"
FT   CDS             complement(join(16450347..16450551,16458928..16459021,
FT                   16461891..16462443))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140811"
FT                   /product="mCG140811"
FT                   /note="gene_id=mCG140811.0 transcript_id=mCT171631.0
FT                   protein_id=mCP94550.0"
FT                   /protein_id="EDL21110.1"
FT                   /translation="MRDFLEALLDHFEITSEPETSVTGDRVALLSHAPLDFLPNTQRSP
FT                   VRTEFNLTSYSSKRLMKRHVDQAVQQLHGDAFLGHALGWALDNVFLNTPNLRRNKVIFV
FT                   ISAGETSHLDAETLKKESLRAKCHGYALFVFSLGPDWDDKELEDLASHPVDQHLIQLGR
FT                   IHKPDHGYSVKFVKSFINSIRHGINKYPPVNLKAKCNRLSSRDLKPPPRQFRSFVPGPQ
FT                   KANLKDHAAEAAKLFQDKKRLSSMLKGGRATISSLSRSTRYAFKQGKEAMKATSKLGKR
FT                   SA"
FT   assembly_gap    16455376..16455395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16456913..16456932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16467041..16467060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16517257..16574033)
FT                   /gene="E330026B02Rik"
FT                   /locus_tag="mCG_140812"
FT                   /note="gene_id=mCG140812.0"
FT   mRNA            complement(join(16517257..16517608,16518867..16518920,
FT                   16519012..16519056,16521511..16521537,16521640..16521711,
FT                   16523351..16523404,16526075..16526229,16530303..16530381,
FT                   16530479..16530822,16538538..16539098,16541776..16542351,
FT                   16544837..16545394,16546128..16546688,16547854..16548474,
FT                   16549899..16550495,16553264..16553361,16573818..16574033))
FT                   /gene="E330026B02Rik"
FT                   /locus_tag="mCG_140812"
FT                   /product="RIKEN cDNA E330026B02"
FT                   /note="gene_id=mCG140812.0 transcript_id=mCT171632.0
FT                   created on 05-AUG-2002"
FT   CDS             complement(join(16517525..16517608,16518867..16518920,
FT                   16519012..16519056,16521511..16521537,16521640..16521711,
FT                   16523351..16523404,16526075..16526229,16530303..16530381,
FT                   16530479..16530822,16538538..16539098,16541776..16542351,
FT                   16544837..16545394,16546128..16546688,16547854..16548474,
FT                   16549899..16550495,16553264..16553324))
FT                   /codon_start=1
FT                   /gene="E330026B02Rik"
FT                   /locus_tag="mCG_140812"
FT                   /product="RIKEN cDNA E330026B02"
FT                   /note="gene_id=mCG140812.0 transcript_id=mCT171632.0
FT                   protein_id=mCP94551.0"
FT                   /protein_id="EDL21111.1"
FT                   /translation="MLLVLCLTMICFHMCVNQDSGPEYADVVFLVDSSDHLGLKSFPLV
FT                   KTFIHKMISSLPIEANKYRVALAQYSDALHNEFQLGTFKNRNPMLNHLKKNFGFIGGSL
FT                   KIGNALQEAHRTYFSAPTNGRDKKQFPPILVVLASAESEDDVEEAAKALREDGVKIISV
FT                   GVQKASEENLKAMATSQFHFNLRTARDLSVFAPNMTEIIKDVTQYREGMADDIIVEACQ
FT                   GPSVADVVFLLDMAINGSQEDLDHLKAFLGESISALDIKENCMRVGLVTYSNETRVISS
FT                   LSTGNNKTEVLQRIQDLSPQVGQAYTGAALRKTRKEIFSAQRGSRKNQGVPQIAVLVTH
FT                   RASEDNVTKAAVNLRREGVTIFTMGIEGANPDELEKIASHPAEQFTSKLGNFSELATHN
FT                   QTFLKKLRNQITHTVSVFSERTETLKSACVDTEEADIYLLIDGSGSTQPTDFHEMKTFL
FT                   SEVVGMFNIAPHKVRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAA
FT                   LNFTLKLLQRAKKERGSKVPCHLVVLTNGMSRDSVLGPAHKLREENIRVHAIGVKEANQ
FT                   MQLREIAGEEKRVYYVHDFDALRNIRNQVVQEICAEEACRDMKADIMFLVDSSGSIGPE
FT                   NFSKMKMFMKNLVSKSQIGADRVQIGVVQFSHENKEEFQLNTFMSQSDIANAIDRMTHI
FT                   GETTLTGSALTFVSQYFSPDKGARPNVRKFLILITDGEAQDIVRDPALALRKEGVIIYS
FT                   VGVFGSNVTQLEEISGKPEMVFYVENFDILQHIEDDLVLGICSPREECKRIEVLDVVFV
FT                   IDSSGSIDYQEYNIMKDFMIGLVKKADVGKNQVRFGALKYADDPEVLFYLDELGTKLEV
FT                   ISVLQNDHPMGGNTYTAEALAFSNHMFTEARGSRLHKGVPQVLIVITDGESHDAEKLNA
FT                   TAKALRDKGILVLAVGIAGANSWELLAMAGSGDKYYFVETFGGLKGIFSDVSASVCNSS
FT                   KVDCEIEKVDLVFLMDGSNSIHPDDFQKMKGFLVSVVQDFDVSLNRVRIGVAQFSDSYR
FT                   SEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKVKYYFQPDTGSRINAGTPQVLLV
FT                   LTDGRSQDEVAQAAEELRHKGVDIYSVGIGDVDDQELVQITGTAEKKLTVHNFDELKKV
FT                   KKRIVRNICTSGDCFVDVVVGFDISSLQRGQTLLEGQPWMGSYLQDLLRAISSLNGVSC
FT                   EVGTETQVSIAFQVTNAMERYPSKFEIYSENILSSLQGVTVNGPSRLNTNLLSSLWDTF
FT                   QNKSAARGKVVLLFSDGLDDGIEKLEQKSDELRKEGLNALITIAVDGAADSSDLADLLY
FT                   IEFGKGFEYRTQFTIGMRNLGSQLSRQLGPPGFKGSDGYLGEEGIAGERGASGPMGEQG
FT                   TKGCFGAKGPKGTRGLSGEEGEVGEDGLDGLDGEQGDHGIPGRRGEKGDEGSQGSPGRR
FT                   GAAGDRGAKGLRGDPVSAWAL"
FT   assembly_gap    16522139..16522196
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    16522968..16523058
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    16534015..16534034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16555266..16555569
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    16579425..16579444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16580572..16580591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16582259..16592862
FT                   /estimated