spacer

EBI Dbfetch

ID   CH466560; SV 1; linear; genomic DNA; CON; MUS; 19989287 BP.
XX
AC   CH466560;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009787569 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-19989287
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-19989287
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 7ae42861c106c1ad24b50577f7c677d1.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000217.
DR   Ensembl-Gn; ENSMUSG00000006673; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006675; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006676; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007815; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010044; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010045; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010047; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010048; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010054; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010067; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020257; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025647; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025651; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032356; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032359; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032368; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032372; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032412; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032413; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032454; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032456; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032462; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032463; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032468; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032470; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032475; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032531; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032548; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032549; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032557; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032563; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032564; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032570; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032575; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032577; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032590; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032591; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032595; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032596; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032598; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032601; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032607; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032612; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032839; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036972; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037784; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037953; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037977; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039313; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039952; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043154; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046242; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046402; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047606; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048758; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049314; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049493; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050641; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051074; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052911; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053747; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061701; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062270; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062867; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063058; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064145; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066357; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066368; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070287; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074139; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079334; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091080; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091129; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091537; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094089; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006851; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006853; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007959; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010188; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010189; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010192; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010198; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013338; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020490; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026743; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034909; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034927; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034983; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035029; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035037; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035045; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035121; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035166; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035170; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035194; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035211; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035216; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035218; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035220; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035230; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035237; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042553; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042581; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044491; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052068; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054819; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057265; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058992; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059097; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059802; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060700; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061248; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065014; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065360; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066773; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068700; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071302; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075941; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078367; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079548; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080435; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085073; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085133; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085242; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093786; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093800; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098443; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112874; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112885; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112911; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112938; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116522; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119472; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120218; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120305; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122384; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000128976; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149243; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000150576; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159283; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160978; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166905; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167504; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169860; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171091; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171412; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172646; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173933; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177657; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178051; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180154; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..19989287
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            2330..150820
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /note="gene_id=mCG66388.3"
FT   mRNA            join(2330..2475,6852..6935)
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   transcript variant mCT169839"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT169839.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(2438..2475,6852..6855)
FT                   /codon_start=1
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT169839.0
FT                   protein_id=mCP92505.1 isoform=CRA_c"
FT                   /protein_id="EDL20889.1"
FT                   /translation="MFYIDQEEPRAFR"
FT   mRNA            join(2842..2965,6852..>6935)
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   transcript variant mCT66571"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT66571.2 created
FT                   on 12-JUN-2003"
FT   CDS             join(2849..2965,6852..>6935)
FT                   /codon_start=1
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT66571.2
FT                   protein_id=mCP33365.2 isoform=CRA_d"
FT                   /protein_id="EDL20890.1"
FT                   /translation="MAAVTVNSAKRGLRAELKQRLRALSAEERLRQSLLLTQKVIAHNQ
FT                   YQNSKRISIFLSMQDEVETEVI"
FT   mRNA            join(3037..3135,112817..112944,135477..135708,
FT                   147294..150820)
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   transcript variant mCT185608"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT185608.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(<3037..3135,6852..6935,17801..18481)
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   transcript variant mCT169838"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT169838.1 created
FT                   on 12-JUN-2003"
FT   CDS             join(<6923..6935,17801..17973)
FT                   /codon_start=1
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT169838.1
FT                   protein_id=mCP92509.1 isoform=CRA_a"
FT                   /protein_id="EDL20887.1"
FT                   /translation="DGSNRFLKEVCKLDFSRLCWMNCIPFSKPSRCQCFTDVQTKAVPS
FT                   STISTCVCPLVIYISH"
FT   gene            complement(58478..>59231)
FT                   /locus_tag="mCG_1032811"
FT                   /note="gene_id=mCG1032811.1"
FT   mRNA            complement(58478..>59231)
FT                   /locus_tag="mCG_1032811"
FT                   /product="mCG1032811"
FT                   /note="gene_id=mCG1032811.1 transcript_id=mCT150515.1
FT                   created on 06-JUN-2002"
FT   CDS             complement(58987..>59229)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032811"
FT                   /product="mCG1032811"
FT                   /note="gene_id=mCG1032811.1 transcript_id=mCT150515.1
FT                   protein_id=mCP68542.1"
FT                   /protein_id="EDL20891.1"
FT                   /translation="KLRILYLHGARFYIYHLFKAFAPSLGRSNCSHSTNRGNKRRKERK
FT                   SERERERKRERKTLNPKSLHSGTQQKPNITVRSSF"
FT   CDS             149136..149384
FT                   /codon_start=1
FT                   /gene="Mthfs"
FT                   /locus_tag="mCG_66388"
FT                   /product="5, 10-methenyltetrahydrofolate synthetase,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG66388.3 transcript_id=mCT185608.0
FT                   protein_id=mCP106866.0 isoform=CRA_b"
FT                   /protein_id="EDL20888.1"
FT                   /translation="MIYFYLAAVARILCQDLLAGEFTSEGASWVHFRFPAPFLASYWNQ
FT                   NFRLVLRNLPSPEEHKNHTPMSAMCALIPLRRVSICL"
FT   gene            complement(369093..401415)
FT                   /gene="AF529169"
FT                   /locus_tag="mCG_7769"
FT                   /note="gene_id=mCG7769.2"
FT   mRNA            complement(join(369093..369669,374724..374978,
FT                   379348..381700,400924..401415))
FT                   /gene="AF529169"
FT                   /locus_tag="mCG_7769"
FT                   /product="cDNA sequence AF529169, transcript variant
FT                   mCT6962"
FT                   /note="gene_id=mCG7769.2 transcript_id=mCT6962.2 created on
FT                   06-JUN-2002"
FT   mRNA            complement(join(369093..369669,374298..374363,
FT                   374724..374978,379348..381700,400924..401415))
FT                   /gene="AF529169"
FT                   /locus_tag="mCG_7769"
FT                   /product="cDNA sequence AF529169, transcript variant
FT                   mCT169841"
FT                   /note="gene_id=mCG7769.2 transcript_id=mCT169841.0 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(369472..369669,374724..374978,
FT                   379348..381648))
FT                   /codon_start=1
FT                   /gene="AF529169"
FT                   /locus_tag="mCG_7769"
FT                   /product="cDNA sequence AF529169, isoform CRA_b"
FT                   /note="gene_id=mCG7769.2 transcript_id=mCT6962.2
FT                   protein_id=mCP11578.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q14CG5"
FT                   /db_xref="InterPro:IPR009626"
FT                   /db_xref="MGI:MGI:2667167"
FT                   /db_xref="UniProtKB/TrEMBL:Q14CG5"
FT                   /protein_id="EDL20893.1"
FT                   /translation="MEANQEASLFLVKILEELDSKQNTVSYQDLCKSLCAQFDLSQLAK
FT                   LRSVLFYTACLDPNFPATLFKDKMKCSVNNQQSKKIMVAADIVTIFNLIQMNGGTAKEK
FT                   LPMSCHKVRKKEASFESCRSDTEVCSPTVCEPLNCELSERPFSRGYPTRQSSKCRKMDC
FT                   KECPQFVPASEPNFLLGVSKEVKNRAASLDRLQALSPYSVASPQPCEMQRTYFPMNIEN
FT                   EPMSDQDSLPISQGIKETFISSEEPFVVQSCVQKRNIFKEDFHNLMTVSPSLVGTTNKA
FT                   EEGHGEPQSQKELHKPPFFNHSFEMPYHNQYLNPVYSPIPDKRRAKHESLDDLQASTYF
FT                   GPTPVMGTQDTRRCPGRSSKQTPWPAKSWSLNTEEVPDFERSFFNRNPSEEKLRYPNSG
FT                   SQTPNFSGPDRHPVYLVPKDQQKVLPAGYAVKPNGLKSKEISSPVDLEKHEAVKKFKDK
FT                   SISCTSGQHSSDTSSVGTQTEQHVLDPPKCKDLCTSGQAKYGDRHAMKQSDDDSEIVSD
FT                   DISDIFRFLDDMSISGSTGVIQSSCYNSTGSLSQLHKSDCDSSPEHHLAKITNGVSSGK
FT                   GDKCNRPENVHHSEEELKSSVCKLVLRIGEIERKLESLSGVREEISQVLGKLNKLDQKI
FT                   QQPEKVNVQIDLNSLTSEAPSDDSASPRVFRAHSGSHGPKLENSPDWCCSDASGSNSES
FT                   LRVKALKKSLFTRPSSRSLTEENSATESKIASISNSPRDWRTITYTNRMSLNEEEIKDA
FT                   GPANNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPTSLKGHMKSNPL
FT                   YTDMRLTELAEVKRGQPSWTIEEYARNSGDKGKLTALDLQTQESLNPNNLEYWMEDIYT
FT                   PGYDSLLKRKEAEFRRAKVCKIAALITAAACTVILVIVVPICTMKS"
FT   CDS             complement(join(374352..374363,374724..374978,
FT                   379348..381648))
FT                   /codon_start=1
FT                   /gene="AF529169"
FT                   /locus_tag="mCG_7769"
FT                   /product="cDNA sequence AF529169, isoform CRA_a"
FT                   /note="gene_id=mCG7769.2 transcript_id=mCT169841.0
FT                   protein_id=mCP92500.0 isoform=CRA_a"
FT                   /protein_id="EDL20892.1"
FT                   /translation="MEANQEASLFLVKILEELDSKQNTVSYQDLCKSLCAQFDLSQLAK
FT                   LRSVLFYTACLDPNFPATLFKDKMKCSVNNQQSKKIMVAADIVTIFNLIQMNGGTAKEK
FT                   LPMSCHKVRKKEASFESCRSDTEVCSPTVCEPLNCELSERPFSRGYPTRQSSKCRKMDC
FT                   KECPQFVPASEPNFLLGVSKEVKNRAASLDRLQALSPYSVASPQPCEMQRTYFPMNIEN
FT                   EPMSDQDSLPISQGIKETFISSEEPFVVQSCVQKRNIFKEDFHNLMTVSPSLVGTTNKA
FT                   EEGHGEPQSQKELHKPPFFNHSFEMPYHNQYLNPVYSPIPDKRRAKHESLDDLQASTYF
FT                   GPTPVMGTQDTRRCPGRSSKQTPWPAKSWSLNTEEVPDFERSFFNRNPSEEKLRYPNSG
FT                   SQTPNFSGPDRHPVYLVPKDQQKVLPAGYAVKPNGLKSKEISSPVDLEKHEAVKKFKDK
FT                   SISCTSGQHSSDTSSVGTQTEQHVLDPPKCKDLCTSGQAKYGDRHAMKQSDDDSEIVSD
FT                   DISDIFRFLDDMSISGSTGVIQSSCYNSTGSLSQLHKSDCDSSPEHHLAKITNGVSSGK
FT                   GDKCNRPENVHHSEEELKSSVCKLVLRIGEIERKLESLSGVREEISQVLGKLNKLDQKI
FT                   QQPEKVNVQIDLNSLTSEAPSDDSASPRVFRAHSGSHGPKLENSPDWCCSDASGSNSES
FT                   LRVKALKKSLFTRPSSRSLTEENSATESKIASISNSPRDWRTITYTNRMSLNEEEIKDA
FT                   GPANNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPTSLKGHMKSNPL
FT                   YTDMRLTELAEVKRGQPSWTIEEYARNSGDKGKLTALDLQHVG"
FT   gene            complement(445659..446775)
FT                   /pseudo
FT                   /locus_tag="mCG_1032780"
FT                   /note="gene_id=mCG1032780.1"
FT   mRNA            complement(445659..446775)
FT                   /pseudo
FT                   /locus_tag="mCG_1032780"
FT                   /note="gene_id=mCG1032780.1 transcript_id=mCT150484.1
FT                   created on 06-JUN-2002"
FT   gene            complement(480451..486257)
FT                   /gene="Tmed3"
FT                   /locus_tag="mCG_8113"
FT                   /note="gene_id=mCG8113.2"
FT   mRNA            complement(join(480451..481228,484019..484267,
FT                   485993..486257))
FT                   /gene="Tmed3"
FT                   /locus_tag="mCG_8113"
FT                   /product="transmembrane emp24 domain containing 3"
FT                   /note="gene_id=mCG8113.2 transcript_id=mCT6967.1 created on
FT                   06-JUN-2002"
FT   CDS             complement(join(480992..481228,484019..484267,
FT                   485993..486172))
FT                   /codon_start=1
FT                   /gene="Tmed3"
FT                   /locus_tag="mCG_8113"
FT                   /product="transmembrane emp24 domain containing 3"
FT                   /note="gene_id=mCG8113.2 transcript_id=mCT6967.1
FT                   protein_id=mCP11572.1"
FT                   /protein_id="EDL20894.1"
FT                   /translation="MVHEAPHASSFQMLLQLLLLLLLRAEPLRSAELTFELPDNAKQCF
FT                   HEEVEQGVKFSLDYQVITGGHYDVDCYVEDPRGNVIYRETKKQYDSFTYKTEAKGVYRF
FT                   CFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQT
FT                   HYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPVNRAVHS"
FT   gene            complement(509726..519950)
FT                   /gene="B230218L05Rik"
FT                   /locus_tag="mCG_57578"
FT                   /note="gene_id=mCG57578.2"
FT   mRNA            complement(join(509726..511807,519560..519950))
FT                   /gene="B230218L05Rik"
FT                   /locus_tag="mCG_57578"
FT                   /product="RIKEN cDNA B230218L05"
FT                   /note="gene_id=mCG57578.2 transcript_id=mCT57761.2 created
FT                   on 06-JUN-2002"
FT   CDS             complement(510159..511763)
FT                   /codon_start=1
FT                   /gene="B230218L05Rik"
FT                   /locus_tag="mCG_57578"
FT                   /product="RIKEN cDNA B230218L05"
FT                   /note="gene_id=mCG57578.2 transcript_id=mCT57761.2
FT                   protein_id=mCP33366.2"
FT                   /db_xref="GOA:B2RPW9"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2685617"
FT                   /db_xref="UniProtKB/TrEMBL:B2RPW9"
FT                   /protein_id="EDL20895.1"
FT                   /translation="MMDDDTELRTDGNSLLKAVWLGRLRLTRLLLEGGAYINESNDKGE
FT                   TALMVACITKHVDQQSISKSKMVKYLLDNRADPNIQDKSGKTALIHACIRRAGGEVVSL
FT                   LLENGADPSLEDRTGASALVYAINADDKDALKHLLDACKAKGKEVIIITTDKSSSGTKT
FT                   TKQYLNVPPSPKVEDRQSPPLCTTPSDVELKTSGLASPPSEKDDDFFILQTGHQSGCST
FT                   SKVLNEPGSPTRKVSSLKRARLPQLKRLQSEPWGLIAPSVLAAATRQDETHGTSTDNEV
FT                   IRSINDVTFPKRGPLSRTNSIDSKDPTLFPTVQEQVLKVSASTPASWKAAYEKGQAPHP
FT                   RLARRGTLPLDQEKSGMCPPGPSTLKDPASLKLLENDLYDLDIQPVGDPPNSMSLESGK
FT                   GPLDRKKLNSSHLSLFHGSRESLEVVPSTSPTSVRRRPPHLLERRGSGTLLLDRIAHTR
FT                   PGFLPPLNVNLNPPIPDIRASSKPASPLASGLKSMAPVAPNSPKRVDLRSKKKLLRRHS
FT                   MQIEQMKQLSDFEEIMA"
FT   gene            <584111..587374
FT                   /locus_tag="mCG_56928"
FT                   /note="gene_id=mCG56928.2"
FT   mRNA            join(<584111..584237,586977..587374)
FT                   /locus_tag="mCG_56928"
FT                   /product="mCG56928"
FT                   /note="gene_id=mCG56928.2 transcript_id=mCT57111.2 created
FT                   on 06-JUN-2002"
FT   CDS             join(<584111..584237,586977..587086)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56928"
FT                   /product="mCG56928"
FT                   /note="gene_id=mCG56928.2 transcript_id=mCT57111.2
FT                   protein_id=mCP33369.2"
FT                   /protein_id="EDL20896.1"
FT                   /translation="DWSSREAGLSPGPINGKSAPTGCVRPAAQPLGDYAGVEFWSNDAE
FT                   ETRGAVFDVRQSHAEVWRFYTGDRKHSSLPMSV"
FT   gene            607080..644623
FT                   /locus_tag="mCG_7771"
FT                   /note="gene_id=mCG7771.2"
FT   mRNA            join(607080..607800,610979..611183,614172..614292,
FT                   636990..637099,638984..639059,644404..644623)
FT                   /locus_tag="mCG_7771"
FT                   /product="mCG7771"
FT                   /note="gene_id=mCG7771.2 transcript_id=mCT6963.1 created on
FT                   06-JUN-2002"
FT   CDS             join(607627..607800,610979..611089)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7771"
FT                   /product="mCG7771"
FT                   /note="gene_id=mCG7771.2 transcript_id=mCT6963.1
FT                   protein_id=mCP11573.1"
FT                   /protein_id="EDL20897.1"
FT                   /translation="MRINQEKRLTSRQSTKSSRKQEGLSWASICVNLQTPSTPPTAKAF
FT                   SDHKGAPASCFNITHGTYVCTCIWKPRLNGLLHCSRLSIFKTNSVTEPV"
FT   gene            689569..805984
FT                   /gene="Rasgrf1"
FT                   /locus_tag="mCG_122247"
FT                   /note="gene_id=mCG122247.1"
FT   mRNA            join(689569..690067,703838..703947,724464..724617,
FT                   730651..730746,733544..733797,747091..747170,
FT                   749584..749777,750209..750318,753989..754107,
FT                   755908..756068,759987..760050,760841..760977,
FT                   763508..763590,770715..770963,773932..774308,
FT                   777934..778056,779982..780155,781073..781179,
FT                   781620..781732,783951..784011,788381..788484,
FT                   789503..789587,791868..792065,796144..796223,
FT                   799421..799538,800473..800541,805681..805984)
FT                   /gene="Rasgrf1"
FT                   /locus_tag="mCG_122247"
FT                   /product="RAS protein-specific guanine nucleotide-releasing
FT                   factor 1, transcript variant mCT123463"
FT                   /note="gene_id=mCG122247.1 transcript_id=mCT123463.1
FT                   created on 06-JUN-2002"
FT   mRNA            join(689569..690067,691243..691387,695300..696083)
FT                   /gene="Rasgrf1"
FT                   /locus_tag="mCG_122247"
FT                   /product="RAS protein-specific guanine nucleotide-releasing
FT                   factor 1, transcript variant mCT169837"
FT                   /note="gene_id=mCG122247.1 transcript_id=mCT169837.0
FT                   created on 06-JUN-2002"
FT   CDS             join(689792..690067,703838..703947,724464..724617,
FT                   730651..730746,733544..733797,747091..747170,
FT                   749584..749777,750209..750318,753989..754107,
FT                   755908..756068,759987..760050,760841..760977,
FT                   763508..763590,770715..770963,773932..774308,
FT                   777934..778056,779982..780155,781073..781179,
FT                   781620..781732,783951..784011,788381..788484,
FT                   789503..789587,791868..792065,796144..796223,
FT                   799421..799538,800473..800541,805681..805773)
FT                   /codon_start=1
FT                   /gene="Rasgrf1"
FT                   /locus_tag="mCG_122247"
FT                   /product="RAS protein-specific guanine nucleotide-releasing
FT                   factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG122247.1 transcript_id=mCT123463.1
FT                   protein_id=mCP68723.1 isoform=CRA_a"
FT                   /db_xref="GOA:B2RS27"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001331"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR019804"
FT                   /db_xref="InterPro:IPR023578"
FT                   /db_xref="MGI:MGI:99694"
FT                   /db_xref="UniProtKB/TrEMBL:B2RS27"
FT                   /protein_id="EDL20898.1"
FT                   /translation="MQKAIRLNDGHVVTLGLLAQKDGTRKGYLSKRSADNPKWQTKWFA
FT                   LLQNLLFYFESDSSPRPSGLYLLEGSICKRAPSPKRGTSSKESGEKQQHYFTVNFSNDS
FT                   QKTLELRTEDAKDCDEWVAAIARASYKILATEHEALMQKYLHLLQVVETEKTVAKQLRQ
FT                   QLEDGEVEIERLKTEVTITNLIKDNDRIQSSNKAGSADDEDSDIKKIKKVQSFLRGWLC
FT                   RRKWKNIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSK
FT                   KPPITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEF
FT                   VRNHQYSLQILAHCKQNRDFDKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHEL
FT                   LAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMITEGCEILLDTS
FT                   QTFVRQGSLMQMSLSEKSKSSRGRLGSLSTKKEGERQCFLFSKHLIICTRGSGGKLHLT
FT                   KNGVISLIDCTLLDEPENLDDEAKGAGPEIEHLEFKIGVEPKDSLPFTVILVASTRQEK
FT                   AAWTSDIIQCVDNIRCNGLMMNAFEENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCK
FT                   VLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTNAMVVLDKLINIYRKPMSAIP
FT                   ARSLELLFSSSHNAKLLYGDAPKSPRASRKFSSPPPLAIGTSSPSRRRKLSLNIPIITG
FT                   GKALELASLGCSSDSYANIHSPISPFGKTTLDTGKLCMASSLPKTPEEIDVPATIPEKP
FT                   GELSASRKHSSDVLKEESEDDQNHSDEDNTEVSPVKSPPTPKSFLNRTITEFPFFNYNN
FT                   GILMTTCRDLVDNNRSTLSATSAFAIATAGANEGPSNKEVFRRMSLANTGFSSDQRNID
FT                   KEFVIRRAATNRVLNVLRHWVTKHTQDFDTDDTLKYRVICFLEEVMHDPDLLTQERKAA
FT                   ANIIRTLTLEETTEQHSMLEEVILMTEGVKTEPFENHPALEIAEQLTLLDHLVFKSIPY
FT                   EEFFGQGWMKAEKYERTPYIMKTTKHFNHVSNFIASEIIRNEDISARASAIEKWVAVAD
FT                   ICRCLHNYNAVLEITSSINRSAIFRLKKTWLKVSKQTKSLLDKLQKLVSSDGRFKNLRE
FT                   SLRNCDPPCVPYLGMYLTDLVFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTTY
FT                   KIDPQPKVIQYLLDESFMLDEESLYESSLLIEPKLPT"
FT   CDS             join(689792..690067,691243..691387,695300..695415)
FT                   /codon_start=1
FT                   /gene="Rasgrf1"
FT                   /locus_tag="mCG_122247"
FT                   /product="RAS protein-specific guanine nucleotide-releasing
FT                   factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG122247.1 transcript_id=mCT169837.0
FT                   protein_id=mCP92507.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9QZR7"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:99694"
FT                   /db_xref="UniProtKB/TrEMBL:Q9QZR7"
FT                   /protein_id="EDL20899.1"
FT                   /translation="MQKAIRLNDGHVVTLGLLAQKDGTRKGYLSKRSADNPKWQTKWFA
FT                   LLQNLLFYFESDSSPRPSGLYLLEGSICKRAPSPKRGTSSKESGEKQRHSRSRRRRNVL
FT                   RRQPTRISKTFRLVAIELTGMTATLEVSFSIIRTEIGTVAPAPQTWMGKPEDLTTLRDR
FT                   VESKRLFHHPCRLII"
FT   gene            812279..812883
FT                   /pseudo
FT                   /locus_tag="mCG_1032818"
FT                   /note="gene_id=mCG1032818.1"
FT   mRNA            812279..812883
FT                   /pseudo
FT                   /locus_tag="mCG_1032818"
FT                   /note="gene_id=mCG1032818.1 transcript_id=mCT150522.1
FT                   created on 06-JUN-2002"
FT   gene            833352..855369
FT                   /gene="Ctsh"
FT                   /locus_tag="mCG_7939"
FT                   /note="gene_id=mCG7939.2"
FT   mRNA            join(833352..833684,839773..839804,840813..840918,
FT                   842011..842081,843445..843549,843799..843885,
FT                   844684..844739,846317..846398,847695..847763,
FT                   851109..851215,854148..854273,854962..855369)
FT                   /gene="Ctsh"
FT                   /locus_tag="mCG_7939"
FT                   /product="cathepsin H, transcript variant mCT6964"
FT                   /note="gene_id=mCG7939.2 transcript_id=mCT6964.2 created on
FT                   06-JUN-2002"
FT   CDS             join(833600..833684,839773..839804,840813..840918,
FT                   842011..842081,843445..843549,843799..843885,
FT                   844684..844739,846317..846398,847695..847763,
FT                   851109..851215,854148..854273,854962..855037)
FT                   /codon_start=1
FT                   /gene="Ctsh"
FT                   /locus_tag="mCG_7939"
FT                   /product="cathepsin H, isoform CRA_b"
FT                   /note="gene_id=mCG7939.2 transcript_id=mCT6964.2
FT                   protein_id=mCP11577.2 isoform=CRA_b"
FT                   /db_xref="GOA:P49935"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR013201"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR025661"
FT                   /db_xref="MGI:MGI:107285"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49935"
FT                   /protein_id="EDL20901.1"
FT                   /translation="MWAALPLLCAGAWLLSTGATAELTVNAIEKFHFKSWMKQHQKTYS
FT                   SVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATK
FT                   SNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACGSCWTFSTTGALESAVAIASGKMLSLA
FT                   EQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAF
FT                   VKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAV
FT                   LAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV"
FT   mRNA            join(<833609..833684,839773..839804,840813..840918,
FT                   842011..842081,843799..843885,844684..844739,
FT                   846317..846398,847695..847763,851109..851215,
FT                   854148..854273,854962..>855021)
FT                   /gene="Ctsh"
FT                   /locus_tag="mCG_7939"
FT                   /product="cathepsin H, transcript variant mCT191544"
FT                   /note="gene_id=mCG7939.2 transcript_id=mCT191544.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<833609..833684,839773..839804,840813..840918,
FT                   842011..842081,843799..843885,844684..844739,
FT                   846317..846398,847695..847763,851109..851215,
FT                   854148..854273,854962..>855021)
FT                   /codon_start=1
FT                   /gene="Ctsh"
FT                   /locus_tag="mCG_7939"
FT                   /product="cathepsin H, isoform CRA_a"
FT                   /note="gene_id=mCG7939.2 transcript_id=mCT191544.0
FT                   protein_id=mCP112513.0 isoform=CRA_a"
FT                   /protein_id="EDL20900.1"
FT                   /translation="ALPLLCAGAWLLSTGATAELTVNAIEKFHFKSWMKQHQKTYSSVE
FT                   YNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQGACGSCWTF
FT                   STTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEED
FT                   SYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMY
FT                   KSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNM
FT                   CGLAACASYP"
FT   gene            complement(870932..893921)
FT                   /locus_tag="mCG_7766"
FT                   /note="gene_id=mCG7766.2"
FT   mRNA            complement(join(870932..871663,872995..873079,
FT                   873616..873788,874365..874453,875747..875848,
FT                   876613..876701,877105..877130,879684..879764,
FT                   881541..881627,886470..886537,889361..889407,
FT                   893761..893921))
FT                   /locus_tag="mCG_7766"
FT                   /product="mCG7766, transcript variant mCT6960"
FT                   /note="gene_id=mCG7766.2 transcript_id=mCT6960.2 created on
FT                   06-JUN-2002"
FT   mRNA            complement(join(870932..871663,872995..873079,
FT                   873616..873788,874365..874453,875747..875848,
FT                   876613..876701,877105..877130,879684..879764,
FT                   881541..881627,882896..883012,886470..886537,
FT                   889361..889407,893761..893921))
FT                   /locus_tag="mCG_7766"
FT                   /product="mCG7766, transcript variant mCT169840"
FT                   /note="gene_id=mCG7766.2 transcript_id=mCT169840.0 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(871579..871663,872995..873079,
FT                   873616..873788,874365..874453,875747..875848,
FT                   876613..876701,877105..877130,879684..879764,
FT                   881541..881627,886470..886537,889361..889407,
FT                   893761..893800))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7766"
FT                   /product="mCG7766, isoform CRA_c"
FT                   /note="gene_id=mCG7766.2 transcript_id=mCT6960.2
FT                   protein_id=mCP11579.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q569V4"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR008676"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR017398"
FT                   /db_xref="InterPro:IPR025995"
FT                   /db_xref="InterPro:IPR026541"
FT                   /db_xref="MGI:MGI:1096551"
FT                   /db_xref="UniProtKB/TrEMBL:Q569V4"
FT                   /protein_id="EDL20904.1"
FT                   /translation="MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIH
FT                   YSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQK
FT                   NVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEE
FT                   LKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIK
FT                   EYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDE
FT                   KSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV"
FT   CDS             complement(join(871579..871663,872995..873079,
FT                   873616..873788,874365..874453,875747..875848,
FT                   876613..876701,877105..877130,879684..879764,
FT                   881541..881627,882896..883012,886470..886537,
FT                   889361..889407,893761..893800))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7766"
FT                   /product="mCG7766, isoform CRA_a"
FT                   /note="gene_id=mCG7766.2 transcript_id=mCT169840.0
FT                   protein_id=mCP92506.0 isoform=CRA_a"
FT                   /protein_id="EDL20902.1"
FT                   /translation="MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIH
FT                   YSGWNKKSAVRPRRSEKSLKTREDIVALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKY
FT                   VDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGG
FT                   STSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFY
FT                   LPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQY
FT                   AEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKN
FT                   SATLFSASDYEVAPPEYHRKAV"
FT   mRNA            complement(join(<874400..874453,875747..875848,
FT                   876613..876701,877105..877130,879684..879764,
FT                   881541..881627,893439..>893514))
FT                   /locus_tag="mCG_7766"
FT                   /product="mCG7766, transcript variant mCT191504"
FT                   /note="gene_id=mCG7766.2 transcript_id=mCT191504.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<874400..874453,875747..875848,
FT                   876613..876701,877105..877130,879684..879764,
FT                   881541..881627,893439..>893512))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7766"
FT                   /product="mCG7766, isoform CRA_b"
FT                   /note="gene_id=mCG7766.2 transcript_id=mCT191504.0
FT                   protein_id=mCP112512.0 isoform=CRA_b"
FT                   /protein_id="EDL20903.1"
FT                   /translation="RASALVCLFFRERRKSIEGRCPAGGWDEWVPESRVLKYVDTNLQK
FT                   QRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQ
FT                   PPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNV
FT                   DSILEDYA"
FT   gene            898205..900110
FT                   /locus_tag="mCG_1032781"
FT                   /note="gene_id=mCG1032781.1"
FT   mRNA            join(898205..899540,899648..900110)
FT                   /locus_tag="mCG_1032781"
FT                   /product="mCG1032781"
FT                   /note="gene_id=mCG1032781.1 transcript_id=mCT150485.1
FT                   created on 14-AUG-2002"
FT   CDS             898263..899138
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032781"
FT                   /product="mCG1032781"
FT                   /note="gene_id=mCG1032781.1 transcript_id=mCT150485.1
FT                   protein_id=mCP68899.1"
FT                   /protein_id="EDL20905.1"
FT                   /translation="MAKGRVADRSPTEMLHSTPAGDRAVRTQGSAAPGSKDHLNEKPCA
FT                   EAGSARTSLLILVSIFSCAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSK
FT                   YKDTFYVQILVAYFATYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFC
FT                   YMLSYLVGRPVVYKYLTEKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVI
FT                   NVPLKVFFIGTFLGVAPPSFVAIKAGTTLYQLTTAGEAVSWSSVFILMVLTLLSILPAI
FT                   FQKKLKQKFE"
FT   gene            complement(934421..>937777)
FT                   /locus_tag="mCG_144694"
FT                   /note="gene_id=mCG144694.0"
FT   mRNA            complement(934421..>937777)
FT                   /locus_tag="mCG_144694"
FT                   /product="mCG144694"
FT                   /note="gene_id=mCG144694.0 transcript_id=mCT184118.1
FT                   created on 25-AUG-2003"
FT   CDS             complement(935915..>936241)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144694"
FT                   /product="mCG144694"
FT                   /note="gene_id=mCG144694.0 transcript_id=mCT184118.1
FT                   protein_id=mCP105885.0"
FT                   /protein_id="EDL20906.1"
FT                   /translation="SQHLGGRGRRISEFEASLVYKVSSRTARAIQRNPVSKRQKKKTKQ
FT                   KGDSIIYPLFYYSFNIPISPFFFSTPLSLHKKESVEHRFLIPGSWFCAPRWVTDIKVTF
FT                   IHLK"
FT   gene            <949503..978144
FT                   /gene="Adamts7"
FT                   /locus_tag="mCG_7768"
FT                   /note="gene_id=mCG7768.2"
FT   mRNA            join(<949503..949858,951693..951858,952615..952721,
FT                   955855..955938,956225..956349,957405..957554,
FT                   958706..958852,963789..963933,964512..964604,
FT                   964974..965119,966321..966490,966711..966844,
FT                   967671..967791,968899..969143,969416..969551,
FT                   969887..970013,970432..970645,970950..972320,
FT                   973209..973361,973728..973901,973982..974128,
FT                   975051..975213,977764..978144)
FT                   /gene="Adamts7"
FT                   /locus_tag="mCG_7768"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 7"
FT                   /note="gene_id=mCG7768.2 transcript_id=mCT6961.2 created on
FT                   06-JUN-2002"
FT   CDS             join(<949505..949858,951693..951858,952615..952721,
FT                   955855..955938,956225..956349,957405..957554,
FT                   958706..958852,963789..963933,964512..964604,
FT                   964974..965119,966321..966490,966711..966844,
FT                   967671..967791,968899..969143,969416..969551,
FT                   969887..970013,970432..970645,970950..972320,
FT                   973209..973361,973728..973901,973982..974128,
FT                   975051..975213,977764..977921)
FT                   /codon_start=1
FT                   /gene="Adamts7"
FT                   /locus_tag="mCG_7768"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 7"
FT                   /note="gene_id=mCG7768.2 transcript_id=mCT6961.2
FT                   protein_id=mCP11576.2"
FT                   /protein_id="EDL20907.1"
FT                   /translation="LVTEGRAGLDIVHPVRVDAGGSFLSYELWPRVLRKRDVSTTQASS
FT                   AFYQLQYQGRELLFNLTTNPYLMAPGFVSEIRRHSTLGHAHIQTSVPTCHLLGDVQDPE
FT                   LEGGFAAISACDGLRGVFQLSNEDYFIEPLDGVSAQPGHAQPHVVYKHQGSRKQAQQGD
FT                   SRPSGTCGMQVSKEKWVETLVVADSKMVEYHGQPQVESYVLTIMNMVAGLFHDPSIGNP
FT                   IHISIVRLIILEDEEKDLKITHHAEETLKNFCRWQKNINIKGDDHPQHHDTAILLTRKD
FT                   LCASMNQPCETLGLSHVSGLCHPQLSCSVSEDTGMPLAFTVAHELGHSFGIQHDGTGND
FT                   CESIGKRPFIMSPQLLYDRGIPLTWSRCSREYITRFLDRGWGLCLDDRPSKDVIALPSV
FT                   LPGVLYDVNHQCRLQYGSHSAYCEDMDDVCHTLWCSVGTTCHSKLDAAVDGTSCGKNKW
FT                   CLKGECVPEGFQPEAVDGGWSGWSAWSDCSRSCGVGVRSSERQCTQPVPKNRGKYCVGE
FT                   RKRSQLCNLPACPPDRPSFRHTQCSQFDGMLYKGKLHKWVPVPNDDNPCELHCRPSNSS
FT                   NTEKLRDAVVDGTPCYQSRISRDICLNGICKNVGCDFVIDSGAEEDRCGVCRGDGSTCQ
FT                   TVSRTFKETEGQGYVDIGLIPAGAREILIEEVAEAANFLALRSEDPDKYFLNGGWTIQW
FT                   NGDYRVAGTTFTYARKGNWENLTSPGPTSEPVWIQLLFQEKNPGVHYQYTIQRDSHDQV
FT                   RPPEFSWHYGPWSKCTVTCGTGVQRQSLYCMERQAGVVAEEYCNTLNRPDERQRKCSEE
FT                   PCPPRWWAGEWQPCSRSCGPEGLSRRAVFCIRSMGLDEQRALELSACEHLPRPLAETPC
FT                   NRHVICPSTWGVGNWSQCSVTCGAGIRQRSVLCINNTDVPCDEAERPITETFCFLQPCQ
FT                   YPMYIVDTGASGSGSSSPELFNEVDFIPNQLAPRPSPASSPKPVSISNAIDEEELDPPG
FT                   PVFVDDFYYDYNFINFHEDLSYGSFEEPHPDLVDNGGWTAPPHIRPTESPSDTPVPTAG
FT                   ALGAEAEDIQGSWSPSPLLSEASYSPPVLEQTSINPLANFLTEEDTPMGAPELGFPSLP
FT                   WPPASVDDMMTPVGPGNPDELLVKEDEQSPPSTPWSDRNKLSTDGNPLGHTSPALPQSP
FT                   IPTQPSPPSISPTQASPSPDVVEVSTGWNVAWDPVLEADLKPGHGELPSTVEVASPPLL
FT                   PMATVPGIWGRDSPLEPGTPTFSSPELSSQHLKTLTMPGTLLLTVPTDLRSPGPSGQPQ
FT                   TPNLEGTQSPGLLPTPARETQTNSSKDPEVQPLQPSLEEDGDPADPLPARNASWQVGNW
FT                   SQCSTTCGLGAIWRLVSCSSGNDEDCTLASRPQPARHCHLRPCAAWRTGNWSKCSRNCG
FT                   GGSSTRDVQCVDTRDLRPLRPFHCQPGPTKPPNRQLCGTQPCLPWYTSSWRECSEACGG
FT                   GEQQRLVTCPEPGLCEESLRPNNSRPCNTHPCTQWVVGPWGQCSAPCGGGVQRRLVRCV
FT                   NTQTGLAEEDSDLCSHEAWPESSRPCATEDCELVEPPRCERDRLSFNFCETLRLLGRCQ
FT                   LPTIRAQCCRSCPPLSRGVPSRGHQRVARR"
FT   gene            complement(980112..1048967)
FT                   /gene="Tbc1d2b"
FT                   /locus_tag="mCG_140508"
FT                   /note="gene_id=mCG140508.1"
FT   mRNA            complement(join(980112..983272,985823..985944,
FT                   987718..987903,993531..993648,996713..997207,
FT                   1000360..1000553,1001492..1001602,1004073..1004456,
FT                   1005382..1005626,1006995..1007158,1019088..1019256,
FT                   1027870..1028023,1048437..1048527,1048844..1048967))
FT                   /gene="Tbc1d2b"
FT                   /locus_tag="mCG_140508"
FT                   /product="TBC1 domain family, member 2B"
FT                   /note="gene_id=mCG140508.1 transcript_id=mCT169836.1
FT                   created on 04-JUN-2003"
FT   CDS             complement(join(983077..983272,985823..985944,
FT                   987718..987903,993531..993648,996713..997207,
FT                   1000360..1000553,1001492..1001602,1004073..1004456,
FT                   1005382..1005626,1006995..1007158,1019088..1019256,
FT                   1027870..1028005))
FT                   /codon_start=1
FT                   /gene="Tbc1d2b"
FT                   /locus_tag="mCG_140508"
FT                   /product="TBC1 domain family, member 2B"
FT                   /note="gene_id=mCG140508.1 transcript_id=mCT169836.1
FT                   protein_id=mCP92503.1"
FT                   /protein_id="EDL20908.1"
FT                   /translation="MTYWLQELQQKRWEYCNSLDMMKWDSRTSPTPGDFPKGLVARDTT
FT                   DIISQHPNPSAEKARTVLAVEAAPGELVGDRAAHQPAPGHPNPINFYSLKQWGNELKNS
FT                   MSSFRPGRGHSESRRTVFYTNEEWELLDPPPKDLEESLVPEERKKPMPEGSKGVASSGF
FT                   PFEFGRNPYKGKRPLKDIIGSYKNRHSSSDPLLEGTATSSGSSGGPTKPVPEMQLQIQS
FT                   QQEELEQLKKDLSSQKELIRLLQQTVRSSQYDKYFTNPQISQGVPGDTLELLHQKDEQI
FT                   LGLSGQLERFGLEKESLQQEVRTLKSKVGELNERLGMLMETIQAKDEVIIKLSACEGSV
FT                   SSPTLGPSSPLAIPASKDQLELDRLKDSLQGYKSQNKFLNKEILELSALRRNAERRERD
FT                   LMAKYSSLEAKLCQVESKYLILLQEMKTPVCSEEQGPARDVIAQLLEDALQVESQEQPE
FT                   QAFVKPHLVSEFDIYGFRTVPDDDEEEKLVAKVRALDLKTLYLTDNQEVSTGVKWENYF
FT                   ASTMNREMACSPELKNLIRAGIPHEHRSKVWKWCVDRHTRKFKDSMEPDYFQTLLQKAL
FT                   EKQNPASKQIELDLLRTLPNNKHYSSPTSEGIQKLRSVLLAFSWRNPDIGYCQGLNRLV
FT                   AVALLYLDQEDAFWCLVTIVEVFMPRDYYTKTLLGSQVDQRVFRDLLSEKLPRLHTHFE
FT                   QYKVDYTLITFNWFLVVFVDSVVSDILFKIWDSFLYEGPKVIFRFALALFKYKEEEILK
FT                   LQDSMSIFKYLRYFTRTILDARKLISISFGDLNPFPLRQIRNRRAYHLEKVRLELTELE
FT                   AIREDFLRERDTSPDKGELVSDEEEDT"
FT   gene            complement(999303..999723)
FT                   /pseudo
FT                   /locus_tag="mCG_7767"
FT                   /note="gene_id=mCG7767.1"
FT   mRNA            complement(999303..999723)
FT                   /pseudo
FT                   /locus_tag="mCG_7767"
FT                   /note="gene_id=mCG7767.1 transcript_id=mCT6969.1 created on
FT                   06-JUN-2002"
FT   gene            complement(1511524..1512113)
FT                   /pseudo
FT                   /locus_tag="mCG_50289"
FT                   /note="gene_id=mCG50289.2"
FT   mRNA            complement(1511524..1512113)
FT                   /pseudo
FT                   /locus_tag="mCG_50289"
FT                   /note="gene_id=mCG50289.2 transcript_id=mCT50472.2 created
FT                   on 07-JUN-2002"
FT   gene            complement(1512713..1512963)
FT                   /pseudo
FT                   /locus_tag="mCG_1032782"
FT                   /note="gene_id=mCG1032782.1"
FT   mRNA            complement(1512713..1512963)
FT                   /pseudo
FT                   /locus_tag="mCG_1032782"
FT                   /note="gene_id=mCG1032782.1 transcript_id=mCT150486.1
FT                   created on 07-JUN-2002"
FT   gene            complement(1525809..1526105)
FT                   /pseudo
FT                   /locus_tag="mCG_1032823"
FT                   /note="gene_id=mCG1032823.1"
FT   mRNA            complement(1525809..1526105)
FT                   /pseudo
FT                   /locus_tag="mCG_1032823"
FT                   /note="gene_id=mCG1032823.1 transcript_id=mCT150527.1
FT                   created on 07-JUN-2002"
FT   gene            complement(1526900..1527108)
FT                   /pseudo
FT                   /locus_tag="mCG_1032824"
FT                   /note="gene_id=mCG1032824.1"
FT   mRNA            complement(1526900..1527108)
FT                   /pseudo
FT                   /locus_tag="mCG_1032824"
FT                   /note="gene_id=mCG1032824.1 transcript_id=mCT150528.1
FT                   created on 07-JUN-2002"
FT   gene            complement(1597459..>1603114)
FT                   /locus_tag="mCG_145339"
FT                   /note="gene_id=mCG145339.0"
FT   mRNA            complement(join(1597459..1598272,1601708..1601944,
FT                   1603007..>1603114))
FT                   /locus_tag="mCG_145339"
FT                   /product="mCG145339"
FT                   /note="gene_id=mCG145339.0 transcript_id=mCT184763.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(1597794..>1598096)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145339"
FT                   /product="mCG145339"
FT                   /note="gene_id=mCG145339.0 transcript_id=mCT184763.0
FT                   protein_id=mCP105887.0"
FT                   /protein_id="EDL20909.1"
FT                   /translation="DFTVSHWTLYHSKCVNVKISPPSLSILARISTSVLSGMIPSGVNL
FT                   RFLEFFEIKHLRNVASEQWKFFSGSIVWTFFFQDFCFLPCKVFLKTTEMQQIRGV"
FT   gene            complement(1673897..1674278)
FT                   /pseudo
FT                   /locus_tag="mCG_1032783"
FT                   /note="gene_id=mCG1032783.1"
FT   mRNA            complement(1673897..1674278)
FT                   /pseudo
FT                   /locus_tag="mCG_1032783"
FT                   /note="gene_id=mCG1032783.1 transcript_id=mCT150487.1
FT                   created on 07-JUN-2002"
FT   gene            1856878..1858478
FT                   /pseudo
FT                   /locus_tag="mCG_4263"
FT                   /note="gene_id=mCG4263.1"
FT   mRNA            1856878..1858478
FT                   /pseudo
FT                   /locus_tag="mCG_4263"
FT                   /note="gene_id=mCG4263.1 transcript_id=mCT3059.1 created on
FT                   07-JUN-2002"
FT   gene            1975845..1976378
FT                   /pseudo
FT                   /locus_tag="mCG_1032763"
FT                   /note="gene_id=mCG1032763.1"
FT   mRNA            1975845..1976378
FT                   /pseudo
FT                   /locus_tag="mCG_1032763"
FT                   /note="gene_id=mCG1032763.1 transcript_id=mCT150467.1
FT                   created on 07-JUN-2002"
FT   gene            complement(2115331..2122643)
FT                   /gene="Zic1"
FT                   /locus_tag="mCG_68156"
FT                   /note="gene_id=mCG68156.2"
FT   mRNA            complement(join(2115331..2116619,2117312..2117475,
FT                   2118884..2120335,2122587..2122643))
FT                   /gene="Zic1"
FT                   /locus_tag="mCG_68156"
FT                   /product="zinc finger protein of the cerebellum 1"
FT                   /note="gene_id=mCG68156.2 transcript_id=mCT68342.2 created
FT                   on 11-JUN-2002"
FT   CDS             complement(join(2116422..2116619,2117312..2117475,
FT                   2118884..2119865))
FT                   /codon_start=1
FT                   /gene="Zic1"
FT                   /locus_tag="mCG_68156"
FT                   /product="zinc finger protein of the cerebellum 1"
FT                   /note="gene_id=mCG68156.2 transcript_id=mCT68342.2
FT                   protein_id=mCP43350.2 partial"
FT                   /db_xref="GOA:P46684"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:106683"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46684"
FT                   /protein_id="EDL20910.1"
FT                   /translation="MLLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMG
FT                   AFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFNSTRDFLFRN
FT                   RGFGDAAAAASAQHSLFAASAGGFGGPHGHTDAAGHLLFSGLHEQAAGHASPNVVNGQM
FT                   RLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGAGAFFRYMRQPIK
FT                   QELICKWIEPEQLANPKKSCNKTFSTMHELVTHVTVEHVGGPEQSNHICFWEECPREGK
FT                   PFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCD
FT                   RRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSSQGSQPSPAASS
FT                   GYESSTPPTIVSPTTDNPTTSSMSPSSSAVHHTAGHSALSSNFNEWYV"
FT   gene            2123457..2142820
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /note="gene_id=mCG4264.2"
FT   mRNA            join(2123457..2123525,2127237..2127321,2133495..2134112,
FT                   2138660..2138975,2141197..2142820)
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4,
FT                   transcript variant mCT170017"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170017.0 created
FT                   on 12-JUN-2002"
FT   mRNA            join(2123601..2123857,2127237..2127321,2133495..2134112,
FT                   2138660..2138975,2141197..2142820)
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4,
FT                   transcript variant mCT170016"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170016.0 created
FT                   on 12-JUN-2002"
FT   mRNA            join(2124802..2125455,2127237..2127321,2133495..2134112,
FT                   2138660..2138975,2141197..2142820)
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4,
FT                   transcript variant mCT170019"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170019.0 created
FT                   on 12-JUN-2002"
FT   mRNA            join(2125633..2125738,2127237..2127321,2133495..2134112,
FT                   2138660..2138975,2141197..2142820)
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4,
FT                   transcript variant mCT170020"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170020.0 created
FT                   on 12-JUN-2002"
FT   CDS             join(2127252..2127321,2133495..2134112,2138660..2138975,
FT                   2141197)
FT                   /codon_start=1
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170016.0
FT                   protein_id=mCP92501.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3UYE7"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:107201"
FT                   /db_xref="UniProtKB/TrEMBL:G3UYE7"
FT                   /protein_id="EDL20911.1"
FT                   /translation="MKYKTSLVMRKRLRLYRNTLKESSSSCGHHGPQLAASSNPSVLPG
FT                   LHEQPPQASHSRPLNGLLRLGIPGDMYARSEPFAPGPMARSDTLATATALHGYGGMNLT
FT                   MNLTAPHGPGAFFRYMRQPIKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHV
FT                   GGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLK
FT                   IHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSL
FT                   RKHMKVHGRSPPPSSGYDSAITSALASPSLESGREPSVACSAAVVVRGTDVSE"
FT   CDS             join(2127252..2127321,2133495..2134112,2138660..2138975,
FT                   2141197)
FT                   /codon_start=1
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170017.0
FT                   protein_id=mCP92504.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3UYE7"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:107201"
FT                   /db_xref="UniProtKB/TrEMBL:G3UYE7"
FT                   /protein_id="EDL20912.1"
FT                   /translation="MKYKTSLVMRKRLRLYRNTLKESSSSCGHHGPQLAASSNPSVLPG
FT                   LHEQPPQASHSRPLNGLLRLGIPGDMYARSEPFAPGPMARSDTLATATALHGYGGMNLT
FT                   MNLTAPHGPGAFFRYMRQPIKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHV
FT                   GGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLK
FT                   IHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSL
FT                   RKHMKVHGRSPPPSSGYDSAITSALASPSLESGREPSVACSAAVVVRGTDVSE"
FT   CDS             join(2127252..2127321,2133495..2134112,2138660..2138975,
FT                   2141197)
FT                   /codon_start=1
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170019.0
FT                   protein_id=mCP92508.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3UYE7"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:107201"
FT                   /db_xref="UniProtKB/TrEMBL:G3UYE7"
FT                   /protein_id="EDL20914.1"
FT                   /translation="MKYKTSLVMRKRLRLYRNTLKESSSSCGHHGPQLAASSNPSVLPG
FT                   LHEQPPQASHSRPLNGLLRLGIPGDMYARSEPFAPGPMARSDTLATATALHGYGGMNLT
FT                   MNLTAPHGPGAFFRYMRQPIKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHV
FT                   GGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLK
FT                   IHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSL
FT                   RKHMKVHGRSPPPSSGYDSAITSALASPSLESGREPSVACSAAVVVRGTDVSE"
FT   CDS             join(2127252..2127321,2133495..2134112,2138660..2138975,
FT                   2141197)
FT                   /codon_start=1
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170020.0
FT                   protein_id=mCP92502.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3UYE7"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:107201"
FT                   /db_xref="UniProtKB/TrEMBL:G3UYE7"
FT                   /protein_id="EDL20915.1"
FT                   /translation="MKYKTSLVMRKRLRLYRNTLKESSSSCGHHGPQLAASSNPSVLPG
FT                   LHEQPPQASHSRPLNGLLRLGIPGDMYARSEPFAPGPMARSDTLATATALHGYGGMNLT
FT                   MNLTAPHGPGAFFRYMRQPIKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHV
FT                   GGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLK
FT                   IHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSL
FT                   RKHMKVHGRSPPPSSGYDSAITSALASPSLESGREPSVACSAAVVVRGTDVSE"
FT   mRNA            join(2132962..2134112,2138660..2139044)
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4,
FT                   transcript variant mCT3060"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT3060.1 created on
FT                   12-JUN-2002"
FT   CDS             join(2133404..2134112,2138660..2139012)
FT                   /codon_start=1
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT3060.1
FT                   protein_id=mCP18364.1 isoform=CRA_c"
FT                   /protein_id="EDL20916.1"
FT                   /translation="MRLGRVCPRGPGKVRSPRHRFSCTLFVSTTGSSCGHHGPQLAASS
FT                   NPSVLPGLHEQPPQASHSRPLNGLLRLGIPGDMYARSEPFAPGPMARSDTLATATALHG
FT                   YGGMNLTMNLTAPHGPGAFFRYMRQPIKQELICKWLGDDSPMSPRPCSKTFSTMHELVT
FT                   HVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVF
FT                   ARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKC
FT                   YTHPSSLRKHMKVHGRSPPPSSGYDSAITSALASPSLESGREPSVACSAAVVVRGTDVS
FT                   EWYVCSGAWTSGG"
FT   mRNA            join(2137054..2137129,2138660..2138975,2141197..2142820)
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4,
FT                   transcript variant mCT170018"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170018.0 created
FT                   on 12-JUN-2002"
FT   CDS             join(2137072..2137129,2138660..2138975,2141197)
FT                   /codon_start=1
FT                   /gene="Zic4"
FT                   /locus_tag="mCG_4264"
FT                   /product="zinc finger protein of the cerebellum 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4264.2 transcript_id=mCT170018.0
FT                   protein_id=mCP92510.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C5L0"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:107201"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C5L0"
FT                   /protein_id="EDL20913.1"
FT                   /translation="MAAGNIFQRTLVYQLYYREGEKPFRCEFEGCERRFANSSDRKKHS
FT                   HVHTSDKPYMCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSAITSALASPSLESG
FT                   REPSVACSAAVVVRGTDVSE"
FT   gene            2470559..2470895
FT                   /pseudo
FT                   /locus_tag="mCG_1032784"
FT                   /note="gene_id=mCG1032784.1"
FT   mRNA            2470559..2470895
FT                   /pseudo
FT                   /locus_tag="mCG_1032784"
FT                   /note="gene_id=mCG1032784.1 transcript_id=mCT150488.1
FT                   created on 12-JUN-2002"
FT   gene            2954668..2959350
FT                   /pseudo
FT                   /locus_tag="mCG_17677"
FT                   /note="gene_id=mCG17677.1"
FT   mRNA            join(2954668..2954728,2955612..2955836,2956839..2956996,
FT                   2959189..2959350)
FT                   /pseudo
FT                   /locus_tag="mCG_17677"
FT                   /note="gene_id=mCG17677.1 transcript_id=mCT14798.1 created
FT                   on 12-JUN-2002"
FT   gene            3000990..3023768
FT                   /locus_tag="mCG_17676"
FT                   /note="gene_id=mCG17676.2"
FT   mRNA            join(3000990..3001600,3009259..3009285,3010485..3010565,
FT                   3014244..3014488,3015857..3015899,3017602..3017822,
FT                   3017923..3018084,3021026..3021187,3022736..3023768)
FT                   /locus_tag="mCG_17676"
FT                   /product="mCG17676"
FT                   /note="gene_id=mCG17676.2 transcript_id=mCT14797.1 created
FT                   on 12-JUN-2002"
FT   CDS             join(3009273..3009285,3010485..3010565,3014244..3014488,
FT                   3015857..3015899,3017602..3017822,3017923..3018084,
FT                   3021026..3021187,3022736..3022795)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17676"
FT                   /product="mCG17676"
FT                   /note="gene_id=mCG17676.2 transcript_id=mCT14797.1
FT                   protein_id=mCP21276.1"
FT                   /protein_id="EDL20917.1"
FT                   /translation="MENHSKQTEAPHPGTYMPAGYPPPYPPAAFQGPSDHAAYPIPQAG
FT                   YQGPPGPYPGPQPGYPVPPGGYAGGGPSGFPVQNQPAYNHPGGPGGTPWMPAPPPPLNC
FT                   PPGLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCC
FT                   GASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVPVGYVTQTWHPC
FT                   LPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFELKSLDEESVVGKISKQWSGFVREAFT
FT                   DADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGAWQ"
FT   gene            3026902..3049312
FT                   /gene="Plscr2"
FT                   /locus_tag="mCG_17683"
FT                   /note="gene_id=mCG17683.2"
FT   mRNA            join(3026902..3027236,3033698..3033778,3039152..3039384,
FT                   3041243..3041285,3042219..3042439,3042557..3042718,
FT                   3047100..3047261,3048757..3049312)
FT                   /gene="Plscr2"
FT                   /locus_tag="mCG_17683"
FT                   /product="phospholipid scramblase 2"
FT                   /note="gene_id=mCG17683.2 transcript_id=mCT14803.2 created
FT                   on 17-JUN-2002"
FT   CDS             join(3033706..3033778,3039152..3039384,3041243..3041285,
FT                   3042219..3042439,3042557..3042718,3047100..3047261,
FT                   3048757..3048786)
FT                   /codon_start=1
FT                   /gene="Plscr2"
FT                   /locus_tag="mCG_17683"
FT                   /product="phospholipid scramblase 2"
FT                   /note="gene_id=mCG17683.2 transcript_id=mCT14803.2
FT                   protein_id=mCP21356.2"
FT                   /db_xref="GOA:Q9DCW2"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="MGI:MGI:1270860"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCW2"
FT                   /protein_id="EDL20918.1"
FT                   /translation="MEAPRSGTYLPAGYAPQYPPAAVQGPPEHTGRPTFQTNYQVPQSG
FT                   YPGPQASYTVSTSGHEGYAATRLPIQNNQTIVLANTQWMPAPPPILNCPPGLEYLNQID
FT                   QLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRIL
FT                   DHLGQEVMTLERPLKCSSCCFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKR
FT                   ENVLKVVGPCVACTCCSDIDFEIKSLDEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPL
FT                   DLEVKMKAVTLGACFLIDYMFFEGCE"
FT   gene            3060983..3116631
FT                   /locus_tag="mCG_17678"
FT                   /note="gene_id=mCG17678.2"
FT   mRNA            join(3060983..3061038,3096444..3096676,3100805..3100847,
FT                   3108230..3108450,3111299..3111460,3113305..3113466,
FT                   3116457..3116631)
FT                   /locus_tag="mCG_17678"
FT                   /product="mCG17678, transcript variant mCT14799"
FT                   /note="gene_id=mCG17678.2 transcript_id=mCT14799.2 created
FT                   on 17-JUN-2002"
FT   mRNA            join(3060983..3061038,3077985..3078093,3078178..3078745)
FT                   /locus_tag="mCG_17678"
FT                   /product="mCG17678, transcript variant mCT170121"
FT                   /note="gene_id=mCG17678.2 transcript_id=mCT170121.0 created
FT                   on 17-JUN-2002"
FT   CDS             join(3061006..3061038,3077985..3078093,3078178..3078335)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17678"
FT                   /product="mCG17678, isoform CRA_b"
FT                   /note="gene_id=mCG17678.2 transcript_id=mCT170121.0
FT                   protein_id=mCP93086.0 isoform=CRA_b"
FT                   /protein_id="EDL20920.1"
FT                   /translation="MKASLPSITSKILRISLLNLSESSARTPFQLRLYHTWQPFACCFS
FT                   CSGPAWDSNLLRPASGSHVWVRAWKASWNLEEKTESRRREKGWNQDNSLIRVQF"
FT   CDS             join(3096620..3096676,3100805..3100847,3108230..3108450,
FT                   3111299..3111460,3113305..3113466,3116457..3116510)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17678"
FT                   /product="mCG17678, isoform CRA_a"
FT                   /note="gene_id=mCG17678.2 transcript_id=mCT14799.2
FT                   protein_id=mCP21296.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V0U0"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="MGI:MGI:1925709"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V0U0"
FT                   /protein_id="EDL20919.1"
FT                   /translation="MAINTTSYGVPPGLEYLLHIDHIMIQQQFEFVEAVLGFETANRYK
FT                   INDKLGQKVYYAAEDFNFLTLNCCGAIRPFTMRIFDNSGREVITLRRPLRCDCCCCPCC
FT                   LQQIEIQAPPGVPVGYVIQTWHPCRPKFTVQNEEKQDVLKIIGPICVCNIGGSIDFEIK
FT                   SLDEEFVVGRISKHWSGILKEILTDVDTFGIQFPLDLDVKMKAVMLGACFLIDFMFFES
FT                   GGGQRPKLFW"
FT   gene            3205445..3240715
FT                   /gene="Plscr4"
FT                   /locus_tag="mCG_17679"
FT                   /note="gene_id=mCG17679.2"
FT   mRNA            join(3205445..3205992,3219721..3219748,3220902..3221012,
FT                   3230612..3230835,3231749..3231791,3232648..3232874,
FT                   3236793..3236954,3238152..3238310,3238960..3240715)
FT                   /gene="Plscr4"
FT                   /locus_tag="mCG_17679"
FT                   /product="phospholipid scramblase 4"
FT                   /note="gene_id=mCG17679.2 transcript_id=mCT14800.2 created
FT                   on 20-JUN-2002"
FT   CDS             join(3219742..3219748,3220902..3221012,3230612..3230835,
FT                   3231749..3231791,3232648..3232874,3236793..3236954,
FT                   3238152..3238310,3238960..3239007)
FT                   /codon_start=1
FT                   /gene="Plscr4"
FT                   /locus_tag="mCG_17679"
FT                   /product="phospholipid scramblase 4"
FT                   /note="gene_id=mCG17679.2 transcript_id=mCT14800.2
FT                   protein_id=mCP21334.1"
FT                   /protein_id="EDL20921.1"
FT                   /translation="MSGLVPTAPEQPTEEMENQIKSPTAVPDAPPDYNSHFAPGPAGPV
FT                   ASPSAGLPMGYYIPQQPGAIPLYHPTGGTHPIQYQPGKYPVTNQPAPIMWMAGPAPVPN
FT                   CPPGLEYLAQLDNIHVLQHVEPLELMTRFETNNRYDIKNNIDQMVYIVTEDTDDFTRNA
FT                   YRNLRPFVLRVTDCLGREIMTMQRPFRCTCCCFCCPCARQELEVQCPPGVTIGFVAEHW
FT                   NLCRASYSIQNEKKESMMRVRGPCATYGCGSDSVFEINSLDGVSNIGSIIRKWNGFLST
FT                   MVNADHFEIRFPLALDVKMKAMIFGSCFLIDFMYFERPPPRRMSR"
FT   gene            3289365..3356472
FT                   /gene="Plod2"
FT                   /locus_tag="mCG_17682"
FT                   /note="gene_id=mCG17682.2"
FT   mRNA            join(3289365..3290757,3319421..3319512,3321637..3321773,
FT                   3329209..3329372,3332498..3332610,3334857..3334920,
FT                   3336619..3336716,3339318..3339419,3341763..3341888,
FT                   3343280..3343401,3344354..3344458,3346606..3346731,
FT                   3348759..3348900,3350003..3350065,3350966..3351079,
FT                   3352827..3352892,3353421..3353525,3354556..3354702,
FT                   3354812..3354937,3355123..3356472)
FT                   /gene="Plod2"
FT                   /locus_tag="mCG_17682"
FT                   /product="procollagen lysine, 2-oxoglutarate 5-dioxygenase
FT                   2, transcript variant mCT170122"
FT                   /note="gene_id=mCG17682.2 transcript_id=mCT170122.0 created
FT                   on 20-JUN-2002"
FT   mRNA            join(3289365..3290757,3319421..3319512,3321637..3321773,
FT                   3329209..3329372,3332498..3332610,3334857..3334920,
FT                   3336619..3336716,3339318..3339419,3341763..3341888,
FT                   3343280..3343401,3344354..3344458,3346606..3346731,
FT                   3348759..3348900,3350966..3351079,3352827..3352892,
FT                   3353421..3353525,3354556..3354702,3354812..3354937,
FT                   3355123..3356472)
FT                   /gene="Plod2"
FT                   /locus_tag="mCG_17682"
FT                   /product="procollagen lysine, 2-oxoglutarate 5-dioxygenase
FT                   2, transcript variant mCT14804"
FT                   /note="gene_id=mCG17682.2 transcript_id=mCT14804.2 created
FT                   on 20-JUN-2002"
FT   CDS             join(3290649..3290757,3319421..3319512,3321637..3321773,
FT                   3329209..3329372,3332498..3332610,3334857..3334920,
FT                   3336619..3336716,3339318..3339419,3341763..3341888,
FT                   3343280..3343401,3344354..3344458,3346606..3346731,
FT                   3348759..3348900,3350003..3350065,3350966..3351079,
FT                   3352827..3352892,3353421..3353525,3354556..3354702,
FT                   3354812..3354937,3355123..3355278)
FT                   /codon_start=1
FT                   /gene="Plod2"
FT                   /locus_tag="mCG_17682"
FT                   /product="procollagen lysine, 2-oxoglutarate 5-dioxygenase
FT                   2, isoform CRA_b"
FT                   /note="gene_id=mCG17682.2 transcript_id=mCT170122.0
FT                   protein_id=mCP93089.0 isoform=CRA_b"
FT                   /protein_id="EDL20923.1"
FT                   /translation="MGDRGARPGRLMPMLALLSWAAGLGVAEETPGRIPADKLLVITVA
FT                   TKENDGFHRFMNSAKYFNYTVKVLGQGQEWRGGDGMNSIGGGQKVRLLKEAMEHYASQE
FT                   DLVILFTECFDVVFAGGPEEVLKKFQKTNHKIVFAADGLLWPDKRLADKYPVVHIGKRY
FT                   LNSGGFIGYAPYISRLVQQWNLQDNDDDQLFYTKVYIDPLKREAFNITLDHKCKIFQAL
FT                   NGATDEVVLKFENGKSRVKNTFYETLPVAINGNGPTKILLNYFGNYVPNSWTQENGCAL
FT                   CDVDTIDLSTVDVPPKVTLGVFIEQPTPFLPRFLNLLLTLDYPKEALQLFIHNKEVYHE
FT                   KDIKVFVDKAKHDISSIKIVGPEENLSQAEARNMGMDFCRQDEKCDYYFSVDADVVLTN
FT                   PRTLKILIEQNRKIIAPLVTRHGKLWSNFWGALSPDGYYARSEDYVDIVQGNRVGIWNV
FT                   PYMANVYLIQGKTLRSEMNERNYFVRDKLDPDMALCRNARDMTLQREKDSPTPETFQML
FT                   SPPKGVFMYISNRHEFGRLISTANYNTSHLNNDFWQIFENPVDWKEKYINRDYSKIFTE
FT                   NIVEQPCPDVFWFPIFSERACDELVEEMEHYGKWSGGKHHDSRISGGYENVPTDDIHMK
FT                   QIGLENVWLHFIREFIAPVTLKVFAGYYTKGFALLNFVVKYSPERQRSLRPHHDASTFT
FT                   INIALNNVGEDFQGGGCKFLRYNCSIESPRKGWSFMHPGRLTHLHEGLPVKNGTRYIAV
FT                   SFIDP"
FT   CDS             join(3290649..3290757,3319421..3319512,3321637..3321773,
FT                   3329209..3329372,3332498..3332610,3334857..3334920,
FT                   3336619..3336716,3339318..3339419,3341763..3341888,
FT                   3343280..3343401,3344354..3344458,3346606..3346731,
FT                   3348759..3348900,3350966..3351079,3352827..3352892,
FT                   3353421..3353525,3354556..3354702,3354812..3354937,
FT                   3355123..3355278)
FT                   /codon_start=1
FT                   /gene="Plod2"
FT                   /locus_tag="mCG_17682"
FT                   /product="procollagen lysine, 2-oxoglutarate 5-dioxygenase
FT                   2, isoform CRA_a"
FT                   /note="gene_id=mCG17682.2 transcript_id=mCT14804.2
FT                   protein_id=mCP21326.1 isoform=CRA_a"
FT                   /protein_id="EDL20922.1"
FT                   /translation="MGDRGARPGRLMPMLALLSWAAGLGVAEETPGRIPADKLLVITVA
FT                   TKENDGFHRFMNSAKYFNYTVKVLGQGQEWRGGDGMNSIGGGQKVRLLKEAMEHYASQE
FT                   DLVILFTECFDVVFAGGPEEVLKKFQKTNHKIVFAADGLLWPDKRLADKYPVVHIGKRY
FT                   LNSGGFIGYAPYISRLVQQWNLQDNDDDQLFYTKVYIDPLKREAFNITLDHKCKIFQAL
FT                   NGATDEVVLKFENGKSRVKNTFYETLPVAINGNGPTKILLNYFGNYVPNSWTQENGCAL
FT                   CDVDTIDLSTVDVPPKVTLGVFIEQPTPFLPRFLNLLLTLDYPKEALQLFIHNKEVYHE
FT                   KDIKVFVDKAKHDISSIKIVGPEENLSQAEARNMGMDFCRQDEKCDYYFSVDADVVLTN
FT                   PRTLKILIEQNRKIIAPLVTRHGKLWSNFWGALSPDGYYARSEDYVDIVQGNRVGIWNV
FT                   PYMANVYLIQGKTLRSEMNERNYFVRDKLDPDMALCRNARDMGVFMYISNRHEFGRLIS
FT                   TANYNTSHLNNDFWQIFENPVDWKEKYINRDYSKIFTENIVEQPCPDVFWFPIFSERAC
FT                   DELVEEMEHYGKWSGGKHHDSRISGGYENVPTDDIHMKQIGLENVWLHFIREFIAPVTL
FT                   KVFAGYYTKGFALLNFVVKYSPERQRSLRPHHDASTFTINIALNNVGEDFQGGGCKFLR
FT                   YNCSIESPRKGWSFMHPGRLTHLHEGLPVKNGTRYIAVSFIDP"
FT   gene            complement(3360549..3361015)
FT                   /pseudo
FT                   /locus_tag="mCG_140572"
FT                   /note="gene_id=mCG140572.0"
FT   mRNA            complement(3360549..3361015)
FT                   /pseudo
FT                   /locus_tag="mCG_140572"
FT                   /note="gene_id=mCG140572.0 transcript_id=mCT170123.0
FT                   created on 20-JUN-2002"
FT   gene            3434836..3435701
FT                   /pseudo
FT                   /locus_tag="mCG_65277"
FT                   /note="gene_id=mCG65277.2"
FT   mRNA            3434836..3435701
FT                   /pseudo
FT                   /locus_tag="mCG_65277"
FT                   /note="gene_id=mCG65277.2 transcript_id=mCT65460.2 created
FT                   on 20-JUN-2002"
FT   gene            3460315..3534557
FT                   /locus_tag="mCG_117698"
FT                   /note="gene_id=mCG117698.1"
FT   mRNA            join(3460315..3460540,3461640..3461938,3487973..3488084)
FT                   /locus_tag="mCG_117698"
FT                   /product="mCG117698, transcript variant mCT118842"
FT                   /note="gene_id=mCG117698.1 transcript_id=mCT118842.1
FT                   created on 20-JUN-2002"
FT   mRNA            join(3461574..3461938,3512290..3512354,3520471..3520546,
FT                   3522596..3522691,3533450..3534557)
FT                   /locus_tag="mCG_117698"
FT                   /product="mCG117698, transcript variant mCT170120"
FT                   /note="gene_id=mCG117698.1 transcript_id=mCT170120.0
FT                   created on 20-JUN-2002"
FT   mRNA            join(3461574..3461938,3487973..3488228)
FT                   /locus_tag="mCG_117698"
FT                   /product="mCG117698, transcript variant mCT170119"
FT                   /note="gene_id=mCG117698.1 transcript_id=mCT170119.0
FT                   created on 20-JUN-2002"
FT   CDS             join(3461832..3461938,3512290..3512354,3520471..3520538)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117698"
FT                   /product="mCG117698, isoform CRA_b"
FT                   /note="gene_id=mCG117698.1 transcript_id=mCT170120.0
FT                   protein_id=mCP93088.0 isoform=CRA_b"
FT                   /protein_id="EDL20926.1"
FT                   /translation="MCLSEVKWSSTLGKTWRNEENKWLKQNALQWRDKKRLFLLCEAVH
FT                   SVLLKDHVSMLSGLPRRHCSEFRLYPAESAELSC"
FT   CDS             join(3461832..3461938,3487973..3488063)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117698"
FT                   /product="mCG117698, isoform CRA_a"
FT                   /note="gene_id=mCG117698.1 transcript_id=mCT118842.1
FT                   protein_id=mCP68512.1 isoform=CRA_a"
FT                   /protein_id="EDL20924.1"
FT                   /translation="MCLSEVKWSSTLGKTWRNEENKWLKQNALQWRDKKRRKGDQKRAT
FT                   DALLREQPQIVPVLSQRRMS"
FT   CDS             join(3461832..3461938,3487973..3488063)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117698"
FT                   /product="mCG117698, isoform CRA_a"
FT                   /note="gene_id=mCG117698.1 transcript_id=mCT170119.0
FT                   protein_id=mCP93081.0 isoform=CRA_a"
FT                   /protein_id="EDL20925.1"
FT                   /translation="MCLSEVKWSSTLGKTWRNEENKWLKQNALQWRDKKRRKGDQKRAT
FT                   DALLREQPQIVPVLSQRRMS"
FT   gene            3634787..3654722
FT                   /locus_tag="mCG_1032846"
FT                   /note="gene_id=mCG1032846.1"
FT   mRNA            join(3634787..3635465,3654530..3654722)
FT                   /locus_tag="mCG_1032846"
FT                   /product="mCG1032846"
FT                   /note="gene_id=mCG1032846.1 transcript_id=mCT150550.1
FT                   created on 20-JUN-2002"
FT   CDS             3654608..3654709
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032846"
FT                   /product="mCG1032846"
FT                   /note="gene_id=mCG1032846.1 transcript_id=mCT150550.1
FT                   protein_id=mCP68790.1"
FT                   /protein_id="EDL20927.1"
FT                   /translation="MFMDKYSHTNTPSLLHPHRYSCTFTIHIERMNK"
FT   gene            3716954..3717269
FT                   /pseudo
FT                   /locus_tag="mCG_1032787"
FT                   /note="gene_id=mCG1032787.1"
FT   mRNA            3716954..3717269
FT                   /pseudo
FT                   /locus_tag="mCG_1032787"
FT                   /note="gene_id=mCG1032787.1 transcript_id=mCT150491.1
FT                   created on 20-JUN-2002"
FT   gene            complement(3720630..3747564)
FT                   /locus_tag="mCG_140570"
FT                   /note="gene_id=mCG140570.0"
FT   mRNA            complement(join(3720630..3720969,3721440..3721567,
FT                   3745624..3745722,3747515..3747564))
FT                   /locus_tag="mCG_140570"
FT                   /product="mCG140570"
FT                   /note="gene_id=mCG140570.0 transcript_id=mCT170113.0
FT                   created on 20-JUN-2002"
FT   CDS             complement(join(3721536..3721567,3745624..3745722,
FT                   3747515..3747539))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140570"
FT                   /product="mCG140570"
FT                   /note="gene_id=mCG140570.0 transcript_id=mCT170113.0
FT                   protein_id=mCP93078.0"
FT                   /protein_id="EDL20928.1"
FT                   /translation="MLTQFPTQVVDGLLLPRLDRLPSCCCAQEPLLIHLLVTAHRAHKP
FT                   DERPTK"
FT   gene            complement(3906706..3907534)
FT                   /pseudo
FT                   /locus_tag="mCG_140573"
FT                   /note="gene_id=mCG140573.0"
FT   mRNA            complement(3906706..3907534)
FT                   /pseudo
FT                   /locus_tag="mCG_140573"
FT                   /note="gene_id=mCG140573.0 transcript_id=mCT170125.0
FT                   created on 20-JUN-2002"
FT   gene            complement(3907574..3908135)
FT                   /pseudo
FT                   /locus_tag="mCG_140574"
FT                   /note="gene_id=mCG140574.0"
FT   mRNA            complement(3907574..3908135)
FT                   /pseudo
FT                   /locus_tag="mCG_140574"
FT                   /note="gene_id=mCG140574.0 transcript_id=mCT170126.0
FT                   created on 20-JUN-2002"
FT   gene            complement(3908385..3909050)
FT                   /pseudo
FT                   /locus_tag="mCG_140575"
FT                   /note="gene_id=mCG140575.0"
FT   mRNA            complement(3908385..3909050)
FT                   /pseudo
FT                   /locus_tag="mCG_140575"
FT                   /note="gene_id=mCG140575.0 transcript_id=mCT170127.0
FT                   created on 20-JUN-2002"
FT   gene            complement(3909379..3909877)
FT                   /pseudo
FT                   /locus_tag="mCG_140576"
FT                   /note="gene_id=mCG140576.0"
FT   mRNA            complement(3909379..3909877)
FT                   /pseudo
FT                   /locus_tag="mCG_140576"
FT                   /note="gene_id=mCG140576.0 transcript_id=mCT170124.0
FT                   created on 20-JUN-2002"
FT   gene            complement(4122217..4123209)
FT                   /pseudo
FT                   /locus_tag="mCG_49401"
FT                   /note="gene_id=mCG49401.1"
FT   mRNA            complement(4122217..4123209)
FT                   /pseudo
FT                   /locus_tag="mCG_49401"
FT                   /note="gene_id=mCG49401.1 transcript_id=mCT49584.1 created
FT                   on 20-JUN-2002"
FT   gene            complement(5123646..5124185)
FT                   /pseudo
FT                   /locus_tag="mCG_57755"
FT                   /note="gene_id=mCG57755.2"
FT   mRNA            complement(5123646..5124185)
FT                   /pseudo
FT                   /locus_tag="mCG_57755"
FT                   /note="gene_id=mCG57755.2 transcript_id=mCT57938.2 created
FT                   on 01-JUL-2002"
FT   gene            complement(5232027..5252002)
FT                   /locus_tag="mCG_21613"
FT                   /note="gene_id=mCG21613.2"
FT   mRNA            complement(join(5232027..5234805,5238570..5238873,
FT                   5251365..5252002))
FT                   /locus_tag="mCG_21613"
FT                   /product="mCG21613"
FT                   /note="gene_id=mCG21613.2 transcript_id=mCT19626.2 created
FT                   on 01-JUL-2002"
FT   CDS             complement(join(5234474..5234805,5238570..5238873,
FT                   5251365..5251940))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21613"
FT                   /product="mCG21613"
FT                   /note="gene_id=mCG21613.2 transcript_id=mCT19626.2
FT                   protein_id=mCP21383.2"
FT                   /protein_id="EDL20929.1"
FT                   /translation="MLLHSPSLLASWQRNELADRRFLQLNKCPACFGTSWCRRFLNGQV
FT                   GFETWGRLRLLDFLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATG
FT                   RPRCDLLQAMPRTEFARLNGDVRLLTPEAVEGWSDLVHCPSQRLLDRLVRRYAETKDSG
FT                   SFLLRNLKDSERMQLLLTLAFNPEPLVLQSFPSDEGWPFAKYLGACGRMVAVNYVGEEL
FT                   WSYFNAPWEKRVDLAWQLMEIAEQLTNNDFEFALYLLDVSFDNFAVGPRDGKVIIVDAE
FT                   NVLVADKRLIRQNKPENWDVWYESKFDDCDKEACLSFSKEILCARVTVDHNYYAVCQNL
FT                   LSRHATWRGTSGGLLHDPPSEIAKDGRLEALLDECTNPKKRYGRFQAAKELRGYLAQLS
FT                   HNVR"
FT   gene            5383375..5945963
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /note="gene_id=mCG10249.2"
FT   mRNA            join(5383375..5383719,5398526..5398728,5433241..5433318,
FT                   5434792..5434868,5531005..5531120,5576532..5576637,
FT                   5652394..5652503,5655519..5655653,5676464..5676552,
FT                   5735027..5735140,5736523..5736634,5769901..5770054,
FT                   5838341..5838363,5853248..5853356,5942712..5942817,
FT                   5944360..5945963)
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, transcript variant mCT10470"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT10470.2 created
FT                   on 01-JUL-2002"
FT   mRNA            join(5383375..5383719,5398526..5398728,5433241..5433318,
FT                   5434792..5434868,5439286..5439719)
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, transcript variant mCT19625"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT19625.2 created
FT                   on 01-JUL-2002"
FT   mRNA            join(<5383391..5383719,5398526..5398728,5433241..5433318,
FT                   5434792..5434868,5531005..5531120,5576532..5576637,
FT                   5652394..5652532,5655548..5655653,5676464..5676552,
FT                   5735027..5735140,5736523..5736634,5769901..5770054,
FT                   5838341..5838396,5853281..5853356,5942712..5942817,
FT                   5944360..5944970)
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, transcript variant mCT191538"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT191538.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<5383521..5383719,5398526..5398728,5433241..5433318,
FT                   5434792..5434868,5531005..5531120,5576532..5576637,
FT                   5652394..5652532,5655548..5655653,5676464..5676552,
FT                   5735027..5735140,5736523..5736634,5769901..5770054,
FT                   5838341..5838396,5853281..5853356,5942712..5942817,
FT                   5944360..5944587)
FT                   /codon_start=1
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, isoform CRA_c"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT191538.0
FT                   protein_id=mCP112461.0 isoform=CRA_c"
FT                   /protein_id="EDL20932.1"
FT                   /translation="ASQSVEWRMAGQLRFTSGKDEDHFQHQGAVELLAFNFLLILTILT
FT                   IWLFKNHRFRFLHETGGAMVYGLIMGLILRYATAPTDIDSGTVYNCGNLFFSPSTLLVN
FT                   ITDQVYEYKYQREINQHNISPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHF
FT                   FQNLGSILTYAFLGTAISCVVIGLIMYGFVKAMVHAGQLKSGDFHFTDCLFFGSLMSAT
FT                   DPVTVLAIFHELHVDPDLYTLLFGESVLNDAVAIVLTYSISIYSPKENPNAFDTAAFFQ
FT                   SVGNFLGIFAGSFAMGSAYAVVTALLTKFTKLREFPMLETGLFFLLSWSAFLSAEAAGL
FT                   TGIVAVLFCGVTQAHYTYNNLSSDSKLRTKQLFEFMNFLAENVIFCYMGLALFTFQNHI
FT                   FNALFILGAFLAIFVARACNIYPLSFLLNLGRKQKIPWNFQHMMMFSGLRGAIAFALAI
FT                   RNTESQPKQMMFTTTLLLVFFTVWVFGGGTTPMLTWLQIRVGVDLDESLKEEPSSQQAT
FT                   NKLDKNMTKTESAQLFRMWYGFDHKYLKPILTHSGPPLTTTLPAWCGPVSRLLTSPQAY
FT                   GEQLKEDDVECIVNQDELAMNYQEQSPSPSSPTTKLALDQKSSGQTPGKENIYEGDLGL
FT                   GGYDLKLEQTRGQPQMD"
FT   CDS             join(5383545..5383719,5398526..5398728,5433241..5433318,
FT                   5434792..5434868,5531005..5531120,5576532..5576637,
FT                   5652394..5652503,5655519..5655653,5676464..5676552,
FT                   5735027..5735140,5736523..5736634,5769901..5770054,
FT                   5838341..5838363,5853248..5853356,5942712..5942817,
FT                   5944360..5944587)
FT                   /codon_start=1
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, isoform CRA_a"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT10470.2
FT                   protein_id=mCP21277.2 isoform=CRA_a"
FT                   /protein_id="EDL20930.1"
FT                   /translation="MAGQLRFTSGKDEDHFQHQGAVELLAFNFLLILTILTIWLFKNHR
FT                   FRFLHETGGAMVYGLIMGLILRYATAPTDIDSGTVYNCGNLFFSPSTLLVNITDQVYEY
FT                   KYQREINQHNISPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSIL
FT                   TYAFLGTAISCVVIGLIMYGFVKAMVHAGQLKSGDFHFTDCLFFGSLMSATDPVTVLAI
FT                   FHELHVDPDLYTLLFGESVLNDAVAIVLTYSISIYSPKENPNAFDTAAFFQSVGNFLGI
FT                   FAGSFAMVVDFLNTPCHLTKFTKLREFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLF
FT                   CGVTQAHYTYNNLSSDSKLRTKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILG
FT                   AFLAIFVARACNIYPLSFLLNLGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPK
FT                   QMMFTTTLLLVFFTVWVFGGGTTPMLTWLQIRVGVDLDENVPFSMVSFQEANKLDKNMT
FT                   KTESAQLFRMWYGFDHKYLKPILTHSGPPLTTTLPAWCGPVSRLLTSPQAYGEQLKEDD
FT                   VECIVNQDELAMNYQEQSPSPSSPTTKLALDQKSSGQTPGKENIYEGDLGLGGYDLKLE
FT                   QTRGQPQMD"
FT   CDS             join(5383545..5383719,5398526..5398728,5433241..5433318,
FT                   5434792..5434868,5439286..5439292)
FT                   /codon_start=1
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, isoform CRA_d"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT19625.2
FT                   protein_id=mCP21273.2 isoform=CRA_d"
FT                   /protein_id="EDL20933.1"
FT                   /translation="MAGQLRFTSGKDEDHFQHQGAVELLAFNFLLILTILTIWLFKNHR
FT                   FRFLHETGGAMVYGLIMGLILRYATAPTDIDSGTVYNCGNLFFSPSTLLVNITDQVYEY
FT                   KYQREINQHNISPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSIL
FT                   TYAFLGTAISCVVIGT"
FT   gene            complement(5417561..5424172)
FT                   /locus_tag="mCG_147716"
FT                   /note="gene_id=mCG147716.0"
FT   mRNA            complement(join(5417561..5419144,5424009..5424172))
FT                   /locus_tag="mCG_147716"
FT                   /product="mCG147716"
FT                   /note="gene_id=mCG147716.0 transcript_id=mCT187979.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(5418522..5418944)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147716"
FT                   /product="mCG147716"
FT                   /note="gene_id=mCG147716.0 transcript_id=mCT187979.0
FT                   protein_id=mCP108542.0"
FT                   /protein_id="EDL20934.1"
FT                   /translation="MTLCFYYSRHRGISAPQFLCKPGNCFEFALSLAGSAMNCVYSFPI
FT                   IRSHQGATGLGKLNWEGLSQQKAGSEQAGWRGREGKECTLTSAESMMKMRQYIFTWCVC
FT                   LQHRAGNKEHLTSSIGPPQTSQSRASKCRQGQMSQC"
FT   mRNA            join(5837020..5837269,5837355..5837392,5838341..5839890)
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, transcript variant mCT170543"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT170543.0 created
FT                   on 01-JUL-2002"
FT   CDS             join(5837180..5837269,5837355..5837392,5838341..5838500)
FT                   /codon_start=1
FT                   /gene="Slc9a9"
FT                   /locus_tag="mCG_10249"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 9, isoform CRA_b"
FT                   /note="gene_id=mCG10249.2 transcript_id=mCT170543.0
FT                   protein_id=mCP93461.0 isoform=CRA_b"
FT                   /protein_id="EDL20931.1"
FT                   /translation="MRYTEPEAILENENSVLFDACQNGDAEMYSISMTGLHGASQSGVG
FT                   VDLDESLKEEPSSQQASSIKSWIKHGLVHCSSVLLEYIAKGAISKMGCLC"
FT   gene            complement(6131265..6134771)
FT                   /gene="Chst2"
FT                   /locus_tag="mCG_10245"
FT                   /note="gene_id=mCG10245.2"
FT   mRNA            complement(join(6131265..6134237,6134341..6134771))
FT                   /gene="Chst2"
FT                   /locus_tag="mCG_10245"
FT                   /product="carbohydrate sulfotransferase 2"
FT                   /note="gene_id=mCG10245.2 transcript_id=mCT10464.2 created
FT                   on 21-JUN-2002"
FT   CDS             complement(6132450..6134042)
FT                   /codon_start=1
FT                   /gene="Chst2"
FT                   /locus_tag="mCG_10245"
FT                   /product="carbohydrate sulfotransferase 2"
FT                   /note="gene_id=mCG10245.2 transcript_id=mCT10464.2
FT                   protein_id=mCP21286.2 partial"
FT                   /protein_id="EDL20935.1"
FT                   /translation="MSRSSAGALPPGALPRPLPAAPAAVQRALLPPWPRRAGRRWPASP
FT                   LGMKVFRRKALVLCAGYALLLVLTMLNLLDYKWHKEPLQQCNPDGPLGAAVGAAGAGWG
FT                   RPGSPPAAPPRAHSRMDPRTPYRPPAAGVGAVPAAAAGSAGAAASLGNATRGTRGGGDK
FT                   RQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDAVSLQGAARDMLSA
FT                   LYRCDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCK
FT                   KCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLKDPALDLKVIHLVRDPRAVASS
FT                   RIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGMGGPADYHALGAMEVIC
FT                   NSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNM
FT                   TSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEV
FT                   KDLSKTLLRKPRL"
FT   gene            complement(6183235..6238472)
FT                   /gene="2610101N10Rik"
FT                   /locus_tag="mCG_140571"
FT                   /note="gene_id=mCG140571.0"
FT   mRNA            complement(join(6183235..6188195,6189355..6189531,
FT                   6191012..6191130,6193199..6193309,6198693..6198852,
FT                   6201082..6201148,6201915..6202010,6202820..6202976,
FT                   6204113..6204235,6205981..6206068,6208362..6208441,
FT                   6208801..6208963,6210884..6211043,6211118..6211188,
FT                   6212275..6212379,6215385..6215428,6216339..6216550,
FT                   6216729..6216894,6217730..6217812,6217907..6217939,
FT                   6218021..6218115,6218963..6219030,6219737..6219870,
FT                   6220342..6220456,6222474..6222572,6227443..6227574,
FT                   6229295..6229339,6238404..6238472))
FT                   /gene="2610101N10Rik"
FT                   /locus_tag="mCG_140571"
FT                   /product="RIKEN cDNA 2610101N10"
FT                   /note="gene_id=mCG140571.0 transcript_id=mCT170118.0
FT                   created on 21-JUN-2002"
FT   CDS             complement(join(6188057..6188195,6189355..6189531,
FT                   6191012..6191130,6193199..6193309,6198693..6198852,
FT                   6201082..6201148,6201915..6202010,6202820..6202976,
FT                   6204113..6204235,6205981..6206068,6208362..6208441,
FT                   6208801..6208963,6210884..6211043,6211118..6211188,
FT                   6212275..6212379,6215385..6215428,6216339..6216550,
FT                   6216729..6216894,6217730..6217812,6217907..6217939,
FT                   6218021..6218115,6218963..6219030,6219737..6219870,
FT                   6220342..6220456,6222474..6222572,6227443..6227574,
FT                   6229295..6229339,6238404..6238448))
FT                   /codon_start=1
FT                   /gene="2610101N10Rik"
FT                   /locus_tag="mCG_140571"
FT                   /product="RIKEN cDNA 2610101N10"
FT                   /note="gene_id=mCG140571.0 transcript_id=mCT170118.0
FT                   protein_id=mCP93092.0"
FT                   /protein_id="EDL20936.1"
FT                   /translation="MADKTPGGSQKASSKNRSSDVHSSGSSDAHMDASGPSDSDMPSRT
FT                   RPKSPRKHNYRNESSRESLCDSPHQNLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEEL
FT                   KKKEDEKAAAEIYEEFLAAFEGSDGNKVKTFVRGGVVNAAKDEHETDEKRGKIYKPSSR
FT                   FADQKNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERH
FT                   KTKGRLSRFEPPQSDSDGQRRSMDVPSRRNRSSVLDDYAPGSHDVGDPSTTNLYLGNIN
FT                   PQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGK
FT                   MIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLP
FT                   PPKNKEDFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMF
FT                   RFLFENQTPAHVYYRWKLYSILQANSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEE
FT                   QETEAFVEEPSKKGALKEEQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCI
FT                   TESLSILKTPLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRT
FT                   IQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLVNIIEEKETEDVPDDLD
FT                   GAPIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIF
FT                   KVAPSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEEDTQSSKSEE
FT                   HHLYSNPVREEATESKFSKYSEMSEEKRAKLREIELKVMKFQDELESGKRPKKPGQSFQ
FT                   EQVEHYRDKLLQREKEKELERERERDKKDKEKLESRSKDKKEKDECTPTRKERKRRHST
FT                   SPSPSRSSSGRRVKSPSPKSERSERSERSHKESSRSRSSHKDSPRDASKKAKRSPSGSR
FT                   TPKRSRRSRSRSPKKSGKKSRSQSRSPHRSHKKSKKNKH"
FT   gene            6368545..6426397
FT                   /gene="Pcolce2"
FT                   /locus_tag="mCG_10247"
FT                   /note="gene_id=mCG10247.2"
FT   mRNA            join(6368545..6368790,6369569..6369677,6400604..6400859,
FT                   6408939..6409063,6412137..6412273,6417537..6417691,
FT                   6423710..6423793,6425473..6425640,6425815..6426397)
FT                   /gene="Pcolce2"
FT                   /locus_tag="mCG_10247"
FT                   /product="procollagen C-endopeptidase enhancer 2"
FT                   /note="gene_id=mCG10247.2 transcript_id=mCT10467.2 created
FT                   on 21-JUN-2002"
FT   CDS             join(6368711..6368790,6369569..6369677,6400604..6400859,
FT                   6408939..6409063,6412137..6412273,6417537..6417691,
FT                   6423710..6423793,6425473..6425640,6425815..6425945)
FT                   /codon_start=1
FT                   /gene="Pcolce2"
FT                   /locus_tag="mCG_10247"
FT                   /product="procollagen C-endopeptidase enhancer 2"
FT                   /note="gene_id=mCG10247.2 transcript_id=mCT10467.2
FT                   protein_id=mCP21251.1"
FT                   /protein_id="EDL20937.1"
FT                   /translation="MGGASACIPLCLLLATARMARPQTPERPVFTCGGILTGESGFIGS
FT                   EGFPGMYPPNSKCTWKITVPEGKVVVLNFRFIDLENDNLCRYDFVDVYNGHANGQRIGR
FT                   FCGTFRPGSLVASGNKMTVQMISDANTAGSGFMATYSAAAPDGKGDRYCGGRLEKPSGT
FT                   FKTPNWPDRDYPVGVTCVWHIIAPKNQLIELKFEKFDVERDNYCRYDYVAVFNGGEVND
FT                   AKRIGKYCGDSPPVPIVSERNELLIQFLSDLSLTADGFIGHYKFRPKKFPTTTTTPVTT
FT                   TLPVTTGLKPTVALCQQKCRRMGTLESNYCSSNFVLAGTVITTVTRGGSLHATVSIISI
FT                   YREGNLAIQQAGKNMSVKLTVVCRQCPLLRRGLNYIIMGQVGEDGRGKIMPNSFVKMFK
FT                   NKNQKPMNALKNKQC"
FT   gene            complement(6435917..6481204)
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /note="gene_id=mCG10244.2"
FT   mRNA            complement(join(6435917..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6480514..6481204))
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, transcript variant mCT170116"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT170116.0 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(6435917..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6467673..6467774,
FT                   6480514..6481204))
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, transcript variant mCT170115"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT170115.0 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(6435917..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6474044..6474198,
FT                   6480514..6481204))
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, transcript variant mCT170117"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT170117.0 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(6435917..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6467673..6467774,
FT                   6474044..6474198,6480514..6481204))
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, transcript variant mCT10465"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT10465.1 created
FT                   on 21-JUN-2002"
FT   CDS             complement(join(6437590..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6474044..6474198,
FT                   6480514..6480733))
FT                   /codon_start=1
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, isoform CRA_d"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT170117.0
FT                   protein_id=mCP93079.0 isoform=CRA_d"
FT                   /db_xref="GOA:B7ZMP6"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002153"
FT                   /db_xref="InterPro:IPR004729"
FT                   /db_xref="InterPro:IPR005457"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR013555"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:109528"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZMP6"
FT                   /protein_id="EDL20941.1"
FT                   /translation="MGAPPPSPGLPPSWAAMMAALYPSTDLSGVSSSSLPSSPSSSSPN
FT                   EVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAV
FT                   TITIENESLDILQLLLDYGCQKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQ
FT                   DVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFEL
FT                   SADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRG
FT                   LLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVG
FT                   IFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMG
FT                   PALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVA
FT                   HNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQ
FT                   DFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFAL
FT                   FWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIA
FT                   NHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVK
FT                   RQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKF
FT                   RNEIRDLLGFRTSKYAMFYPRN"
FT   CDS             complement(join(6437590..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6467673..6467774,
FT                   6474044..6474198,6480514..6480733))
FT                   /codon_start=1
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, isoform CRA_a"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT10465.1
FT                   protein_id=mCP21288.1 isoform=CRA_a"
FT                   /db_xref="GOA:B2RPS7"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002153"
FT                   /db_xref="InterPro:IPR004729"
FT                   /db_xref="InterPro:IPR005457"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR013555"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:109528"
FT                   /db_xref="UniProtKB/TrEMBL:B2RPS7"
FT                   /protein_id="EDL20938.1"
FT                   /translation="MGAPPPSPGLPPSWAAMMAALYPSTDLSGVSSSSLPSSPSSSSPN
FT                   EVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAV
FT                   TITIENESLDILQLLLDYGCQSADALLVAIDSEVVGAVDILLNHRPKRSSRPTIVKLME
FT                   RIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDS
FT                   LRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQC
FT                   KMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQ
FT                   SNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTP
FT                   FMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRL
FT                   WYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGL
FT                   FAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYD
FT                   KGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQS
FT                   FVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTL
FT                   PPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCC
FT                   LVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPRN"
FT   CDS             complement(join(6437590..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6480514..6480546))
FT                   /codon_start=1
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, isoform CRA_c"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT170116.0
FT                   protein_id=mCP93087.0 isoform=CRA_c"
FT                   /protein_id="EDL20940.1"
FT                   /translation="MRSFSCWRATRKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTM
FT                   LLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILR
FT                   AFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPL
FT                   DKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTV
FT                   LTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKK
FT                   NTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFAL
FT                   KVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMG
FT                   QMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGT
FT                   CFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSF
FT                   QLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSK
FT                   GKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQD
FT                   LSKFRNEIRDLLGFRTSKYAMFYPRN"
FT   CDS             complement(join(6437590..6437817,6439051..6439245,
FT                   6439496..6439697,6440966..6441141,6446934..6447077,
FT                   6448371..6448510,6451984..6452320,6453946..6454141,
FT                   6457278..6457409,6462860..6463062,6467673..6467774,
FT                   6480514..6480546))
FT                   /codon_start=1
FT                   /gene="Trpc1"
FT                   /locus_tag="mCG_10244"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 1, isoform CRA_b"
FT                   /note="gene_id=mCG10244.2 transcript_id=mCT170115.0
FT                   protein_id=mCP93083.0 isoform=CRA_b"
FT                   /protein_id="EDL20939.1"
FT                   /translation="MRSFSCWRATRSADALLVAIDSEVVGAVDILLNHRPKRSSRPTIV
FT                   KLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKN
FT                   KKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEEL
FT                   ARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKE
FT                   FVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRI
FT                   IHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSD
FT                   IKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLV
FT                   AEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLT
FT                   QLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGE
FT                   ELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDD
FT                   KCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQK
FT                   VMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPR
FT                   N"
FT   gene            complement(6483493..6575418)
FT                   /locus_tag="mCG_10241"
FT                   /note="gene_id=mCG10241.2"
FT   mRNA            complement(join(6483493..6485283,6485507..6485631,
FT                   6492146..6492269,6492767..6492900,6496544..6496658,
FT                   6499570..6499648,6503994..6504189,6505785..6505880,
FT                   6506943..6507085,6507166..6507331,6512952..6513033,
FT                   6514684..6514816,6516074..6516203,6517517..6517680,
FT                   6526262..6526366,6575310..6575418))
FT                   /locus_tag="mCG_10241"
FT                   /product="mCG10241, transcript variant mCT10461"
FT                   /note="gene_id=mCG10241.2 transcript_id=mCT10461.2 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(6483493..6485283,6485507..6485631,
FT                   6492146..6492269,6492767..6492900,6496544..6496658,
FT                   6499570..6499648,6503994..6504189,6505785..6505880,
FT                   6506943..6507085,6507166..6507331,6512952..6513033,
FT                   6514765..6514816,6516074..6516203,6517517..6517680,
FT                   6526262..6526366,6545738..6545898))
FT                   /locus_tag="mCG_10241"
FT                   /product="mCG10241, transcript variant mCT170114"
FT                   /note="gene_id=mCG10241.2 transcript_id=mCT170114.0 created
FT                   on 21-JUN-2002"
FT   CDS             complement(join(6485148..6485283,6485507..6485631,
FT                   6492146..6492269,6492767..6492900,6496544..6496658,
FT                   6499570..6499648,6503994..6504189,6505785..6505880,
FT                   6506943..6507085,6507166..6507331,6512952..6513033,
FT                   6514765..6514816,6516074..6516203,6517517..6517680,
FT                   6526262..6526331))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10241"
FT                   /product="mCG10241, isoform CRA_a"
FT                   /note="gene_id=mCG10241.2 transcript_id=mCT170114.0
FT                   protein_id=mCP93085.0 isoform=CRA_a"
FT                   /protein_id="EDL20942.1"
FT                   /translation="MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASL
FT                   PLPGYKVREIVEKILVVADNNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITA
FT                   IGGTSSISSEGTQHSYSEEEKVAFVNWINKALENDKMINLSEPDTIDERAINKKKLTPF
FT                   TVSENLNLALNSASAIGCTVVNIGAQDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEA
FT                   LIALLKDGEDLEELMKLSPEELLLRWVNYHLTNAGWRTINNFSQDIKDSKAYFHLLNQI
FT                   APKGDRDDGPAVAIDLSGFNEKNDLKRAGFMLQEADKLGCRQFVTPADVVSGNPKLNLA
FT                   FVANLFNTYPCLHKPDNNDIDLNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADAL
FT                   VIFQLYEMIRVPVNWSQVNKPPYPALGGNMKKIENCNYAVELGKNEAKFSLVGIAGQDL
FT                   NEGNATLTLALVWQLMRRYTLKVLSDLGEGEKVTDDIIIKWVNQTLKSANKSTSISSFK
FT                   DKSISTSLPVLDLIDAIAPNAVRQEMIKREHLTDEDKLNNAKYAISVARKIGARIYALP
FT                   DDLVEVKPKMVMTVFACLMGKGLNRLK"
FT   CDS             complement(join(6485148..6485283,6485507..6485631,
FT                   6492146..6492269,6492767..6492900,6496544..6496658,
FT                   6499570..6499648,6503994..6504189,6505785..6505880,
FT                   6506943..6507085,6507166..6507331,6512952..6513033,
FT                   6514684..6514816,6516074..6516203,6517517..6517680,
FT                   6526262..6526331))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10241"
FT                   /product="mCG10241, isoform CRA_b"
FT                   /note="gene_id=mCG10241.2 transcript_id=mCT10461.2
FT                   protein_id=mCP21270.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V0K9"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:104809"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3V0K9"
FT                   /protein_id="EDL20943.1"
FT                   /translation="MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASL
FT                   PLPGYKVREIVEKILVVADNNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITA
FT                   IGGTSSISSEGTQHSYSEEEKVAFVNWINKALENDADCSHLLPMNPNDGSLFKSLADGI
FT                   LLCKMINLSEPDTIDERAINKKKLTPFTVSENLNLALNSASAIGCTVVNIGAQDLKEGK
FT                   PHLVLGLLWQIIKVGLFADIEISRNEALIALLKDGEDLEELMKLSPEELLLRWVNYHLT
FT                   NAGWRTINNFSQDIKDSKAYFHLLNQIAPKGDRDDGPAVAIDLSGFNEKNDLKRAGFML
FT                   QEADKLGCRQFVTPADVVSGNPKLNLAFVANLFNTYPCLHKPDNNDIDLNLLEGESKEE
FT                   RTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIRVPVNWSQVNKPPYPALGGNMKK
FT                   IENCNYAVELGKNEAKFSLVGIAGQDLNEGNATLTLALVWQLMRRYTLKVLSDLGEGEK
FT                   VTDDIIIKWVNQTLKSANKSTSISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIKREHL
FT                   TDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLMGKGLNRLK"
FT   gene            6587778..6681846
FT                   /locus_tag="mCG_10240"
FT                   /note="gene_id=mCG10240.2"
FT   mRNA            join(6587778..6587922,6591508..6591599,6592922..6593071,
FT                   6595108..6595985,6596723..6596901,6597634..6597825,
FT                   6600022..6600212,6600760..6600912,6601576..6601827,
FT                   6604218..6604408,6604491..6604591,6604843..6605014,
FT                   6605734..6605904,6608595..6608789,6611366..6611551,
FT                   6613256..6613348,6615482..6615612,6618240..6618383,
FT                   6620899..6620992,6623551..6623676,6627681..6627887,
FT                   6629182..6629295,6633808..6633923,6635883..6636003,
FT                   6637441..6637578,6638395..6638587,6640624..6640802,
FT                   6645082..6645246,6646575..6646666,6650490..6650581,
FT                   6650812..6650989,6651798..6651977,6652893..6653052,
FT                   6657314..6657493,6662474..6662616,6665623..6665720,
FT                   6666439..6666671,6667658..6667792,6669294..6669494,
FT                   6671014..6671157,6672730..6672880,6675232..6675388,
FT                   6675488..6675641,6677234..6677385,6680689..6680729,
FT                   6680803..6680852,6681653..6681846)
FT                   /locus_tag="mCG_10240"
FT                   /product="mCG10240"
FT                   /note="gene_id=mCG10240.2 transcript_id=mCT10460.2 created
FT                   on 21-JUN-2002"
FT   CDS             join(6587864..6587922,6591508..6591599,6592922..6593071,
FT                   6595108..6595985,6596723..6596901,6597634..6597825,
FT                   6600022..6600212,6600760..6600912,6601576..6601827,
FT                   6604218..6604408,6604491..6604591,6604843..6605014,
FT                   6605734..6605904,6608595..6608789,6611366..6611551,
FT                   6613256..6613348,6615482..6615612,6618240..6618383,
FT                   6620899..6620992,6623551..6623676,6627681..6627887,
FT                   6629182..6629295,6633808..6633923,6635883..6636003,
FT                   6637441..6637578,6638395..6638587,6640624..6640802,
FT                   6645082..6645246,6646575..6646666,6650490..6650581,
FT                   6650812..6650989,6651798..6651977,6652893..6653052,
FT                   6657314..6657493,6662474..6662616,6665623..6665720,
FT                   6666439..6666671,6667658..6667792,6669294..6669494,
FT                   6671014..6671157,6672730..6672880,6675232..6675388,
FT                   6675488..6675641,6677234..6677385,6680689..6680729,
FT                   6680803..6680852,6681653..6681826)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10240"
FT                   /product="mCG10240"
FT                   /note="gene_id=mCG10240.2 transcript_id=mCT10460.2
FT                   protein_id=mCP21306.2"
FT                   /protein_id="EDL20944.1"
FT                   /translation="MGDHGLELASMIPALRELASATPEEYNTVVQKPRQILCQFIDRIL
FT                   TDVNVVALELVKKTDAQPTSVMLLDFIQHIMKSSPLMFVNVNGSQGQNEAKDSCIEFSH
FT                   WIITRLLRIAATPSCHMLHKKICEVICSLLFLFKSKNPAIFGVLTRELLYLFEDLIYLH
FT                   KRNAVGEVMEWPVVVSRFLSRLDEHMGCLQPAPLQFMNVQNVEFIEVTLLMVLIHIVPT
FT                   VFFRRQELLLWQIGCALLEHGSPKIRSLAISLLTELFELGGLPAQPASTFFSLFLELLQ
FT                   HLVGMDADQLKLYEEPLSKLVKTLFPFEAEAYRNIEPVYLNVLLEKLSVMFEDRVLMRL
FT                   KSDLLKAALCHLLQYFLTFVPAGYESALQVRKVYVTNICRALVDALGVQKHVGYLLGPF
FT                   YAALKMESKEIIERIQCQAQQENLSGNNDEVSPKRRKLSSSLSSYKKPSRQPEEIIHVD
FT                   MDKKSILWNVLKQKAESLQISLECGTLKNSVAEALEGITVVLQLTALCTVHCSHQDMDG
FT                   HNVKDHQHKYKKKPPVVVTWMSLDFYTKVLKSCRSLLESVQKLELELVIDSMVRICDAL
FT                   MYMQVKSSFKDHVLEELCGMLSLPWIYSYSDDNSLKMTTFATNLLPLSQRVWDSYYRVK
FT                   DDSDMVKKEFASVLGQLVCTLHGMFYLSSSVEPCFEHMDLFSKNLKATSQHECSSSQVK
FT                   ASTCKPFLFLLTKNTPSPVKLAFIDNLHHLCKHLDFQEDEREVKAVLGTLLNLMEDPDK
FT                   DVRIAFSGNIKYILESLNSEDGFVKELFVLRMKEAYTHAQIARNNELKDTLILTTGDIG
FT                   RAAKGDLIPFALLHLLHCLLSKSASVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQF
FT                   LVESLHSSQMTALPSAPCQSSEIRKQDVAHHREMALNTLSEIANVFDFPDLNRFLTRTL
FT                   QVLLPDLAAKASPAASALIRTLGKQLNVSRREILINNFKYIFSHLVCSCSKDELERALH
FT                   YLKNETEIELGSLLRQDFQGLHNELLLRIGEHYQQVFNGLSILASFASSDDPYQGPRDI
FT                   TSPELMADYLQPKLLGILAFFNMQLLSSSVGIEDKKMALTSLMSLMKLMGPKHVSSVRV
FT                   KMMTTLRTGLRFKDDFPELCCRAWDCFVRCLDHAYLGPLLSHVIVALLPLIHMQPKETA
FT                   AIFHYLIIENRDAVQDFLHEIYFLPDHPELEKIKAVLQEYRKETSETTDLQTTLQLSMK
FT                   AIQHENVDVRIHALTSLKETLYKNQEKLIKYATDSETVEPVISQLVTVILKGCQDANSQ
FT                   ARLLCGECLGELGAIDPGRLDFSTTETQGKDFTFVTGVEDLSFAYGLLMELTRAYLAYA
FT                   DNSRAQDSAAYAIQELLSIYDCREMQSNGPGYQLWKRFPEHVREILEPHLNTRYKSSQK
FT                   STDWSGVTKPIYLSKLGNNFAEWSSSWAGYLITKVRDNLASKIFTCCSIMMKHDFKVTI
FT                   YLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHDEQHAISTQDSASDLCQLSTQTVFSVL
FT                   DHLTQWARHKFQALNAEKLAQNKPKGVSNVNFEDYQSVTRFLDLIPQDTLAVASFRSKA
FT                   YTRAVMHFESFITEKKQNIQKHLGFLQKLYAAMHEPDGVAGVSAIRKAEPSLKEQILEH
FT                   ESIGLLRDATACYDRAIQLEPDQIIHYHGVVKSMLGLGQLSTVITQVNGVHANRSEWTD
FT                   ELNTYRVEAAWKLSQWDLVENYLAADGKSTTWSVRLGQLLLSAKKRDTTTFYDTLKLVR
FT                   AEQIVPLSAASFERGSYQRGYEFIVRLHMLCELEHSLKPLFRKSPGDSCNEDSLNWGAR
FT                   LEMTQNSYRAKEPILALRRALLSLNKRPDYNEMVGECWLQSARVARKAGHHQTAYNALL
FT                   NAGESRLAELYVERAKWLWSKGDVHQALIVLQKGVELCFPENKSPSESKHMLIHGRATL
FT                   LVGRFMEETANFESNAVMKKYKDVTLFLPEWEDGHFYLAKYYDKLMPMVTDNKMEKQGD
FT                   LIRYIVLHFGRSLQYGNQFIYQSMPRMLSLWLDFGAKAYEWEKGGRSDRLQMRNDLAKI
FT                   NSVLTEHTNRLAPYQFLTAFSQLISRICHSHDEVFVVLMEIIAKVFLAYPQQAMWMMTA
FT                   VSKSSYPMRVNRCKEILTKAIHMKKSLEKFVGDATRLTDKLLELCNKSVDGSNSTLSMS
FT                   THFKMLKRLVEDPTFSEILIPLQSVMIPTLPSVLGAHANHDPFPGHWAYLAGFDDVVEI
FT                   LSSLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINKSLRKDAESRRRELH
FT                   IRTYAVIPLNDECGIIEWVNNTAGLRPILTKIYKEKGVYMTGKELRQCMLPKSAALSEK
FT                   LKVFQELLLPRHPPVFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGE
FT                   NILFDSFTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEV
FT                   TLRLMRDQREPLMSVLKTFLHDPLVEWIHSKAPLNETGQVVNEKAKTHVLDIEQRLQGV
FT                   IKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM"
FT   gene            complement(6672193..>6689598)
FT                   /locus_tag="mCG_146220"
FT                   /note="gene_id=mCG146220.0"
FT   mRNA            complement(join(6672193..6673883,6676006..6676244,
FT                   6689433..>6689598))
FT                   /locus_tag="mCG_146220"
FT                   /product="mCG146220"
FT                   /note="gene_id=mCG146220.0 transcript_id=mCT186323.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(6676043..>6676240)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146220"
FT                   /product="mCG146220"
FT                   /note="gene_id=mCG146220.0 transcript_id=mCT186323.0
FT                   protein_id=mCP107618.0"
FT                   /protein_id="EDL20945.1"
FT                   /translation="IYGLFHLPVIADSNPKKIGHRNRNYLLIFLQNCKRRKILMFLKMD
FT                   PLALIYSQGPTLVLFVVAVI"
FT   gene            6684965..6787832
FT                   /gene="Xrn1"
FT                   /locus_tag="mCG_117319"
FT                   /note="gene_id=mCG117319.1"
FT   mRNA            join(6684965..6685148,6694176..6694408,6697917..6698014,
FT                   6699438..6699547,6699652..6699762,6700910..6700992,
FT                   6703460..6703547,6703631..6703799,6704577..6704644,
FT                   6704943..6705080,6707711..6707777,6707978..6708083,
FT                   6709316..6709405,6711955..6712111,6715364..6715483,
FT                   6719017..6719186,6721154..6721274,6721367..6721465,
FT                   6725278..6725381,6728394..6728525,6729592..6729754,
FT                   6732313..6732426,6734022..6734120,6736175..6736290,
FT                   6736878..6737024,6741386..6741475,6741699..6741834,
FT                   6747927..6747983,6748223..6748355,6751982..6752051,
FT                   6754199..6754397,6757015..6757110,6763762..6763870,
FT                   6765812..6765873,6768796..6768906,6769056..6769178,
FT                   6769877..6770033,6775772..6775947,6778373..6778475,
FT                   6781626..6781786,6782546..6787832)
FT                   /gene="Xrn1"
FT                   /locus_tag="mCG_117319"
FT                   /product="5'-3' exoribonuclease 1"
FT                   /note="gene_id=mCG117319.1 transcript_id=mCT118456.1
FT                   created on 21-JUN-2002"
FT   CDS             join(6685074..6685148,6694176..6694408,6697917..6698014,
FT                   6699438..6699547,6699652..6699762,6700910..6700992,
FT                   6703460..6703547,6703631..6703799,6704577..6704644,
FT                   6704943..6705080,6707711..6707777,6707978..6708083,
FT                   6709316..6709405,6711955..6712111,6715364..6715483,
FT                   6719017..6719186,6721154..6721274,6721367..6721465,
FT                   6725278..6725381,6728394..6728525,6729592..6729754,
FT                   6732313..6732426,6734022..6734120,6736175..6736290,
FT                   6736878..6737024,6741386..6741475,6741699..6741834,
FT                   6747927..6747983,6748223..6748355,6751982..6752051,
FT                   6754199..6754397,6757015..6757110,6763762..6763870,
FT                   6765812..6765873,6768796..6768906,6769056..6769178,
FT                   6769877..6770033,6775772..6775947,6778373..6778475,
FT                   6781626..6781786,6782546..6782842)
FT                   /codon_start=1
FT                   /gene="Xrn1"
FT                   /locus_tag="mCG_117319"
FT                   /product="5'-3' exoribonuclease 1"
FT                   /note="gene_id=mCG117319.1 transcript_id=mCT118456.1
FT                   protein_id=mCP68530.1"
FT                   /protein_id="EDL20946.1"
FT                   /translation="MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSH
FT                   PNDDDVHFRISDDKIFTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRS
FT                   AKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQG
FT                   VTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFS
FT                   LLREEVRFGGKKTQRVCAPEETTFHLLHLSLMREYIDYEFSALKEKITFKYDIEKIIDD
FT                   WILMGFLVGNDFIPHLPHLHINHDALPLLYGTYIAILPELGGYINESGHLNLPRFERYL
FT                   VKLSDFDREHFSEVFVDLKWFESKVGNKYLNEAAGAAAEEAKNCKEKRKPKGQENSLSW
FT                   AALDKSEGEGVASRDNFEDETEDDDLFETEFRQYKRTYYMTKMGVDVVSDEFLANQAAC
FT                   YVQAIQWILHYYYHGVQSWSWYYPYHYAPFLSDIRSISTLKIHFELGKPFKPFEQLLAV
FT                   LPSASKNLLPTCYQHLMTSEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDETRLLE
FT                   AMETCNHSLKKEERKRNQHSECLMCWYDRDTEFTYSSPWPEKFPAIERCCTRYKMISLD
FT                   AWRVDINKNKITRVDQKALYFCGFPTLKHIKHKFFLKKSGVQVFQQSSRGENLMLEISV
FT                   NAEPDELRIENIASAVLGKAVFVNWPHLEEARVVAVSDGETKFYIEEPPGTQKVYLGKT
FT                   APPSKVIQLTDKEQSNWTKEIQGISEQYLRRKGIIINETSAVVYAQLLTGRKYQISQNG
FT                   EVRLEKQWSKQILPFVYQTIVKDIRAFDSRFSNIKTLDDLFPPRTMVFMLGTPYYGCTG
FT                   EVQDSGDLITEGRIRVVFSIPCEPNLDALIQNQHKYSIKYNPGYVLAGRLGVSGYLVSR
FT                   FTGSIFIGRGSRRNPHGDHKANVGLNLKFNKKNEEVPGYTKKVGNEWMYSSAAEQLLAE
FT                   YIERAPELFSYIAKNSQEDVFYEDDIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCD
FT                   LHILDAAIVEKIEEEVEKCKQRKSNKKVRVTVKPHLLYRPLEQQHGVIPDRDAEFRLFD
FT                   RVVNVRESFSVPVGLRGTVIGIKGASREADVLFEVLFDEEFPGGLTIRCSPGRGYRLPT
FT                   SALVNLSHGSRCETGNQKLTAIVKPQPSVSHCSAAPSGHLGGLNHSPQSPFLPTQVPTK
FT                   GDDEFCNIWQSLQGAGKIQHLQPTVQEKGAVLPQEISQVTEGHKSGFTDHSVRHQQRKH
FT                   DSQRKFKEEYKSPKAECQSQKLSSKQTSGGSARCSIKLLKRNESPGTSEAQKVVTSYPN
FT                   AVHKPPSGIENFLASLNLSKENEAQLPHHGEPPDEADLSPQSFAMKGTRMLKEILKIDS
FT                   PDTRDSKNDMKKSDNEATVSSRRDERGVSAHPKPSKKLTCHMNKPHGTNEFQNVASVDS
FT                   VCWPGQMPPVSTPVTELSRICSLVGMPQPDFSFLRTTQGSLGVSFPLPPPIFTNYPPAV
FT                   PPGAVPPVFTQPTANIMPSSSHLFGSVSWRPPVPVAGNAFHYPSYPGTMPLAGGVPGGV
FT                   HSQFIPLQVTKKRVANRKNFENKEAQSSQATPLQTNKPGSSEATKMTPQESPPASSSSS
FT                   QAAQPVSSHVETASQGHVGSQPRSAPSSSKRKSRKLAVNFSVSKPSE"
FT   gene            6740296..6793865
FT                   /locus_tag="mCG_147713"
FT                   /note="gene_id=mCG147713.0"
FT   mRNA            join(6740296..6740351,6744680..6744754,6748814..6748845,
FT                   6790780..6793865)
FT                   /locus_tag="mCG_147713"
FT                   /product="mCG147713"
FT                   /note="gene_id=mCG147713.0 transcript_id=mCT187976.0
FT                   created on 13-JAN-2004"
FT   CDS             6792651..6793028
FT                   /codon_start=1
FT                   /locus_tag="mCG_147713"
FT                   /product="mCG147713"
FT                   /note="gene_id=mCG147713.0 transcript_id=mCT187976.0
FT                   protein_id=mCP108540.0"
FT                   /protein_id="EDL20947.1"
FT                   /translation="MSILKKWVWEGYKESIWCRCSNSGLAPAVVAREIFRLFPSNQYHK
FT                   HLTVSFISGHTHGFKERSKHWQIHRFKEQPEHCEPISEASSANNEIYFANFRASVTFYK
FT                   TMTKTTLIKDKRFIPLSRQKA"
FT   gene            <6839579..6904672
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /note="gene_id=mCG117324.1"
FT   mRNA            join(6839579..6839790,6849253..6849346,6853635..6853710,
FT                   6858012..6858105,6860806..6860937,6865943..6866040,
FT                   6871007..6871067,6873352..6873478,6875664..6875768,
FT                   6891649..6891743,6894881..6894984,6896421..6896480,
FT                   6897610..6897743,6898993..6904672)
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /product="RIKEN cDNA C330018K18, transcript variant
FT                   mCT118461"
FT                   /note="gene_id=mCG117324.1 transcript_id=mCT118461.1
FT                   created on 21-JUN-2002"
FT   mRNA            join(<6839579..6839790,6849253..6849346,6853635..6853710,
FT                   6858012..6858105,6860806..6860937,6865943..6866018,
FT                   6870487..6870548,6870706..6870779,6871007..6871067,
FT                   6873352..6873478,6875664..6875768,6891649..6891743,
FT                   6894881..6894984,6896421..6896480,6897610..6897743,
FT                   6898993..6900270)
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /product="RIKEN cDNA C330018K18, transcript variant
FT                   mCT191554"
FT                   /note="gene_id=mCG117324.1 transcript_id=mCT191554.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<6839584..6839790,6849253..6849346,6853635..6853710,
FT                   6858012..6858105,6860806..6860937,6865943..6866018,
FT                   6870487..6870548,6870706..6870779,6871007..6871067,
FT                   6873352..6873478,6875664..6875768,6891649..6891743,
FT                   6894881..6894984,6896421..6896480,6897610..6897743,
FT                   6898993..6899141)
FT                   /codon_start=1
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /product="RIKEN cDNA C330018K18, isoform CRA_b"
FT                   /note="gene_id=mCG117324.1 transcript_id=mCT191554.0
FT                   protein_id=mCP112465.0 isoform=CRA_b"
FT                   /protein_id="EDL20949.1"
FT                   /translation="LRAGRPVATAVFGVAMSGQQERAERQREELSASASPPSRFVLGLD
FT                   VGSTVIRCHVYDQTARVRGSSAQKVENVYPQPGWVEIDPDSLWAQFVAVIKDAVKAAGV
FT                   QMNQIVGLGISTQRATFITWNKKTGHHFHNFISWQDLRAAELVKSWNNSLIMKLLHGAT
FT                   RVLHFFSRSKVMLTVSRFNFSTQHATLRLTWILQNLSEVKRAVEEDNCCFGTIDTWLLY
FT                   KLTKGSSYATDYSNASTTGFFDPYAMRWSRLITTMVSIPLSILPPVKDTSYNFGSVDEK
FT                   IFGVPIPVVALVGDQQSAMFGECCFETGDVKLTMGTGTFLDINTGKNLQHVNGGFYPLI
FT                   GWKIGQELVCLAEGNAGDTGTAIMWAQKLDLFTDAAETEKMALSLEDSEGVYFVPSFSG
FT                   LQAPLNDPCACASFMGLKHSTNKYHLVRAILESIAFRNKQLYDMLQREIQIPVTNIRAD
FT                   GGVCNNAFVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVGFWADKEELQKLRQSEM
FT                   VFKPQKKWQEYEVNMENWVKAVKRSMNWYNKT"
FT   mRNA            join(<6839605..6839790,6849253..6849346,6853635..6853710,
FT                   6858012..6858105,6860806..6860937,6865943..6866018,
FT                   6870487..6870548,6870706..6870779,6871007..6871067,
FT                   6873352..6873478,6875664..6875768,6891649..6891743,
FT                   6894881..6894984,6896421..6896480,6897610..6897743,
FT                   6898993..6899078,6901844..6903025)
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /product="RIKEN cDNA C330018K18, transcript variant
FT                   mCT191555"
FT                   /note="gene_id=mCG117324.1 transcript_id=mCT191555.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<6839605..6839790,6849253..6849346,6853635..6853710,
FT                   6858012..6858105,6860806..6860937,6865943..6866018,
FT                   6870487..6870548,6870706..6870779,6871007..6871067,
FT                   6873352..6873478,6875664..6875768,6891649..6891743,
FT                   6894881..6894984,6896421..6896480,6897610..6897743,
FT                   6898993..6899078,6901844..6901852)
FT                   /codon_start=1
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /product="RIKEN cDNA C330018K18, isoform CRA_c"
FT                   /note="gene_id=mCG117324.1 transcript_id=mCT191555.0
FT                   protein_id=mCP112466.0 isoform=CRA_c"
FT                   /protein_id="EDL20950.1"
FT                   /translation="ATAVFGVAMSGQQERAERQREELSASASPPSRFVLGLDVGSTVIR
FT                   CHVYDQTARVRGSSAQKVENVYPQPGWVEIDPDSLWAQFVAVIKDAVKAAGVQMNQIVG
FT                   LGISTQRATFITWNKKTGHHFHNFISWQDLRAAELVKSWNNSLIMKLLHGATRVLHFFS
FT                   RSKVMLTVSRFNFSTQHATLRLTWILQNLSEVKRAVEEDNCCFGTIDTWLLYKLTKGSS
FT                   YATDYSNASTTGFFDPYAMRWSRLITTMVSIPLSILPPVKDTSYNFGSVDEKIFGVPIP
FT                   VVALVGDQQSAMFGECCFETGDVKLTMGTGTFLDINTGKNLQHVNGGFYPLIGWKIGQE
FT                   LVCLAEGNAGDTGTAIMWAQKLDLFTDAAETEKMALSLEDSEGVYFVPSFSGLQAPLND
FT                   PCACASFMGLKHSTNKYHLVRAILESIAFRNKQLYDMLQREIQIPVTNIRADGGVCNNA
FT                   FVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVGFWADKEELQKLRQSEMVFKPQKK
FT                   WQEYEAF"
FT   CDS             join(6839629..6839790,6849253..6849346,6853635..6853710,
FT                   6858012..6858105,6860806..6860937,6865943..6866040,
FT                   6871007..6871067,6873352..6873478,6875664..6875768,
FT                   6891649..6891743,6894881..6894984,6896421..6896480,
FT                   6897610..6897743,6898993..6899141)
FT                   /codon_start=1
FT                   /gene="C330018K18Rik"
FT                   /locus_tag="mCG_117324"
FT                   /product="RIKEN cDNA C330018K18, isoform CRA_a"
FT                   /note="gene_id=mCG117324.1 transcript_id=mCT118461.1
FT                   protein_id=mCP68751.1 isoform=CRA_a"
FT                   /protein_id="EDL20948.1"
FT                   /translation="MSGQQERAERQREELSASASPPSRFVLGLDVGSTVIRCHVYDQTA
FT                   RVRGSSAQKVENVYPQPGWVEIDPDSLWAQFVAVIKDAVKAAGVQMNQIVGLGISTQRA
FT                   TFITWNKKTGHHFHNFISWQDLRAAELVKSWNNSLIMKLLHGATRVLHFFSRSKVMLTV
FT                   SRFNFSTQHATLRLTWILQNLSEVKRAVEEDNCCFGTIDTWLLYKLTKGKVDITDLYNF
FT                   GSVDEKIFGVPIPVVALVGDQQSAMFGECCFETGDVKLTMGTGTFLDINTGKNLQHVNG
FT                   GFYPLIGWKIGQELVCLAEGNAGDTGTAIMWAQKLDLFTDAAETEKMALSLEDSEGVYF
FT                   VPSFSGLQAPLNDPCACASFMGLKHSTNKYHLVRAILESIAFRNKQLYDMLQREIQIPV
FT                   TNIRADGGVCNNAFVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVGFWADKEELQK
FT                   LRQSEMVFKPQKKWQEYEVNMENWVKAVKRSMNWYNKT"
FT   gene            6916401..7036895
FT                   /gene="Tfdp2"
FT                   /locus_tag="mCG_117096"
FT                   /note="gene_id=mCG117096.1"
FT   mRNA            join(6916401..6916657,6922226..6922283,6942366..6942470,
FT                   6951940..6952006,6992677..6992780,7005855..7005976,
FT                   7008828..7008875,7015491..7015634,7018244..7018312,
FT                   7024575..7024726,7028352..7028518,7035288..7035393,
FT                   7035599..7036895)
FT                   /gene="Tfdp2"
FT                   /locus_tag="mCG_117096"
FT                   /product="transcription factor Dp 2, transcript variant
FT                   mCT118463"
FT                   /note="gene_id=mCG117096.1 transcript_id=mCT118463.1
FT                   created on 21-JUN-2002"
FT   CDS             join(6942456..6942470,6951940..6952006,6992677..6992780,
FT                   7005855..7005976,7008828..7008875,7015491..7015536)
FT                   /codon_start=1
FT                   /gene="Tfdp2"
FT                   /locus_tag="mCG_117096"
FT                   /product="transcription factor Dp 2, isoform CRA_b"
FT                   /note="gene_id=mCG117096.1 transcript_id=mCT118463.1
FT                   protein_id=mCP68783.1 isoform=CRA_b"
FT                   /protein_id="EDL20952.1"
FT                   /translation="MTAKNVGLPSTNAELRGFIDQNFSPTKGNISLVAFPVSSTNSPTK
FT                   ILPKTLGPINVNVGPQMIISTPQRIANSGSVLIGNPYTPAPAMVTQTHIAEAAGWVPSD
FT                   RKRAREFIDSDFSERLMIRRTLDEEFMML"
FT   mRNA            join(6977584..6977713,6992677..6992780,7005855..7005976,
FT                   7008828..7008875,7015491..7015634,7018244..7018312,
FT                   7024575..7024726,7028352..7028518,7035288..7035393,
FT                   7035599..7036895)
FT                   /gene="Tfdp2"
FT                   /locus_tag="mCG_117096"
FT                   /product="transcription factor Dp 2, transcript variant
FT                   mCT118229"
FT                   /note="gene_id=mCG117096.1 transcript_id=mCT118229.1
FT                   created on 21-JUN-2002"
FT   CDS             join(6977683..6977713,6992677..6992780,7005855..7005976,
FT                   7008828..7008875,7015491..7015536)
FT                   /codon_start=1
FT                   /gene="Tfdp2"
FT                   /locus_tag="mCG_117096"
FT                   /product="transcription factor Dp 2, isoform CRA_a"
FT                   /note="gene_id=mCG117096.1 transcript_id=mCT118229.1
FT                   protein_id=mCP68766.1 isoform=CRA_a"
FT                   /protein_id="EDL20951.1"
FT                   /translation="MYNSNYAGLVSNISLVAFPVSSTNSPTKILPKTLGPINVNVGPQM
FT                   IISTPQRIANSGSVLIGNPYTPAPAMVTQTHIAEAAGWVPSDRKRAREFIDSDFSERLM
FT                   IRRTLDEEFMML"
FT   gene            complement(7050495..7083813)
FT                   /locus_tag="mCG_21656"
FT                   /note="gene_id=mCG21656.2"
FT   mRNA            complement(join(7050495..7051502,7053174..7053257,
FT                   7056455..7056505,7057997..7058181,7061055..7061162,
FT                   7063746..7063874,7083545..7083813))
FT                   /locus_tag="mCG_21656"
FT                   /product="mCG21656, transcript variant mCT20299"
FT                   /note="gene_id=mCG21656.2 transcript_id=mCT20299.2 created
FT                   on 24-JUN-2002"
FT   mRNA            complement(join(7050495..7051502,7053174..7053257,
FT                   7056455..7056505,7057997..7058181,7061055..7061162,
FT                   7063746..7063874,7067175..7067364))
FT                   /locus_tag="mCG_21656"
FT                   /product="mCG21656, transcript variant mCT170324"
FT                   /note="gene_id=mCG21656.2 transcript_id=mCT170324.0 created
FT                   on 24-JUN-2002"
FT   CDS             complement(join(7051332..7051502,7053174..7053257,
FT                   7056455..7056505,7057997..7058181,7061055..7061162,
FT                   7063746..7063874,7083545..7083653))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21656"
FT                   /product="mCG21656, isoform CRA_b"
FT                   /note="gene_id=mCG21656.2 transcript_id=mCT20299.2
FT                   protein_id=mCP21344.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q544Q7"
FT                   /db_xref="InterPro:IPR000402"
FT                   /db_xref="MGI:MGI:107788"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Q7"
FT                   /protein_id="EDL20954.1"
FT                   /translation="MTKTEKKSFHQSLAEWKLFIYNPSSGEFLGRTSKSWGLILLFYLV
FT                   FYGFLAALFTFTMWAMLQTLNDEVPKYRDQIPSPGLMVFPKPQTALEYTFSMSEPQTYK
FT                   KLVEDLESFLKPYSVEEQKNLTSCPDGAPFIQHGPDYRACQFPVSLLEECSGVTDANFG
FT                   YSKGQPCILVKMNRIIDLIPDGYPQISCLPKEENATIATYPEFGVLDLKYFPYYGKKRH
FT                   VGYRQPLVAVQVKFDSGLNKKEVTVECHIAGTRNLKNKNERDKFLGRVSFKVTARA"
FT   CDS             complement(join(7051332..7051502,7053174..7053257,
FT                   7056455..7056505,7057997..7058181,7061055..7061162,
FT                   7063746..7063874,7067175..7067211))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21656"
FT                   /product="mCG21656, isoform CRA_a"
FT                   /note="gene_id=mCG21656.2 transcript_id=mCT170324.0
FT                   protein_id=mCP93242.0 isoform=CRA_a"
FT                   /protein_id="EDL20953.1"
FT                   /translation="MMTSRDHRIESAGLILLFYLVFYGFLAALFTFTMWAMLQTLNDEV
FT                   PKYRDQIPSPGLMVFPKPQTALEYTFSMSEPQTYKKLVEDLESFLKPYSVEEQKNLTSC
FT                   PDGAPFIQHGPDYRACQFPVSLLEECSGVTDANFGYSKGQPCILVKMNRIIDLIPDGYP
FT                   QISCLPKEENATIATYPEFGVLDLKYFPYYGKKRHVGYRQPLVAVQVKFDSGLNKKEVT
FT                   VECHIAGTRNLKNKNERDKFLGRVSFKVTARA"
FT   gene            complement(7193063..7200712)
FT                   /locus_tag="mCG_21643"
FT                   /note="gene_id=mCG21643.2"
FT   mRNA            complement(join(7193063..7193969,7196076..7196123,
FT                   7200525..7200712))
FT                   /locus_tag="mCG_21643"
FT                   /product="mCG21643"
FT                   /note="gene_id=mCG21643.2 transcript_id=mCT20286.2 created
FT                   on 24-JUN-2002"
FT   CDS             complement(join(7193851..7193969,7196076..7196123,
FT                   7200525..7200699))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21643"
FT                   /product="mCG21643"
FT                   /note="gene_id=mCG21643.2 transcript_id=mCT20286.2
FT                   protein_id=mCP21351.2"
FT                   /protein_id="EDL20955.1"
FT                   /translation="MADVEDGEEPCVLSSHSGSAGSKSGGDKMFSLKKWNAVAMWSWDV
FT                   ECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQ
FT                   DWVVQRIGK"
FT   gene            7260312..7260913
FT                   /pseudo
FT                   /locus_tag="mCG_21647"
FT                   /note="gene_id=mCG21647.1"
FT   mRNA            7260312..7260913
FT                   /pseudo
FT                   /locus_tag="mCG_21647"
FT                   /note="gene_id=mCG21647.1 transcript_id=mCT20290.1 created
FT                   on 24-JUN-2002"
FT   gene            complement(7262367..7354474)
FT                   /gene="Rasa2"
FT                   /locus_tag="mCG_21645"
FT                   /note="gene_id=mCG21645.2"
FT   mRNA            complement(join(7262367..7265541,7267345..7267531,
FT                   7267854..7267957,7268655..7268863,7269313..7269395,
FT                   7275369..7275475,7276179..7276252,7280466..7280543,
FT                   7283764..7283847,7289082..7289188,7291430..7291553,
FT                   7292086..7292160,7292757..7292871,7293732..7293880,
FT                   7294931..7295087,7299352..7299453,7300539..7300615,
FT                   7303553..7303625,7305805..7305888,7315013..7315089,
FT                   7325761..7325855,7329141..7329244,7334430..7334547,
FT                   7354335..7354474))
FT                   /gene="Rasa2"
FT                   /locus_tag="mCG_21645"
FT                   /product="RAS p21 protein activator 2"
FT                   /note="gene_id=mCG21645.2 transcript_id=mCT20289.2 created
FT                   on 24-JUN-2002"
FT   CDS             complement(join(7265511..7265541,7267345..7267531,
FT                   7267854..7267957,7268655..7268863,7269313..7269395,
FT                   7275369..7275475,7276179..7276252,7280466..7280543,
FT                   7283764..7283847,7289082..7289188,7291430..7291553,
FT                   7292086..7292160,7292757..7292871,7293732..7293880,
FT                   7294931..7295087,7299352..7299453,7300539..7300615,
FT                   7303553..7303625,7305805..7305888,7315013..7315089,
FT                   7325761..7325855,7329141..7329244,7334430..7334547,
FT                   7354335..7354464))
FT                   /codon_start=1
FT                   /gene="Rasa2"
FT                   /locus_tag="mCG_21645"
FT                   /product="RAS p21 protein activator 2"
FT                   /note="gene_id=mCG21645.2 transcript_id=mCT20289.2
FT                   protein_id=mCP21275.2"
FT                   /db_xref="GOA:P58069"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001562"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="MGI:MGI:2149960"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58069"
FT                   /protein_id="EDL20956.1"
FT                   /translation="MAAAAPAAAASPEAPAVSGSADPETGDEDSREVRVLQSLRGRIYE
FT                   AKNLLPYLGPNKMRDCFCTINLDQEEVYRTQVVEKSLSPYFSEEFYFEIPRTFQYLSFY
FT                   VYDKNVLQRDLRIGKVAIKKEDLCSHSGKETWFSLQPIDSNSEVQGKVHLELRLNELIT
FT                   ENGTVCQQLVVHIKACHGLPLINGQSCDPYATVSLVGPSRNDQKKTKVKKKTSNPQFNE
FT                   VFYFEVTRSSSYSRKSQFQVEEEDIEKLEIRIDLWNNENLVQDVFLGEIKVPVNVLRSD
FT                   SFHQAWYLLQPRDNGNKSSKTDDLGSLLLTLCYTEDCVLPSEYYGPLKTLLLKSPDVQP
FT                   VSASAAYILGEICQDQKDAVLPLVRLLLHHNKLVPFITAVAELDLKDTPDANAIFRGNS
FT                   LATQCLTEMMKIVGGHYLKVTLKPVLDEICESSKSCEIDPVKLKEGDNVENNKENLYYY
FT                   VDKVFNTIVGSSVSCPTVMCDIFYSLRQMAAKKFPNHPHVQYSAVSSFVFLRFFAVAIL
FT                   SPHAFHLRPHYPDTQTVRTLTLISKTIQIIGNWGCQSRKKSRFKKSVMCEFLKMFQEER
FT                   YFTDVKKFLDEISSTETKESSGTSEPVHLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSR
FT                   ELTYHRQQGKDAIYTIPVKNILAVEKLEEGSFNKKNMFQVIHTEKTLYIQANNCVEANE
FT                   WIDVLCRVSRCNHNRLSSFHPSAYLNGNWLCCQETSESTPGCKPCTAGIPADIQIDIDE
FT                   DRETERIYSIFTLSLLKLQKMEETCGSIAVYQGPQKEPGYSKFTIEDSVATFKTIQQIK
FT                   STIEKLDEPHEKYRKKRSSSAKYGSKENPIVGKIS"
FT   gene            complement(<7404751..7475413)
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /note="gene_id=mCG21644.1"
FT   mRNA            complement(join(<7404751..7408341,7437549..7437648,
FT                   7450605..7451053,7451559..7451624,7474007..7474088,
FT                   7475086..7475413))
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38,
FT                   transcript variant mCT170323"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT170323.0 created
FT                   on 24-JUN-2002"
FT   mRNA            complement(join(<7404751..7408341,7437549..7437648,
FT                   7450605..7451053,7451559..7451624,7451992..7452081))
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38,
FT                   transcript variant mCT150472"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT150472.1 created
FT                   on 24-JUN-2002"
FT   mRNA            complement(join(<7404751..7408341,7437549..7437648,
FT                   7439125..7439190))
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38,
FT                   transcript variant mCT170322"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT170322.0 created
FT                   on 24-JUN-2002"
FT   mRNA            complement(join(<7404751..7408341,7437549..7437648,
FT                   7438699..7438782))
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38,
FT                   transcript variant mCT20288"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT20288.1 created
FT                   on 24-JUN-2002"
FT   CDS             complement(7404751..7408341)
FT                   /codon_start=1
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT150472.1
FT                   protein_id=mCP68822.1 isoform=CRA_a"
FT                   /protein_id="EDL20957.1"
FT                   /translation="MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFK
FT                   AHSNVLAASSLYFKNIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETV
FT                   TDLAAAGKKLGISFLEDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPR
FT                   ITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTASLCQERASVCHEVEPVRTLAEHS
FT                   YAVSSITEAYRSQPPREQDSSSSAKTGKETGDALATKAKPCRKPKPQTQDSDSTTENMP
FT                   LSLVTCPEVNQERSPQPAPDLSHSEPPSNEGDIHFPREDENQPSDAPGPGAAEVPPLVY
FT                   NCSCCSKSFDSSTLLSAHMQLHKPTQEPFVCKYCNKQFTTLNRLDRHEQICMRSSHVPI
FT                   PGGNPPFLENYPTIGQDGTSFRSPESLGPENRIGELSSAGSALSDADHMVKFVNGQMLY
FT                   SCIVCKRSYVTLSSLRRHANVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCI
FT                   FCLETFMTYYILKNHQKSFHAIDHRLSINKKTANGGLKPTVYPYKLYRLLPMRCKRAPY
FT                   KSYRNSSYVSAQGSSQRGESAPDTFIVPNLQSSEMPTLDFQDGRNTLPSSPAVPVETPS
FT                   RQGAPTSARVKNAEGIKWRKQAVKTNLVDNFDSTEVSVSSTGNTVSTTLQTEPACVSSV
FT                   GKGSEHSASVISYSGSVPSVIVHSSQFSSVIKHSNTIASLTNSNHKSPSQPVVSPSLIK
FT                   DSKPETDKASKSASRPKSIKEKKKTAPSNRGEITEEAKYIADHGGSSGKTTNAEETSKI
FT                   ETYIAKPALPGTSTNSNVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRKPKYQMQEET
FT                   LPRENDPETPGDSPLGLCQAECVEMSEAFDEVSDQDSTDKPWRPYYNYKPKKKSKQLRK
FT                   MRKVKWRKERRSRSPVGRCRYPAELDRAEVKLPPDKAFEEEEEEENKEMPKLQCELCDG
FT                   CPDGAAGAGAEGKPHQHLTSKPYICELCAKQFQSSSTLKMHMRCHTGEKPYQCKTCGRC
FT                   FSVQGNLQKHERIHLGVKEFICQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQGFLY
FT                   LSTKRNHERRHIREHDGKGFACFQCPKICKTAAALRMHQKKHLYKTLPKQEETGDTCHE
FT                   NADLLESQLCTDSEDSEQKDDIKAFAENVL"
FT   CDS             complement(7404751..7408341)
FT                   /codon_start=1
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT170322.0
FT                   protein_id=mCP93241.0 isoform=CRA_a"
FT                   /protein_id="EDL20958.1"
FT                   /translation="MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFK
FT                   AHSNVLAASSLYFKNIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETV
FT                   TDLAAAGKKLGISFLEDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPR
FT                   ITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTASLCQERASVCHEVEPVRTLAEHS
FT                   YAVSSITEAYRSQPPREQDSSSSAKTGKETGDALATKAKPCRKPKPQTQDSDSTTENMP
FT                   LSLVTCPEVNQERSPQPAPDLSHSEPPSNEGDIHFPREDENQPSDAPGPGAAEVPPLVY
FT                   NCSCCSKSFDSSTLLSAHMQLHKPTQEPFVCKYCNKQFTTLNRLDRHEQICMRSSHVPI
FT                   PGGNPPFLENYPTIGQDGTSFRSPESLGPENRIGELSSAGSALSDADHMVKFVNGQMLY
FT                   SCIVCKRSYVTLSSLRRHANVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCI
FT                   FCLETFMTYYILKNHQKSFHAIDHRLSINKKTANGGLKPTVYPYKLYRLLPMRCKRAPY
FT                   KSYRNSSYVSAQGSSQRGESAPDTFIVPNLQSSEMPTLDFQDGRNTLPSSPAVPVETPS
FT                   RQGAPTSARVKNAEGIKWRKQAVKTNLVDNFDSTEVSVSSTGNTVSTTLQTEPACVSSV
FT                   GKGSEHSASVISYSGSVPSVIVHSSQFSSVIKHSNTIASLTNSNHKSPSQPVVSPSLIK
FT                   DSKPETDKASKSASRPKSIKEKKKTAPSNRGEITEEAKYIADHGGSSGKTTNAEETSKI
FT                   ETYIAKPALPGTSTNSNVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRKPKYQMQEET
FT                   LPRENDPETPGDSPLGLCQAECVEMSEAFDEVSDQDSTDKPWRPYYNYKPKKKSKQLRK
FT                   MRKVKWRKERRSRSPVGRCRYPAELDRAEVKLPPDKAFEEEEEEENKEMPKLQCELCDG
FT                   CPDGAAGAGAEGKPHQHLTSKPYICELCAKQFQSSSTLKMHMRCHTGEKPYQCKTCGRC
FT                   FSVQGNLQKHERIHLGVKEFICQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQGFLY
FT                   LSTKRNHERRHIREHDGKGFACFQCPKICKTAAALRMHQKKHLYKTLPKQEETGDTCHE
FT                   NADLLESQLCTDSEDSEQKDDIKAFAENVL"
FT   CDS             complement(7404751..7408341)
FT                   /codon_start=1
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT170323.0
FT                   protein_id=mCP93240.0 isoform=CRA_a"
FT                   /protein_id="EDL20959.1"
FT                   /translation="MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFK
FT                   AHSNVLAASSLYFKNIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETV
FT                   TDLAAAGKKLGISFLEDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPR
FT                   ITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTASLCQERASVCHEVEPVRTLAEHS
FT                   YAVSSITEAYRSQPPREQDSSSSAKTGKETGDALATKAKPCRKPKPQTQDSDSTTENMP
FT                   LSLVTCPEVNQERSPQPAPDLSHSEPPSNEGDIHFPREDENQPSDAPGPGAAEVPPLVY
FT                   NCSCCSKSFDSSTLLSAHMQLHKPTQEPFVCKYCNKQFTTLNRLDRHEQICMRSSHVPI
FT                   PGGNPPFLENYPTIGQDGTSFRSPESLGPENRIGELSSAGSALSDADHMVKFVNGQMLY
FT                   SCIVCKRSYVTLSSLRRHANVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCI
FT                   FCLETFMTYYILKNHQKSFHAIDHRLSINKKTANGGLKPTVYPYKLYRLLPMRCKRAPY
FT                   KSYRNSSYVSAQGSSQRGESAPDTFIVPNLQSSEMPTLDFQDGRNTLPSSPAVPVETPS
FT                   RQGAPTSARVKNAEGIKWRKQAVKTNLVDNFDSTEVSVSSTGNTVSTTLQTEPACVSSV
FT                   GKGSEHSASVISYSGSVPSVIVHSSQFSSVIKHSNTIASLTNSNHKSPSQPVVSPSLIK
FT                   DSKPETDKASKSASRPKSIKEKKKTAPSNRGEITEEAKYIADHGGSSGKTTNAEETSKI
FT                   ETYIAKPALPGTSTNSNVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRKPKYQMQEET
FT                   LPRENDPETPGDSPLGLCQAECVEMSEAFDEVSDQDSTDKPWRPYYNYKPKKKSKQLRK
FT                   MRKVKWRKERRSRSPVGRCRYPAELDRAEVKLPPDKAFEEEEEEENKEMPKLQCELCDG
FT                   CPDGAAGAGAEGKPHQHLTSKPYICELCAKQFQSSSTLKMHMRCHTGEKPYQCKTCGRC
FT                   FSVQGNLQKHERIHLGVKEFICQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQGFLY
FT                   LSTKRNHERRHIREHDGKGFACFQCPKICKTAAALRMHQKKHLYKTLPKQEETGDTCHE
FT                   NADLLESQLCTDSEDSEQKDDIKAFAENVL"
FT   CDS             complement(7404751..7408341)
FT                   /codon_start=1
FT                   /gene="Zbtb38"
FT                   /locus_tag="mCG_21644"
FT                   /product="zinc finger and BTB domain containing 38, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21644.1 transcript_id=mCT20288.1
FT                   protein_id=mCP21274.1 isoform=CRA_a"
FT                   /protein_id="EDL20960.1"
FT                   /translation="MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFK
FT                   AHSNVLAASSLYFKNIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETV
FT                   TDLAAAGKKLGISFLEDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPR
FT                   ITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTASLCQERASVCHEVEPVRTLAEHS
FT                   YAVSSITEAYRSQPPREQDSSSSAKTGKETGDALATKAKPCRKPKPQTQDSDSTTENMP
FT                   LSLVTCPEVNQERSPQPAPDLSHSEPPSNEGDIHFPREDENQPSDAPGPGAAEVPPLVY
FT                   NCSCCSKSFDSSTLLSAHMQLHKPTQEPFVCKYCNKQFTTLNRLDRHEQICMRSSHVPI
FT                   PGGNPPFLENYPTIGQDGTSFRSPESLGPENRIGELSSAGSALSDADHMVKFVNGQMLY
FT                   SCIVCKRSYVTLSSLRRHANVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCI
FT                   FCLETFMTYYILKNHQKSFHAIDHRLSINKKTANGGLKPTVYPYKLYRLLPMRCKRAPY
FT                   KSYRNSSYVSAQGSSQRGESAPDTFIVPNLQSSEMPTLDFQDGRNTLPSSPAVPVETPS
FT                   RQGAPTSARVKNAEGIKWRKQAVKTNLVDNFDSTEVSVSSTGNTVSTTLQTEPACVSSV
FT                   GKGSEHSASVISYSGSVPSVIVHSSQFSSVIKHSNTIASLTNSNHKSPSQPVVSPSLIK
FT                   DSKPETDKASKSASRPKSIKEKKKTAPSNRGEITEEAKYIADHGGSSGKTTNAEETSKI
FT                   ETYIAKPALPGTSTNSNVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRKPKYQMQEET
FT                   LPRENDPETPGDSPLGLCQAECVEMSEAFDEVSDQDSTDKPWRPYYNYKPKKKSKQLRK
FT                   MRKVKWRKERRSRSPVGRCRYPAELDRAEVKLPPDKAFEEEEEEENKEMPKLQCELCDG
FT                   CPDGAAGAGAEGKPHQHLTSKPYICELCAKQFQSSSTLKMHMRCHTGEKPYQCKTCGRC
FT                   FSVQGNLQKHERIHLGVKEFICQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQGFLY
FT                   LSTKRNHERRHIREHDGKGFACFQCPKICKTAAALRMHQKKHLYKTLPKQEETGDTCHE
FT                   NADLLESQLCTDSEDSEQKDDIKAFAENVL"
FT   gene            7425168..7430790
FT                   /locus_tag="mCG_147711"
FT                   /note="gene_id=mCG147711.0"
FT   mRNA            join(7425168..7426223,7429032..7430790)
FT                   /locus_tag="mCG_147711"
FT                   /product="mCG147711"
FT                   /note="gene_id=mCG147711.0 transcript_id=mCT187974.0
FT                   created on 13-JAN-2004"
FT   CDS             7425673..7426194
FT                   /codon_start=1
FT                   /locus_tag="mCG_147711"
FT                   /product="mCG147711"
FT                   /note="gene_id=mCG147711.0 transcript_id=mCT187974.0
FT                   protein_id=mCP108537.0"
FT                   /protein_id="EDL20961.1"
FT                   /translation="MVSRHYELEVSEVLTSDPGSFRAAGTASGGEKKKVSQYLERVTCS
FT                   SAAPFSRVSAKPYKQRTLHSLSQQVLDQFPSTSVLSNPAPASCDRSILVLCPAMESRQP
FT                   VIVSAPISAYQAKYLLPHPDSFQRPTLWTQTQQRQKRPAVSILVVLSHLQTLSYTPTHF
FT                   PSCDVHAAME"
FT   gene            7488558..7494962
FT                   /locus_tag="mCG_1032863"
FT                   /note="gene_id=mCG1032863.1"
FT   mRNA            join(7488558..7488661,7492960..7493077,7493293..7493438,
FT                   7494823..7494962)
FT                   /locus_tag="mCG_1032863"
FT                   /product="mCG1032863, transcript variant mCT170320"
FT                   /note="gene_id=mCG1032863.1 transcript_id=mCT170320.0
FT                   created on 24-JUN-2002"
FT   mRNA            join(7488558..7488661,7492960..7493077,7493293..7493438,
FT                   7494910..7494956)
FT                   /locus_tag="mCG_1032863"
FT                   /product="mCG1032863, transcript variant mCT150567"
FT                   /note="gene_id=mCG1032863.1 transcript_id=mCT150567.1
FT                   created on 24-JUN-2002"
FT   CDS             join(7493073..7493077,7493293..7493431)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032863"
FT                   /product="mCG1032863, isoform CRA_a"
FT                   /note="gene_id=mCG1032863.1 transcript_id=mCT150567.1
FT                   protein_id=mCP68647.1 isoform=CRA_a"
FT                   /protein_id="EDL20962.1"
FT                   /translation="MSFGLDVRLPFHFICQHVSHSRSVYKQVTEGGSALTYLTLFRLKT
FT                   KR"
FT   CDS             join(7493073..7493077,7493293..7493431)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032863"
FT                   /product="mCG1032863, isoform CRA_a"
FT                   /note="gene_id=mCG1032863.1 transcript_id=mCT170320.0
FT                   protein_id=mCP93238.0 isoform=CRA_a"
FT                   /protein_id="EDL20963.1"
FT                   /translation="MSFGLDVRLPFHFICQHVSHSRSVYKQVTEGGSALTYLTLFRLKT
FT                   KR"
FT   gene            7503218..7505764
FT                   /locus_tag="mCG_140610"
FT                   /note="gene_id=mCG140610.0"
FT   mRNA            join(7503218..7503430,7505587..7505764)
FT                   /locus_tag="mCG_140610"
FT                   /product="mCG140610"
FT                   /note="gene_id=mCG140610.0 transcript_id=mCT170321.0
FT                   created on 24-JUN-2002"
FT   CDS             7503297..7503392
FT                   /codon_start=1
FT                   /locus_tag="mCG_140610"
FT                   /product="mCG140610"
FT                   /note="gene_id=mCG140610.0 transcript_id=mCT170321.0
FT                   protein_id=mCP93239.0"
FT                   /protein_id="EDL20964.1"
FT                   /translation="MECIRRTGTHDDWGPANHRTLTLPERWLVAM"
FT   gene            complement(7536536..7537474)
FT                   /pseudo
FT                   /locus_tag="mCG_1032753"
FT                   /note="gene_id=mCG1032753.1"
FT   mRNA            complement(7536536..7537474)
FT                   /pseudo
FT                   /locus_tag="mCG_1032753"
FT                   /note="gene_id=mCG1032753.1 transcript_id=mCT150457.1
FT                   created on 24-JUN-2002"
FT   gene            complement(7545530..7612892)
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /note="gene_id=mCG21642.2"
FT   mRNA            complement(join(7545530..7548734,7552042..7552181,
FT                   7562292..7562418,7563165..7563323,7579857..7579988,
FT                   7612779..7612892))
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /product="acid phosphatase-like 2, transcript variant
FT                   mCT20285"
FT                   /note="gene_id=mCG21642.2 transcript_id=mCT20285.2 created
FT                   on 20-FEB-2003"
FT   mRNA            complement(join(7545530..7548734,7552042..7552181,
FT                   7562292..7562418,7563165..7563323,7579857..7579988,
FT                   7584278..7584495,7612779..7612892))
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /product="acid phosphatase-like 2, transcript variant
FT                   mCT180711"
FT                   /note="gene_id=mCG21642.2 transcript_id=mCT180711.0 created
FT                   on 20-FEB-2003"
FT   mRNA            complement(join(7545530..7548734,7552042..7552181,
FT                   7562292..7562418,7563165..7563323,7579857..7579988,
FT                   7584278..7584513,7612779..7612892))
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /product="acid phosphatase-like 2, transcript variant
FT                   mCT170567"
FT                   /note="gene_id=mCG21642.2 transcript_id=mCT170567.0 created
FT                   on 20-FEB-2003"
FT   CDS             complement(join(7547797..7548734,7552042..7552181,
FT                   7562292..7562418,7563165..7563323,7579857..7579935))
FT                   /codon_start=1
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /product="acid phosphatase-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG21642.2 transcript_id=mCT170567.0
FT                   protein_id=mCP93485.0 isoform=CRA_a"
FT                   /protein_id="EDL20965.1"
FT                   /translation="MLHRNRFLVLLALAGLLAFLSLSLQFFHLIPVSATKNGGSSKSRK
FT                   RIMPDPVTEPPTVDPVYEALLYCNIPSVAEHSMEGHAPHHYKLVSVHVFIRHGDRYPLY
FT                   AIPKTKRPEIDCTLVASRKPYHPKLEAFISHMLKGSGASFESPLNSLPLYPNHPLCETG
FT                   ELTQTGVVQHLLNGQLLRDIYLRKHKLLPNNWSSDQLYLESTGKSRTLQSGLALLYGFL
FT                   PEFDWKKVYFKHQPSALFCSGSCYCPLRNQYLEKEQRRQYLLRLKNSDLERTYGEMAKI
FT                   VDIPTKQLRAANPIDSMLCHFCHNVSFPCSRSGCLGMEHFKVIKTHQIEDERERHEKLL
FT                   YFGYSLLGAHPILNQTVNRMQRAASGWRDELFTLYSAHDVTLSPILSALGLLEARFPRF
FT                   AARLVFELWQDRQKPSEHSVRILYNGADVTFHTSFCHDFHKRSPKPMCPLENLVRFVKR
FT                   DMFVALDGSSTNYYDACHGEGA"
FT   CDS             complement(join(7547797..7548734,7552042..7552181,
FT                   7562292..7562418,7563165..7563323,7579857..7579935))
FT                   /codon_start=1
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /product="acid phosphatase-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG21642.2 transcript_id=mCT180711.0
FT                   protein_id=mCP103633.0 isoform=CRA_a"
FT                   /protein_id="EDL20966.1"
FT                   /translation="MLHRNRFLVLLALAGLLAFLSLSLQFFHLIPVSATKNGGSSKSRK
FT                   RIMPDPVTEPPTVDPVYEALLYCNIPSVAEHSMEGHAPHHYKLVSVHVFIRHGDRYPLY
FT                   AIPKTKRPEIDCTLVASRKPYHPKLEAFISHMLKGSGASFESPLNSLPLYPNHPLCETG
FT                   ELTQTGVVQHLLNGQLLRDIYLRKHKLLPNNWSSDQLYLESTGKSRTLQSGLALLYGFL
FT                   PEFDWKKVYFKHQPSALFCSGSCYCPLRNQYLEKEQRRQYLLRLKNSDLERTYGEMAKI
FT                   VDIPTKQLRAANPIDSMLCHFCHNVSFPCSRSGCLGMEHFKVIKTHQIEDERERHEKLL
FT                   YFGYSLLGAHPILNQTVNRMQRAASGWRDELFTLYSAHDVTLSPILSALGLLEARFPRF
FT                   AARLVFELWQDRQKPSEHSVRILYNGADVTFHTSFCHDFHKRSPKPMCPLENLVRFVKR
FT                   DMFVALDGSSTNYYDACHGEGA"
FT   CDS             complement(join(7547797..7548734,7552042..7552181,
FT                   7562292..7562418,7563165..7563323,7579857..7579935))
FT                   /codon_start=1
FT                   /gene="Acpl2"
FT                   /locus_tag="mCG_21642"
FT                   /product="acid phosphatase-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG21642.2 transcript_id=mCT20285.2
FT                   protein_id=mCP21363.2 isoform=CRA_a"
FT                   /protein_id="EDL20967.1"
FT                   /translation="MLHRNRFLVLLALAGLLAFLSLSLQFFHLIPVSATKNGGSSKSRK
FT                   RIMPDPVTEPPTVDPVYEALLYCNIPSVAEHSMEGHAPHHYKLVSVHVFIRHGDRYPLY
FT                   AIPKTKRPEIDCTLVASRKPYHPKLEAFISHMLKGSGASFESPLNSLPLYPNHPLCETG
FT                   ELTQTGVVQHLLNGQLLRDIYLRKHKLLPNNWSSDQLYLESTGKSRTLQSGLALLYGFL
FT                   PEFDWKKVYFKHQPSALFCSGSCYCPLRNQYLEKEQRRQYLLRLKNSDLERTYGEMAKI
FT                   VDIPTKQLRAANPIDSMLCHFCHNVSFPCSRSGCLGMEHFKVIKTHQIEDERERHEKLL
FT                   YFGYSLLGAHPILNQTVNRMQRAASGWRDELFTLYSAHDVTLSPILSALGLLEARFPRF
FT                   AARLVFELWQDRQKPSEHSVRILYNGADVTFHTSFCHDFHKRSPKPMCPLENLVRFVKR
FT                   DMFVALDGSSTNYYDACHGEGA"
FT   gene            7619021..7619794
FT                   /pseudo
FT                   /locus_tag="mCG_21652"
FT                   /note="gene_id=mCG21652.2"
FT   mRNA            7619021..7619794
FT                   /pseudo
FT                   /locus_tag="mCG_21652"
FT                   /note="gene_id=mCG21652.2 transcript_id=mCT20295.2 created
FT                   on 16-JUL-2003"
FT   gene            7628802..7629812
FT                   /pseudo
FT                   /locus_tag="mCG_21648"
FT                   /note="gene_id=mCG21648.1"
FT   mRNA            7628802..7629812
FT                   /pseudo
FT                   /locus_tag="mCG_21648"
FT                   /note="gene_id=mCG21648.1 transcript_id=mCT20291.1 created
FT                   on 09-JUL-2002"
FT   gene            complement(7666939..7742313)
FT                   /gene="Spsb4"
FT                   /locus_tag="mCG_21649"
FT                   /note="gene_id=mCG21649.2"
FT   mRNA            complement(join(7666939..7668163,7718996..7719842,
FT                   7741611..7742313))
FT                   /gene="Spsb4"
FT                   /locus_tag="mCG_21649"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 4"
FT                   /note="gene_id=mCG21649.2 transcript_id=mCT20292.2 created
FT                   on 09-JUL-2002"
FT   CDS             complement(join(7668036..7668163,7718996..7719689))
FT                   /codon_start=1
FT                   /gene="Spsb4"
FT                   /locus_tag="mCG_21649"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 4"
FT                   /note="gene_id=mCG21649.2 transcript_id=mCT20292.2
FT                   protein_id=mCP21302.2"
FT                   /protein_id="EDL20968.1"
FT                   /translation="MGQKLSGSLKSVEVREPALRPAKRELRGLEPGRPARLDQLLDMPA
FT                   AGLAVQLRHAWNPEDRSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQIHW
FT                   PARQRGTHAVVGVATARAPLHSVGYTALVGSDSESWGWDLGRSRLYHDGKNRPGVAYPA
FT                   FLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEV
FT                   TMRYINGLDPEPLPLMDLCRRSIRSALGRQRLRDIGSLPLPQSLKNYLQYQ"
FT   gene            7739387..7742313
FT                   /locus_tag="mCG_140663"
FT                   /note="gene_id=mCG140663.0"
FT   mRNA            join(7739387..7739758,7741410..7742313)
FT                   /locus_tag="mCG_140663"
FT                   /product="mCG140663, transcript variant mCT170577"
FT                   /note="gene_id=mCG140663.0 transcript_id=mCT170577.0
FT                   created on 09-JUL-2002"
FT   mRNA            join(7741016..7741183,7741410..7742313)
FT                   /locus_tag="mCG_140663"
FT                   /product="mCG140663, transcript variant mCT170576"
FT                   /note="gene_id=mCG140663.0 transcript_id=mCT170576.0
FT                   created on 09-JUL-2002"
FT   CDS             7741732..7741881
FT                   /codon_start=1
FT                   /locus_tag="mCG_140663"
FT                   /product="mCG140663, isoform CRA_a"
FT                   /note="gene_id=mCG140663.0 transcript_id=mCT170576.0
FT                   protein_id=mCP93494.0 isoform=CRA_a"
FT                   /protein_id="EDL20969.1"
FT                   /translation="MLAAASQPAARPLDLYPAAAPSRSAGCPGVRDVLGEVDARERPPR
FT                   SGPE"
FT   CDS             7741732..7741881
FT                   /codon_start=1
FT                   /locus_tag="mCG_140663"
FT                   /product="mCG140663, isoform CRA_a"
FT                   /note="gene_id=mCG140663.0 transcript_id=mCT170577.0
FT                   protein_id=mCP93495.0 isoform=CRA_a"
FT                   /protein_id="EDL20970.1"
FT                   /translation="MLAAASQPAARPLDLYPAAAPSRSAGCPGVRDVLGEVDARERPPR
FT                   SGPE"
FT   gene            complement(7765943..7766249)
FT                   /pseudo
FT                   /locus_tag="mCG_140653"
FT                   /note="gene_id=mCG140653.0"
FT   mRNA            complement(7765943..7766249)
FT                   /pseudo
FT                   /locus_tag="mCG_140653"
FT                   /note="gene_id=mCG140653.0 transcript_id=mCT170544.0
FT                   created on 09-JUL-2002"
FT   gene            complement(7770860..7771753)
FT                   /locus_tag="mCG_1032865"
FT                   /note="gene_id=mCG1032865.0"
FT   mRNA            complement(join(7770860..7771271,7771662..7771753))
FT                   /locus_tag="mCG_1032865"
FT                   /product="mCG1032865"
FT                   /note="gene_id=mCG1032865.0 transcript_id=mCT150569.0
FT                   created on 09-JUL-2002"
FT   CDS             complement(7770994..7771209)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032865"
FT                   /product="mCG1032865"
FT                   /note="gene_id=mCG1032865.0 transcript_id=mCT150569.0
FT                   protein_id=mCP68655.1"
FT                   /protein_id="EDL20971.1"
FT                   /translation="MLDGSFRDAATIDVTSCKQPLAVVMYGSQEAHGVTMQDWTVACFC
FT                   CGCLIGLIALRSFRKKKKSHTFPVQN"
FT   gene            complement(7797952..7834376)
FT                   /gene="Slc25a36"
FT                   /locus_tag="mCG_146563"
FT                   /note="gene_id=mCG146563.0"
FT   mRNA            complement(join(7797952..7802578,7803532..7803821,
FT                   7808331..7808397,7816351..7816451,7820377..7820454,
FT                   7823349..7823513,7834156..7834376))
FT                   /gene="Slc25a36"
FT                   /locus_tag="mCG_146563"
FT                   /product="solute carrier family 25, member 36, transcript
FT                   variant mCT186826"
FT                   /note="gene_id=mCG146563.0 transcript_id=mCT186826.0
FT                   created on 25-NOV-2003"
FT   CDS             complement(join(7802385..7802578,7803532..7803821,
FT                   7808331..7808397,7816351..7816451,7820377..7820454,
FT                   7823349..7823513,7834156..7834196))
FT                   /codon_start=1
FT                   /gene="Slc25a36"
FT                   /locus_tag="mCG_146563"
FT                   /product="solute carrier family 25, member 36, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG146563.0 transcript_id=mCT186826.0
FT                   protein_id=mCP108065.0 isoform=CRA_b"
FT                   /protein_id="EDL20973.1"
FT                   /translation="MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISE
FT                   VQLNTMAGASVNRVVSPGPLHCLKAILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSN
FT                   CKEKLNGVFDPDSTQVHMASAAMAGFTAITATNPIWLIKTRLQLDARTRGEKQMGAFEC
FT                   VRKVYQTDGLRGFYRGMSASYAGISETVIHFVIYESIKQKLLECKTASMMETDEESVKE
FT                   ASDFVRMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLIVQEEGYGSLY
FT                   RGLTTHLVRQIPNTAIMMATYELVVYLLNG"
FT   mRNA            complement(join(7803706..7803821,7808331..7808397,
FT                   7813367..7813448,7816351..7816451,7820377..7820454,
FT                   7823349..7823513,7834156..>7834252))
FT                   /gene="Slc25a36"
FT                   /locus_tag="mCG_146563"
FT                   /product="solute carrier family 25, member 36, transcript
FT                   variant mCT191512"
FT                   /note="gene_id=mCG146563.0 transcript_id=mCT191512.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(7813435..7813448,7816351..7816451,
FT                   7820377..7820454,7823349..7823513,7834156..>7834250))
FT                   /codon_start=1
FT                   /gene="Slc25a36"
FT                   /locus_tag="mCG_146563"
FT                   /product="solute carrier family 25, member 36, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG146563.0 transcript_id=mCT191512.0
FT                   protein_id=mCP112473.0 isoform=CRA_a"
FT                   /protein_id="EDL20972.1"
FT                   /translation="GLLGPRPASTPGGHAEERMSQRDTLVHLFAGGCGGTVGAILTCPL
FT                   EVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKAILEKEGPRSLFRGLGP
FT                   NLVGVAPSRAIYFAAYSNCKEKLNGVFDPDSTQVHMASAAMAEHKN"
FT   gene            <7903892..>7904692
FT                   /locus_tag="mCG_18601"
FT                   /note="gene_id=mCG18601.0"
FT   mRNA            <7903892..>7904692
FT                   /locus_tag="mCG_18601"
FT                   /product="mCG18601"
FT                   /note="gene_id=mCG18601.0 transcript_id=mCT14765.0 created
FT                   on 14-AUG-2002"
FT   CDS             7903892..7904692
FT                   /codon_start=1
FT                   /locus_tag="mCG_18601"
FT                   /product="mCG18601"
FT                   /note="gene_id=mCG18601.0 transcript_id=mCT14765.0
FT                   protein_id=mCP21365.0"
FT                   /protein_id="EDL20974.1"
FT                   /translation="MPKVKKAKGKKVAPAPAVVKKQEAKKVVNPLFEKRPKNFGIGQDI
FT                   QPKRDLMRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRP
FT                   ETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDP
FT                   IELVVFLPALCRKMGVPYCIIKENARLGHLVHRKTCTTVAFTQVNSEDKGALAKLVEAI
FT                   RTNYNDSYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG"
FT   gene            complement(7933733..7935570)
FT                   /pseudo
FT                   /locus_tag="mCG_49766"
FT                   /note="gene_id=mCG49766.2"
FT   mRNA            complement(join(7933733..7934729,7935028..7935570))
FT                   /pseudo
FT                   /locus_tag="mCG_49766"
FT                   /note="gene_id=mCG49766.2 transcript_id=mCT49949.2 created
FT                   on 09-JUL-2002"
FT   gene            complement(7952630..7953552)
FT                   /pseudo
FT                   /locus_tag="mCG_1032754"
FT                   /note="gene_id=mCG1032754.1"
FT   mRNA            complement(7952630..7953552)
FT                   /pseudo
FT                   /locus_tag="mCG_1032754"
FT                   /note="gene_id=mCG1032754.1 transcript_id=mCT150458.1
FT                   created on 09-JUL-2002"
FT   gene            <8003378..8017181
FT                   /locus_tag="mCG_1032866"
FT                   /note="gene_id=mCG1032866.0"
FT   mRNA            join(<8003378..8003583,8006113..8006245,8017082..8017181)
FT                   /locus_tag="mCG_1032866"
FT                   /product="mCG1032866"
FT                   /note="gene_id=mCG1032866.0 transcript_id=mCT150570.0
FT                   created on 09-JUL-2002"
FT   CDS             join(<8006117..8006245,8017082..8017135)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032866"
FT                   /product="mCG1032866"
FT                   /note="gene_id=mCG1032866.0 transcript_id=mCT150570.0
FT                   protein_id=mCP68664.0"
FT                   /protein_id="EDL20975.1"
FT                   /translation="GFEYYIGEKRREEKRREEKRREEKRHCAHCLIPECGGVLCFPIDI
FT                   LKHPSLAPLHRRSSL"
FT   gene            complement(8067193..8087426)
FT                   /gene="Trim42"
FT                   /locus_tag="mCG_18603"
FT                   /note="gene_id=mCG18603.2"
FT   mRNA            complement(join(8067193..8067453,8080325..8081145,
FT                   8083046..8083743,8086971..8087426))
FT                   /gene="Trim42"
FT                   /locus_tag="mCG_18603"
FT                   /product="tripartite motif-containing 42"
FT                   /note="gene_id=mCG18603.2 transcript_id=mCT14767.2 created
FT                   on 09-JUL-2002"
FT   CDS             complement(join(8067367..8067453,8080325..8081145,
FT                   8083046..8083743,8086971..8087311))
FT                   /codon_start=1
FT                   /gene="Trim42"
FT                   /locus_tag="mCG_18603"
FT                   /product="tripartite motif-containing 42"
FT                   /note="gene_id=mCG18603.2 transcript_id=mCT14767.2
FT                   protein_id=mCP21396.2"
FT                   /protein_id="EDL20976.1"
FT                   /translation="METAMCVCSPCCTWQRCCPRLFSCLCCKFIFTSERNCTCFPCPYK
FT                   DERNCQFCHCTCAENPNCHWCCCSWANDPNCKCCCTASTNLKCYYYESHCCRNVTITFR
FT                   KGRLRSIVTSSKTALRVGSSDTQMDEPKTMPASSHLVSHLTCPMCNRLRLHSFMLPCNH
FT                   SLCEKCLRQLQKHAEVTENFFILICPMCSRSHCMPYSHQMHLPENYLRGRLTKRYMQQH
FT                   GYLKWRFDRSSGPILCQVCRTRRIAYKRCVTCRLNLCNDCLKAFHSDVAMQDHVFVDTS
FT                   AEDQDEKICIHHPSSRINEYCRSDNQLLCAFCKIAFHNGHDTVSLIDACSERSAALFSA
FT                   IAKFKAVRYEIDNDLMEFNILKSSFKADKEAKRKEVRNGFLKLRAILQEKEKIIMEQIE
FT                   NLEVSRQKEIEKYVYITTMKVNEMDGLIAYSKEALKETGQVAFLQSAKILVDQIEEGIQ
FT                   NTFRPDPQLRLHSLHCIPLDFAELSNAIHELFPTGPKKACSSGDSLPSQYPIHSEMMIA
FT                   RKVTFSTHSFGNQQIYQRSSSLISFNTANDKGKMGLENYGRAQSAAPAKTTDGLYTYWS
FT                   ATGETQPPQSSNSFHNWYSFNDTSVRTPGPIVIYQTLVYPRAAKVVTPDGRGKNRAKWG
FT                   LLKNIQSALQKRF"
FT   gene            complement(8161850..>8750765)
FT                   /gene="Clstn2"
FT                   /locus_tag="mCG_18600"
FT                   /note="gene_id=mCG18600.2"
FT   mRNA            complement(join(8161850..8163165,8172059..8172219,
FT                   8173902..8174086,8174789..8174912,8175023..8175168,
FT                   8175570..8175740,8178808..8179031,8180914..8181062,
FT                   8187080..8187246,8200290..8200452,8243773..8243894,
FT                   8250081..8250329,8259193..8259378,8288116..8288265,
FT                   8300018..8300226,8301063..8301258,8516932..8517054,
FT                   8750698..>8750765))
FT                   /gene="Clstn2"
FT                   /locus_tag="mCG_18600"
FT                   /product="calsyntenin 2"
FT                   /note="gene_id=mCG18600.2 transcript_id=mCT14764.1 created
FT                   on 16-AUG-2002"
FT   CDS             complement(join(8163105..8163165,8172059..8172219,
FT                   8173902..8174086,8174789..8174912,8175023..8175168,
FT                   8175570..8175740,8178808..8179031,8180914..8181062,
FT                   8187080..8187246,8200290..8200452,8243773..8243894,
FT                   8250081..8250329,8259193..8259378,8288116..8288265,
FT                   8300018..8300226,8301063..8301258,8516932..8517054,
FT                   8750698..>8750764))
FT                   /codon_start=1
FT                   /gene="Clstn2"
FT                   /locus_tag="mCG_18600"
FT                   /product="calsyntenin 2"
FT                   /note="gene_id=mCG18600.2 transcript_id=mCT14764.1
FT                   protein_id=mCP21342.1"
FT                   /protein_id="EDL20977.1"
FT                   /translation="VGSGGGSGDGGDSRRRRLLVAKVNKHKPWIETSYHGVITENNDTV
FT                   ILDPPLVALDKDAPVPFAGEICAFKIHGQELPFEAVVLNKTSGEGRLRAKSPIDCELQK
FT                   EYTFIIQAYDCGAGPREAAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVTEGKIYDS
FT                   ILQVEAIDEDCSPQYSQICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAY
FT                   DCGQKPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIHLETCDGAVSSL
FT                   QVTAELQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEM
FT                   IFKFDGRQGAKIPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHH
FT                   YALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDG
FT                   ATYEPYLVTNDWPIHPSHIAMQLTVGACWQGGEVAKPRFAQFFHGSLASLTIRPGKMES
FT                   QKVISCLQACKEGLDINSLESLGRGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINS
FT                   RQFPTAGVRRLRLSSKVQCFGEDVCISIPDVDAYIMVLQAIEPQITLQGTERFWRPAAQ
FT                   FESARGVTLFPDIKIVSTFAKTEASGDMRATGTAPKSAVLEEMLHNLDFCDILVLGGDL
FT                   DPRQECLELNHSELHQRHLDATNSTAGYSIYGVGSMNRYEQVLHHLRYRNWHPTSLETR
FT                   RFRIKCSELNGRYTSNEFNLEVSVLHEVRVSDKEHVNHLIVQPPFLQSVHHPETRSSIQ
FT                   RSSVVPSIATVVIIISVCMLVFVVAMGVYRVRIAHQHFIQETEAAKEAEMDWDDSALTI
FT                   TVNPMEKHEGPGHGEDETTEGEEEEEAEEGSSSSSSGSDDSEEEEEEGMGRVRHGQSGT
FT                   SSQSPERSTWNTAGVINIWK"
FT   gene            <8721271..8727785
FT                   /locus_tag="mCG_60674"
FT                   /note="gene_id=mCG60674.2"
FT   mRNA            join(<8721271..8721546,8727465..8727785)
FT                   /locus_tag="mCG_60674"
FT                   /product="mCG60674, transcript variant mCT170574"
FT                   /note="gene_id=mCG60674.2 transcript_id=mCT170574.0 created
FT                   on 09-JUL-2002"
FT   mRNA            join(<8721271..8721546,8722505..8723618)
FT                   /locus_tag="mCG_60674"
FT                   /product="mCG60674, transcript variant mCT60857"
FT                   /note="gene_id=mCG60674.2 transcript_id=mCT60857.2 created
FT                   on 09-JUL-2002"
FT   CDS             join(<8721424..8721546,8727465..8727509)
FT                   /codon_start=1
FT                   /locus_tag="mCG_60674"
FT                   /product="mCG60674, isoform CRA_a"
FT                   /note="gene_id=mCG60674.2 transcript_id=mCT170574.0
FT                   protein_id=mCP93492.0 isoform=CRA_a"
FT                   /protein_id="EDL20978.1"
FT                   /translation="SQSYPFSHSLGWSLSSGCSQAPIRVEGTIYSATEPVDTVLSLTPS
FT                   VQACCSAASM"
FT   CDS             join(<8721424..8721546,8722505..8722627)
FT                   /codon_start=1
FT                   /locus_tag="mCG_60674"
FT                   /product="mCG60674, isoform CRA_b"
FT                   /note="gene_id=mCG60674.2 transcript_id=mCT60857.2
FT                   protein_id=mCP41335.2 isoform=CRA_b"
FT                   /protein_id="EDL20979.1"
FT                   /translation="SQSYPFSHSLGWSLSSGCSQAPIRVEGTIYSATEPVDTVLSQYIL
FT                   HIKFLEYFKIRTNQNTKSLSCSICATTTEHHTLDRF"
FT   gene            complement(8904360..>8904985)
FT                   /locus_tag="mCG_52933"
FT                   /note="gene_id=mCG52933.2"
FT   mRNA            complement(join(8904360..8904657,8904768..>8904985))
FT                   /locus_tag="mCG_52933"
FT                   /product="mCG52933"
FT                   /note="gene_id=mCG52933.2 transcript_id=mCT53116.2 created
FT                   on 09-JUL-2002"
FT   CDS             complement(join(8904489..8904657,8904768..>8904985))
FT                   /codon_start=1
FT                   /locus_tag="mCG_52933"
FT                   /product="mCG52933"
FT                   /note="gene_id=mCG52933.2 transcript_id=mCT53116.2
FT                   protein_id=mCP41324.2"
FT                   /protein_id="EDL20980.1"
FT                   /translation="ISHSSSSDCLSDCTSKPETPGLGKLLCSPLLTRLSSHFRQITRTA
FT                   AWGWQHQEASFSRIQRDYLSTEAEHSYRCPGRMRPGLLSESKCVVKQSEEEEEEAWRKK
FT                   QEPWCQTDMALSPAAFTSMGGAVA"
FT   gene            9005004..9136718
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /note="gene_id=mCG9789.2"
FT   mRNA            join(9005004..9005126,9070255..9070400,9083517..9084307)
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /product="nicotinamide nucleotide adenylyltransferase 3,
FT                   transcript variant mCT170580"
FT                   /note="gene_id=mCG9789.2 transcript_id=mCT170580.0 created
FT                   on 09-JUL-2002"
FT   mRNA            join(9014127..9014524,9070255..9070400,9115680..9115863,
FT                   9119765..9119844,9126303..9127652)
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /product="nicotinamide nucleotide adenylyltransferase 3,
FT                   transcript variant mCT9858"
FT                   /note="gene_id=mCG9789.2 transcript_id=mCT9858.2 created on
FT                   09-JUL-2002"
FT   mRNA            join(9014153..9014276,9070255..9070400,9115680..9115863,
FT                   9119765..9119844,9136451..9136718)
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /product="nicotinamide nucleotide adenylyltransferase 3,
FT                   transcript variant mCT170579"
FT                   /note="gene_id=mCG9789.2 transcript_id=mCT170579.0 created
FT                   on 09-JUL-2002"
FT   gene            9019161..9019808
FT                   /pseudo
FT                   /locus_tag="mCG_9787"
FT                   /note="gene_id=mCG9787.0"
FT   mRNA            9019161..9019808
FT                   /pseudo
FT                   /locus_tag="mCG_9787"
FT                   /note="gene_id=mCG9787.0 transcript_id=mCT9856.0 created on
FT                   09-JUL-2002"
FT   CDS             join(9070292..9070400,9115680..9115863,9119765..9119844,
FT                   9136451..9136458)
FT                   /codon_start=1
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /product="nicotinamide nucleotide adenylyltransferase 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9789.2 transcript_id=mCT170579.0
FT                   protein_id=mCP93497.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V3F1"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="MGI:MGI:1921330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V3F1"
FT                   /protein_id="EDL20981.1"
FT                   /translation="MKNRIPVVLLACGSFNPITNMHLRLFEVARDHLHQTGRYQVIEGI
FT                   ISPVNDSYGKKDLVASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHREL
FT                   LRSSAQMDGPDPSKTPSASADA"
FT   CDS             join(9070292..9070400,9115680..9115863,9119765..9119844,
FT                   9126303..9126667)
FT                   /codon_start=1
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /product="nicotinamide nucleotide adenylyltransferase 3,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9789.2 transcript_id=mCT9858.2
FT                   protein_id=mCP21402.2 isoform=CRA_c"
FT                   /protein_id="EDL20983.1"
FT                   /translation="MKNRIPVVLLACGSFNPITNMHLRLFEVARDHLHQTGRYQVIEGI
FT                   ISPVNDSYGKKDLVASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHREL
FT                   LRSSAQMDGPDPSKTPSASAALPELKLLCGADVLKTFQTPNLWKDTHIQEIVEKFGLVC
FT                   VSRSGHDPERYISDSPILQQFQHNIHLAREPVLNEISATYVRKALGQGQSVKYLLPEAV
FT                   ITYIRDQGLYINDGSWKGKGKTG"
FT   CDS             join(9070292..9070400,9083517..9083686)
FT                   /codon_start=1
FT                   /gene="Nmnat3"
FT                   /locus_tag="mCG_9789"
FT                   /product="nicotinamide nucleotide adenylyltransferase 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG9789.2 transcript_id=mCT170580.0
FT                   protein_id=mCP93498.0 isoform=CRA_b"
FT                   /protein_id="EDL20982.1"
FT                   /translation="MKNRIPVVLLACGSFNPITNMHLRLFEVARDHLHQTELLEATCSK
FT                   ALVSGIDEEHSKLNHQSSQPLQERSKDIMRHRSMAHMRLVRRMWRDS"
FT   gene            9139287..9162788
FT                   /gene="Rbp1"
FT                   /locus_tag="mCG_9784"
FT                   /note="gene_id=mCG9784.2"
FT   mRNA            join(9139287..9141344,9141747..9141925,9160804..9160905,
FT                   9162510..9162788)
FT                   /gene="Rbp1"
FT                   /locus_tag="mCG_9784"
FT                   /product="retinol binding protein 1, cellular"
FT                   /note="gene_id=mCG9784.2 transcript_id=mCT9853.2 created on
FT                   09-JUL-2002"
FT   CDS             join(9141272..9141344,9141747..9141925,9160804..9160905,
FT                   9162510..9162563)
FT                   /codon_start=1
FT                   /gene="Rbp1"
FT                   /locus_tag="mCG_9784"
FT                   /product="retinol binding protein 1, cellular"
FT                   /note="gene_id=mCG9784.2 transcript_id=mCT9853.2
FT                   protein_id=mCP21366.2 partial"
FT                   /db_xref="GOA:Q58EU7"
FT                   /db_xref="InterPro:IPR000463"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="MGI:MGI:97876"
FT                   /db_xref="UniProtKB/TrEMBL:Q58EU7"
FT                   /protein_id="EDL20984.1"
FT                   /translation="MPVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQ
FT                   DGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEG
FT                   RGWTQWIEGDELHLEMRAEGVICKQVFKKVH"
FT   gene            9195327..9219016
FT                   /gene="Rbp2"
FT                   /locus_tag="mCG_9785"
FT                   /note="gene_id=mCG9785.2"
FT   mRNA            join(9195327..9195458,9199792..9199926,9207986..9208164,
FT                   9216987..9217088,9218772..9219016)
FT                   /gene="Rbp2"
FT                   /locus_tag="mCG_9785"
FT                   /product="retinol binding protein 2, cellular"
FT                   /note="gene_id=mCG9785.2 transcript_id=mCT9854.1 created on
FT                   09-JUL-2002"
FT   CDS             join(9199854..9199926,9207986..9208164,9216987..9217088,
FT                   9218772..9218822)
FT                   /codon_start=1
FT                   /gene="Rbp2"
FT                   /locus_tag="mCG_9785"
FT                   /product="retinol binding protein 2, cellular"
FT                   /note="gene_id=mCG9785.2 transcript_id=mCT9854.1
FT                   protein_id=mCP21339.1"
FT                   /db_xref="GOA:Q059R7"
FT                   /db_xref="InterPro:IPR000463"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="MGI:MGI:97877"
FT                   /db_xref="UniProtKB/TrEMBL:Q059R7"
FT                   /protein_id="EDL20985.1"
FT                   /translation="MTKDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKIITQ
FT                   DGDNFKTKTNSTFRNYDLDFTVGVEFDEHTKGLDGRHVKTLVTWEGNTLVCVQKGEKEN
FT                   RGWKQWVEGDKLYLELTCGDQVCRQVFKKK"
FT   gene            complement(9271802..9272953)
FT                   /locus_tag="mCG_1032870"
FT                   /note="gene_id=mCG1032870.1"
FT   mRNA            complement(9271802..9272953)
FT                   /locus_tag="mCG_1032870"
FT                   /product="mCG1032870"
FT                   /note="gene_id=mCG1032870.1 transcript_id=mCT150574.1
FT                   created on 09-JUL-2002"
FT   CDS             complement(9272495..9272836)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032870"
FT                   /product="mCG1032870"
FT                   /note="gene_id=mCG1032870.1 transcript_id=mCT150574.1
FT                   protein_id=mCP68825.1"
FT                   /db_xref="GOA:Q8BH39"
FT                   /db_xref="MGI:MGI:1923131"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BH39"
FT                   /protein_id="EDL20986.1"
FT                   /translation="MERSAGFLLNVGSSGGARKRYPNSVSLWQRKESSKTVYSSGLRNG
FT                   AQSGVWVLGETDRGGKDVGAAPAFEAPRSPEILVLEAPGGSRVITLQRASTGSFVWLCT
FT                   FSWWYCHIT"
FT   gene            9273063..9297724
FT                   /gene="Copb2"
FT                   /locus_tag="mCG_9781"
FT                   /note="gene_id=mCG9781.2"
FT   mRNA            join(9273063..9273165,9277335..9277472,9279651..9279737,
FT                   9279928..9280054,9280839..9280987,9282782..9282928,
FT                   9283413..9283512,9286305..9286447,9286675..9286874,
FT                   9288328..9288438,9289429..9289517,9289605..9289711,
FT                   9290482..9290625,9291619..9291749,9292037..9292244,
FT                   9294330..9294440,9295279..9295493,9296387..9296479,
FT                   9296572..9296752,9296899..9296967,9297108..9297176,
FT                   9297392..9297724)
FT                   /gene="Copb2"
FT                   /locus_tag="mCG_9781"
FT                   /product="coatomer protein complex, subunit beta 2 (beta
FT                   prime)"
FT                   /note="gene_id=mCG9781.2 transcript_id=mCT9852.2 created on
FT                   09-JUL-2002"
FT   CDS             join(9273163..9273165,9277335..9277472,9279651..9279737,
FT                   9279928..9280054,9280839..9280987,9282782..9282928,
FT                   9283413..9283512,9286305..9286447,9286675..9286874,
FT                   9288328..9288438,9289429..9289517,9289605..9289711,
FT                   9290482..9290625,9291619..9291749,9292037..9292244,
FT                   9294330..9294440,9295279..9295493,9296387..9296479,
FT                   9296572..9296752,9296899..9296967,9297108..9297176,
FT                   9297392..9297487)
FT                   /codon_start=1
FT                   /gene="Copb2"
FT                   /locus_tag="mCG_9781"
FT                   /product="coatomer protein complex, subunit beta 2 (beta
FT                   prime)"
FT                   /note="gene_id=mCG9781.2 transcript_id=mCT9852.2
FT                   protein_id=mCP21322.2"
FT                   /protein_id="EDL20987.1"
FT                   /translation="MPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHE
FT                   TQTLVKTFEVCDLPVRAAKFVARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRC
FT                   IAVHPTQPFILTSSDDMLIKLWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQFASASL
FT                   DRTIKVWQLGSSSPNFTLEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIWDYQNKTCV
FT                   QTLEGHAQNVSCASFHPELPIIITGSEDGTVRIWHSSTYRLESTLNYGMERVWCVASLR
FT                   GSNNVALGYDEGSIIVKLGREEPAMSMDANGKIIWAKHSEVQQANLKAMGDTEIKDGER
FT                   LPLAVKDMGSCEIYPQTIQHNPNGRFVVVCGDGEYIIYTAMALRNKSFGSAQEFAWAHD
FT                   SSEYAIRESNSIVKIFKNFKEKKSFKPDFGAESIYGGFLLGVRSVNGLAFYDWENTELI
FT                   RRIEIQPKHIFWSDSGELVCIATEESFFILKYLSEKVLAAQETHEGVTEDGIEDAFEVL
FT                   GEIQEIVKTGLWVGDCFIYTSSVNRLNYYVGGEIVTIAHLDRTMYLLGYIPKDNRLYLG
FT                   DKELNIVSYSLLVSVLEYQTAVMRRDFSMADKVLPTIPKEQRTRVAHFLEKQGFKQQAL
FT                   TVSTDPEHRFELALQLGELKIAYQLAVEAESEQKWKQLAELAISKCQFSLAQECLHHAQ
FT                   DYGGLLLLATASGNASMVNKLAEGAERDGKNNVAFMSYFLQGKLDACLELLIRTGRLPE
FT                   AAFLARTYLPSQVSRVVKLWRENLSKVNQKAAESLADPTEYENLFPGLKEAFVVEEWVK
FT                   ETHADLWPAKQYPLVTPNEERNVMEEAKGFQPSRPTAQQEPDGKPASSPVIMASQTTHK
FT                   EEKSLLELEVDLDNLELEDIDTTDINLDEDILDD"
FT   gene            complement(9298084..9310989)
FT                   /gene="Mrps22"
FT                   /locus_tag="mCG_9783"
FT                   /note="gene_id=mCG9783.2"
FT   mRNA            complement(join(9298084..9298273,9299382..9299490,
FT                   9301903..9302048,9303421..9303504,9304018..9304161,
FT                   9306147..9306311,9307462..9307625,9310800..9310989))
FT                   /gene="Mrps22"
FT                   /locus_tag="mCG_9783"
FT                   /product="mitochondrial ribosomal protein S22"
FT                   /note="gene_id=mCG9783.2 transcript_id=mCT9851.1 created on
FT                   09-JUL-2002"
FT   CDS             complement(join(9298178..9298273,9299382..9299490,
FT                   9301903..9302048,9303421..9303504,9304018..9304161,
FT                   9306147..9306311,9307462..9307625,9310800..9310971))
FT                   /codon_start=1
FT                   /gene="Mrps22"
FT                   /locus_tag="mCG_9783"
FT                   /product="mitochondrial ribosomal protein S22"
FT                   /note="gene_id=mCG9783.2 transcript_id=mCT9851.1
FT                   protein_id=mCP21325.1"
FT                   /protein_id="EDL20988.1"
FT                   /translation="MAAVRTPLSLWRFQLGSRRARRVCTRATAQRHPDALLATRPQPFE
FT                   VGQPRRLLSSEAESGSSEVKKPAFMDEEVQRILTKITGLDLQKTFRPAIQPLKPPTYKL
FT                   MTQAQLEEATRLAVEAAKVRLKMPPVLEERKPINDVLAEDKILEGTETNKYVFTDISYN
FT                   IPHRERFIVVREPSGTLRKASWEERDRVIQIYFPKEGRRVLPPVIFKDENLKTMYSQDR
FT                   HADVLNLCVAQFEPDSAEYIKVHHQTYEDIDRHGKYELLRSTRHFGGMAWYFVNKKKID
FT                   GLLIDQIQRDLVDDATSLVQLYHMLHPDGQSAQEAKEQAAEGVDLIKVFAKTEAQRGAY
FT                   IELALQTYQEIVTSHSAAS"
FT   gene            complement(<9450473..9516429)
FT                   /locus_tag="mCG_1051021"
FT                   /note="gene_id=mCG1051021.0"
FT   mRNA            complement(join(<9450473..9451306,9459639..9459768,
FT                   9516276..9516429))
FT                   /locus_tag="mCG_1051021"
FT                   /product="mCG1051021"
FT                   /note="gene_id=mCG1051021.0 transcript_id=mCT194810.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(<9450473..9450733)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051021"
FT                   /product="mCG1051021"
FT                   /note="gene_id=mCG1051021.0 transcript_id=mCT194810.0
FT                   protein_id=mCP115839.0"
FT                   /protein_id="EDL20989.1"
FT                   /translation="MAANTSAVVRRGQQVNAIEEERKCGLSGSLTHVASVACGPVLSLY
FT                   RDSDDQKMYLVMTRNQQWVMVRYEFDLWIERTLHFVGANRVQ"
FT   gene            <9538882..9539940
FT                   /locus_tag="mCG_65589"
FT                   /note="gene_id=mCG65589.2"
FT   mRNA            <9538882..9539940
FT                   /locus_tag="mCG_65589"
FT                   /product="mCG65589"
FT                   /note="gene_id=mCG65589.2 transcript_id=mCT65772.2 created
FT                   on 09-JUL-2002"
FT   CDS             9538882..9539658
FT                   /codon_start=1
FT                   /locus_tag="mCG_65589"
FT                   /product="mCG65589"
FT                   /note="gene_id=mCG65589.2 transcript_id=mCT65772.2
FT                   protein_id=mCP41311.2"
FT                   /db_xref="GOA:G3UW32"
FT                   /db_xref="InterPro:IPR018903"
FT                   /db_xref="MGI:MGI:3645743"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW32"
FT                   /protein_id="EDL20990.1"
FT                   /translation="MLRTRPRSPSANPAPCWSPQTPAPSPAKRRRLHQEPACPEPLAQP
FT                   ELEAPAEPASSALTSVVFLAAGSALQLPLDGIDLLLEPEPTSVLQVSLQEHTILLVPEG
FT                   LMTQPQPGQPGFVAISPQGAAAQDGPQDHLVGLQEETFCEYFYQEDVCDEDADLELLEP
FT                   WARPPDDQANGNFSSIPGVPSPLLQEQVPGPSTGAERYSPRFIWELDSYLLGPLPGSPL
FT                   QPLPPSPSQSPQEQLPPRPPCSPRAPCKARKRLVYD"
FT   gene            <9552872..>9553633
FT                   /locus_tag="mCG_140662"
FT                   /note="gene_id=mCG140662.0"
FT   mRNA            <9552872..>9553633
FT                   /locus_tag="mCG_140662"
FT                   /product="mCG140662"
FT                   /note="gene_id=mCG140662.0 transcript_id=mCT170573.0
FT                   created on 09-JUL-2002"
FT   CDS             9552872..9553633
FT                   /codon_start=1
FT                   /locus_tag="mCG_140662"
FT                   /product="mCG140662"
FT                   /note="gene_id=mCG140662.0 transcript_id=mCT170573.0
FT                   protein_id=mCP93491.0"
FT                   /db_xref="GOA:D3YWX5"
FT                   /db_xref="InterPro:IPR018903"
FT                   /db_xref="MGI:MGI:3645937"
FT                   /db_xref="UniProtKB/TrEMBL:D3YWX5"
FT                   /protein_id="EDL20991.1"
FT                   /translation="MLRTRPRSPCVDPAPCWSPQTSAPSPAKRRRLHQEPACPEPLAQP
FT                   ELEAPAEPTTSVVFLAAGSALQLPLDGIDLLLEPEPTSVLQVSLQGHTILLVPEGLMTQ
FT                   PQPGQPGFVAISPQGAAAQDGPQDHLVGLQEETCEYFYQEDVCNEDADLEFLEPWARPP
FT                   DDQANGSFFSIPGVPSPLLQEQVPGPSTGAERYSPRSIWELDSYLLGPLPGSPLQPLPP
FT                   SPSQSPQEQLPPCPPCSPRAPCKARKRLVYD"
FT   gene            9561069..9562859
FT                   /locus_tag="mCG_140661"
FT                   /note="gene_id=mCG140661.0"
FT   mRNA            9561069..9562859
FT                   /locus_tag="mCG_140661"
FT                   /product="mCG140661"
FT                   /note="gene_id=mCG140661.0 transcript_id=mCT170572.0
FT                   created on 09-JUL-2002"
FT   CDS             9561275..9562039
FT                   /codon_start=1
FT                   /locus_tag="mCG_140661"
FT                   /product="mCG140661"
FT                   /note="gene_id=mCG140661.0 transcript_id=mCT170572.0
FT                   protein_id=mCP93490.0"
FT                   /protein_id="EDL20992.1"
FT                   /translation="MLRTRPRSPSADPAPCWSPQTPAPSPAKRRRLHQEPACPEPLAQP
FT                   ELEAPAEPTTSVVFLAAGSALQLPLDGVDLLLEPEPTSVLQVSLQGHTILLVPEGLQDS
FT                   THFGQPGFVAISPQGAAAQDGPQDHLVGLQEETFCEYFYQEDVCDEDADLEFLEHWASP
FT                   PDDQANGNFSSIPGVPSPLSQDQVPGPSTGAEQYSPRFIWELDINMLGPFPGSPLQPLP
FT                   PSPSRNPQEQLPPCPPCSPRAPRRARKRLVYE"
FT   gene            complement(9566022..9568757)
FT                   /pseudo
FT                   /locus_tag="mCG_113821"
FT                   /note="gene_id=mCG113821.1"
FT   mRNA            complement(9566022..9568757)
FT                   /pseudo
FT                   /locus_tag="mCG_113821"
FT                   /note="gene_id=mCG113821.1 transcript_id=mCT114909.1
FT                   created on 09-JUL-2002"
FT   gene            9582874..9583593
FT                   /pseudo
FT                   /locus_tag="mCG_140655"
FT                   /note="gene_id=mCG140655.0"
FT   mRNA            9582874..9583593
FT                   /pseudo
FT                   /locus_tag="mCG_140655"
FT                   /note="gene_id=mCG140655.0 transcript_id=mCT170546.0
FT                   created on 09-JUL-2002"
FT   gene            9592263..9592658
FT                   /pseudo
FT                   /locus_tag="mCG_140654"
FT                   /note="gene_id=mCG140654.0"
FT   mRNA            9592263..9592658
FT                   /pseudo
FT                   /locus_tag="mCG_140654"
FT                   /note="gene_id=mCG140654.0 transcript_id=mCT170545.0
FT                   created on 09-JUL-2002"
FT   gene            complement(9626642..9627025)
FT                   /pseudo
FT                   /locus_tag="mCG_50376"
FT                   /note="gene_id=mCG50376.2"
FT   mRNA            complement(9626642..9627025)
FT                   /pseudo
FT                   /locus_tag="mCG_50376"
FT                   /note="gene_id=mCG50376.2 transcript_id=mCT50559.2 created
FT                   on 09-JUL-2002"
FT   gene            <9657104..>9658470
FT                   /locus_tag="mCG_52244"
FT                   /note="gene_id=mCG52244.2"
FT   mRNA            join(<9657104..9657636,9658143..>9658470)
FT                   /locus_tag="mCG_52244"
FT                   /product="mCG52244"
FT                   /note="gene_id=mCG52244.2 transcript_id=mCT52427.2 created
FT                   on 10-JUL-2002"
FT   CDS             join(9657104..9657636,9658143..9658470)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52244"
FT                   /product="mCG52244"
FT                   /note="gene_id=mCG52244.2 transcript_id=mCT52427.2
FT                   protein_id=mCP41380.2"
FT                   /protein_id="EDL20993.1"
FT                   /translation="MMASYPEPEDTAGTLLAPESGRAVKEAEASPPSPGKGGGTTPEKP
FT                   DPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSL
FT                   NECFIKVPREGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLF
FT                   GSGGAAGGCGVPGAGCGGIRLGGPPAAPPPPPPPPHPHPHPHAHHLHAAAAPPPAPPHH
FT                   GAAAPPPGQLSPASPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALH
FT                   SRLDL"
FT   gene            9687862..9703507
FT                   /gene="Faim"
FT                   /locus_tag="mCG_9782"
FT                   /note="gene_id=mCG9782.1"
FT   mRNA            join(9687862..9688001,9692404..9692460,9693590..9693722,
FT                   9694002..9694230,9700456..9700505,9703044..9703507)
FT                   /gene="Faim"
FT                   /locus_tag="mCG_9782"
FT                   /product="Fas apoptotic inhibitory molecule, transcript
FT                   variant mCT170578"
FT                   /note="gene_id=mCG9782.1 transcript_id=mCT170578.0 created
FT                   on 10-JUL-2002"
FT   mRNA            join(9687862..9688001,9693590..9693722,9694002..9694230,
FT                   9700456..9700505,9703044..9703507)
FT                   /gene="Faim"
FT                   /locus_tag="mCG_9782"
FT                   /product="Fas apoptotic inhibitory molecule, transcript
FT                   variant mCT9850"
FT                   /note="gene_id=mCG9782.1 transcript_id=mCT9850.1 created on
FT                   10-JUL-2002"
FT   CDS             join(9692417..9692460,9693590..9693722,9694002..9694230,
FT                   9700456..9700505,9703044..9703193)
FT                   /codon_start=1
FT                   /gene="Faim"
FT                   /locus_tag="mCG_9782"
FT                   /product="Fas apoptotic inhibitory molecule, isoform CRA_a"
FT                   /note="gene_id=mCG9782.1 transcript_id=mCT170578.0
FT                   protein_id=mCP93496.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3Z3C1"
FT                   /db_xref="InterPro:IPR010695"
FT                   /db_xref="MGI:MGI:1344387"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z3C1"
FT                   /protein_id="EDL20994.1"
FT                   /translation="MASGDDSPIFEDDESPLYSLEKMTDLVAVWDVALSDGVHKIEFEH
FT                   GTTSGKRVVYVDGKEEIRREWMFKLVGKETFFVGAAKTKATINIDAISGFAYEYTLEID
FT                   GKSLKKYMENRSKTTSTWVLRLDGEDLRVVLEKDTMDVWCNGQKMETAGEFVDDGTETH
FT                   FSVGNHGCYIKAVSSGKRKEGIIHTLIVDNREIPELTQ"
FT   CDS             join(9693612..9693722,9694002..9694230,9700456..9700505,
FT                   9703044..9703193)
FT                   /codon_start=1
FT                   /gene="Faim"
FT                   /locus_tag="mCG_9782"
FT                   /product="Fas apoptotic inhibitory molecule, isoform CRA_b"
FT                   /note="gene_id=mCG9782.1 transcript_id=mCT9850.1
FT                   protein_id=mCP21321.0 isoform=CRA_b"
FT                   /protein_id="EDL20995.1"
FT                   /translation="MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRREWM
FT                   FKLVGKETFFVGAAKTKATINIDAISGFAYEYTLEIDGKSLKKYMENRSKTTSTWVLRL
FT                   DGEDLRVVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHGCYIKAVSSGKRKEGI
FT                   IHTLIVDNREIPELTQ"
FT   gene            complement(9708288..>9712768)
FT                   /locus_tag="mCG_9779"
FT                   /note="gene_id=mCG9779.2"
FT   mRNA            complement(join(9708288..9708570,9710731..9710935,
FT                   9712599..>9712768))
FT                   /locus_tag="mCG_9779"
FT                   /product="mCG9779"
FT                   /note="gene_id=mCG9779.2 transcript_id=mCT9848.2 created on
FT                   10-JUL-2002"
FT   CDS             complement(join(9708566..9708570,9710731..9710935,
FT                   9712599..>9712766))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9779"
FT                   /product="mCG9779"
FT                   /note="gene_id=mCG9779.2 transcript_id=mCT9848.2
FT                   protein_id=mCP21319.2"
FT                   /protein_id="EDL20996.1"
FT                   /translation="HIGSVSITTPEQTIQKARGETVHLPCTFTLSPEDHGPLFIDWMQL
FT                   TGPQNEVVNRMFIVYLADKIYDNFYQDMKGRVQFTSNDIRSGEASINITDARLSDAGTY
FT                   QCGVSHAFGTAKGTIQLTVVG"
FT   gene            complement(<9715674..9737107)
FT                   /locus_tag="mCG_113820"
FT                   /note="gene_id=mCG113820.1"
FT   mRNA            complement(join(<9715674..9715878,9717605..9717774,
FT                   9719792..9719996,9724651..9724820,9736985..9737107))
FT                   /locus_tag="mCG_113820"
FT                   /product="mCG113820"
FT                   /note="gene_id=mCG113820.1 transcript_id=mCT114908.1
FT                   created on 10-JUL-2002"
FT   CDS             complement(join(<9715674..9715878,9717605..9717774,
FT                   9719792..9719996,9724651..9724820,9736985..9737027))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113820"
FT                   /product="mCG113820"
FT                   /note="gene_id=mCG113820.1 transcript_id=mCT114908.1
FT                   protein_id=mCP68852.1"
FT                   /protein_id="EDL20997.1"
FT                   /translation="MVFLLGFLFLCGVTDHIGSVSITTPEQTIQEVQGETVHLPCMFTL
FT                   SPEDQGPLDIEWLRLSGPNNEAMDHVIILYAVDKIYSDFYQDMRGRVNFTSNGITSGEA
FT                   SIKIRDVQPADSGTYLCKVKTAPGVAKTTVQLTVVDYIGSVSITTPEQTIEKDQGETVH
FT                   LPCMFTFISKDQGPLNIEWLRLSGPNNEAMDHVVILYSADKIHDDVYPDLKGRVYFTSN
FT                   DIKSGDASINITNVQLSDAGTYQCKVKTYPGTVNRNLQLAVT"
FT   gene            complement(9739806..9825751)
FT                   /gene="Pik3cb"
FT                   /locus_tag="mCG_113823"
FT                   /note="gene_id=mCG113823.1"
FT   mRNA            complement(join(9739806..9741254,9742328..9742460,
FT                   9743931..9744076,9746152..9746275,9747954..9748121,
FT                   9753723..9753801,9755389..9755498,9756760..9756938,
FT                   9761603..9761702,9763149..9763292,9764255..9764376,
FT                   9765442..9765630,9766982..9767032,9771663..9771793,
FT                   9772770..9772866,9775004..9775255,9791914..9791991,
FT                   9793459..9793629,9796334..9796513,9797731..9797954,
FT                   9804484..9804709,9808850..9809036,9825655..9825751))
FT                   /gene="Pik3cb"
FT                   /locus_tag="mCG_113823"
FT                   /product="phosphatidylinositol 3-kinase, catalytic, beta
FT                   polypeptide"
FT                   /note="gene_id=mCG113823.1 transcript_id=mCT114911.1
FT                   created on 10-JUL-2002"
FT   CDS             complement(join(9741117..9741254,9742328..9742460,
FT                   9743931..9744076,9746152..9746275,9747954..9748121,
FT                   9753723..9753801,9755389..9755498,9756760..9756938,
FT                   9761603..9761702,9763149..9763292,9764255..9764376,
FT                   9765442..9765630,9766982..9767032,9771663..9771793,
FT                   9772770..9772866,9775004..9775255,9791914..9791991,
FT                   9793459..9793629,9796334..9796513,9797731..9797954,
FT                   9804484..9804709,9808850..9809002))
FT                   /codon_start=1
FT                   /gene="Pik3cb"
FT                   /locus_tag="mCG_113823"
FT                   /product="phosphatidylinositol 3-kinase, catalytic, beta
FT                   polypeptide"
FT                   /note="gene_id=mCG113823.1 transcript_id=mCT114911.1
FT                   protein_id=mCP68638.1"
FT                   /db_xref="GOA:Q8BTI9"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1922019"
FT                   /db_xref="PDB:2Y3A"
FT                   /db_xref="PDB:4BFR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BTI9"
FT                   /protein_id="EDL20998.1"
FT                   /translation="MPPAMADNLDIWAVDSQIASDGAISVDFLLPTGIYIQLEVPREAT
FT                   ISYIKQMLWKQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLK
FT                   LVTRSCDPAEKLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEAKIQSLVGLSWI
FT                   DWLKHTYPPEHEPSVLENLEDKLYGGKLVVAVHFENSQDVFSFQVSPNLNPIKINELAI
FT                   QKRLTIRGKEDEASPCDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECC
FT                   KIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRVISHIWDNNNPFQITLVKGNKLNTE
FT                   ETVKVHVRAGLFHGTELLCKTVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVY
FT                   AVLDKVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSS
FT                   FPDELEEMLNPMGTVQTNPYAENATALHITFPENKKQPCYYPPFDKIIEKAAELASGDS
FT                   ANVSSRGGKKFLAVLKEILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKW
FT                   NKLEDVAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQ
FT                   LVQVLKYEPFLDCALSRFLLERALDNRRIGQFLFWHLRSEVHTPAVSVQFGVILEAYCR
FT                   GSVGHMKVLSKQVEALNKLKTLNSLIKLNAVKLSRAKGKEAMHTCLKQSAYREALSDLQ
FT                   SPLNPCVILSELYVEKCKYMDSKMKPLWLVYSSRAFGEDSVGVIFKNGDDLRQDMLTLQ
FT                   MLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFN
FT                   KDALLNWLKEYNSGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHI
FT                   DFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRR
FT                   HGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWT
FT                   TKVNWMAHTVRKDYRS"
FT   gene            complement(9861687..9862117)
FT                   /pseudo
FT                   /locus_tag="mCG_140656"
FT                   /note="gene_id=mCG140656.0"
FT   mRNA            complement(9861687..9862117)
FT                   /pseudo
FT                   /locus_tag="mCG_140656"
FT                   /note="gene_id=mCG140656.0 transcript_id=mCT170547.0
FT                   created on 10-JUL-2002"
FT   gene            complement(9923696..9924218)
FT                   /pseudo
FT                   /locus_tag="mCG_140658"
FT                   /note="gene_id=mCG140658.0"
FT   mRNA            complement(9923696..9924218)
FT                   /pseudo
FT                   /locus_tag="mCG_140658"
FT                   /note="gene_id=mCG140658.0 transcript_id=mCT170556.0
FT                   created on 10-JUL-2002"
FT   gene            complement(<9933114..>9940017)
FT                   /locus_tag="mCG_18104"
FT                   /note="gene_id=mCG18104.2"
FT   mRNA            complement(join(<9933114..9933263,9936092..9936141,
FT                   9937963..9938191,9939910..>9940017))
FT                   /locus_tag="mCG_18104"
FT                   /product="mCG18104"
FT                   /note="gene_id=mCG18104.2 transcript_id=mCT19943.2 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(9933114..9933263,9936092..9936141,
FT                   9937963..9938191,9939910..9940017))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18104"
FT                   /product="mCG18104"
FT                   /note="gene_id=mCG18104.2 transcript_id=mCT19943.2
FT                   protein_id=mCP21244.2"
FT                   /db_xref="GOA:J3QPY3"
FT                   /db_xref="InterPro:IPR010695"
FT                   /db_xref="MGI:MGI:3647754"
FT                   /db_xref="UniProtKB/TrEMBL:J3QPY3"
FT                   /protein_id="EDL20999.1"
FT                   /translation="MKIAAIWDVILSDGVHKIEFEHGTTSGKRVVYVDGKEVIRKEWMF
FT                   PLVGKETFCVGAAKNKAIIRILSGKGCGFSYTLEIDGKSFRKFVENRSKTTNTWVLHLD
FT                   DKDFRIVLEKPTMDVWCNGKIVESVGEFVDDGTETHFSVGNHGCYIKAVSSGKKREGII
FT                   HTLIVDNREIPELTQ"
FT   gene            9947020..9997647
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /note="gene_id=mCG18107.2"
FT   mRNA            join(9947020..9947172,9949994..9950093,9957982..9958104,
FT                   9966265..9966355,9966555..9966678,9967358..9967538,
FT                   9972889..9973058,9974700..9974756,9975248..9975329,
FT                   9975421..9975509,9978339..9978413,9986509..9986614,
FT                   9988838..9989008,9993338..9993484,9993587..9993755,
FT                   9994890..9995004,9995749..9995828,9996974..9997647)
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /product="centrosomal protein 70, transcript variant
FT                   mCT19947"
FT                   /note="gene_id=mCG18107.2 transcript_id=mCT19947.2 created
FT                   on 01-AUG-2002"
FT   mRNA            join(9947117..9947172,9949950..9950093,9957982..9958104,
FT                   9966265..9966355,9966555..9966678,9967358..9967538,
FT                   9972889..9973058,9974700..9974756,9975248..9975329,
FT                   9975421..9975509,9978339..9978413,9986509..9986614,
FT                   9988838..9989008,9993338..9993484,9993587..9993755,
FT                   9994890..9995004,9995749..9995828,9996974..9997647)
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /product="centrosomal protein 70, transcript variant
FT                   mCT170559"
FT                   /note="gene_id=mCG18107.2 transcript_id=mCT170559.0 created
FT                   on 01-AUG-2002"
FT   mRNA            join(9947163..9947523,9949994..9950093,9957982..9958104,
FT                   9966265..9966355,9966555..9966678,9967358..9967538,
FT                   9972889..9973058,9974700..9974756,9975248..9975329,
FT                   9975421..9975509,9978339..9978413,9986509..9986614,
FT                   9988838..9989008,9993338..9993484,9993587..9993755,
FT                   9994890..9995004,9995749..9995828,9996974..9997647)
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /product="centrosomal protein 70, transcript variant
FT                   mCT170558"
FT                   /note="gene_id=mCG18107.2 transcript_id=mCT170558.0 created
FT                   on 01-AUG-2002"
FT   CDS             join(9950085..9950093,9957982..9958104,9966265..9966355,
FT                   9966555..9966678,9967358..9967538,9972889..9973058,
FT                   9974700..9974756,9975248..9975329,9975421..9975509,
FT                   9978339..9978413,9986509..9986614,9988838..9989008,
FT                   9993338..9993484,9993587..9993755,9994890..9995004,
FT                   9995749..9995828,9996974..9997035)
FT                   /codon_start=1
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /product="centrosomal protein 70, isoform CRA_a"
FT                   /note="gene_id=mCG18107.2 transcript_id=mCT170559.0
FT                   protein_id=mCP93476.0 isoform=CRA_a"
FT                   /protein_id="EDL21000.1"
FT                   /translation="MTEGSQIFLLPISTSDSTKEPLSPVASKAQDPSLLSNRLMIEKQQ
FT                   EEAEWESINGLLMTHGFKPLCLVKGADLRDFIVFDKQSSQKMRQILKTLMEETTRQQSM
FT                   IRELIETNQQLKSELQLEQNRAAHQEQRANDLQQIMDSVKSKIGELEDESLNRVCQQQN
FT                   RIKDLQKEYKMLQMKCQQYKKNRMEQEGTIASLQKEIHRLAKEEEERILTQNRVFAHLC
FT                   RRVPHSVLDKQLLCLIDYYECKLRKLHIQRQFEEDSQSEEKDFTNLGASPNYKGVLMSL
FT                   QKQLKESKSRIDVLVGEKLSLQKDLENRPTEHELRLYKQQVKKLEKTLKKNIKLQDLIG
FT                   QKKSDDTEKKDEPSKDSHQQALIEQSYFQVLCSINSIVHNPRAPVIIYKQSKGRAPNGN
FT                   KDIGQDCGFEHLVPIIEMWVDELTSLKDLYKSLKILSAELVPWHSLKKLDEKEGVKVGD
FT                   LLFMVDTMLEEVENQKETSSTPNSQTLQAIVSHFQKLFDVQSLNGVFPRMNEVYTRLGE
FT                   MNNAVRNLQELLELDSSSSLCVVVSTVGKLCEIINKDVSEQVKQVLGPEDLQSIIKKLE
FT                   EHEEFFPAFQAFANDLLEILEIDDLDAIVPAVKKLKILSY"
FT   CDS             join(9950085..9950093,9957982..9958104,9966265..9966355,
FT                   9966555..9966678,9967358..9967538,9972889..9973058,
FT                   9974700..9974756,9975248..9975329,9975421..9975509,
FT                   9978339..9978413,9986509..9986614,9988838..9989008,
FT                   9993338..9993484,9993587..9993755,9994890..9995004,
FT                   9995749..9995828,9996974..9997035)
FT                   /codon_start=1
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /product="centrosomal protein 70, isoform CRA_a"
FT                   /note="gene_id=mCG18107.2 transcript_id=mCT19947.2
FT                   protein_id=mCP21330.2 isoform=CRA_a"
FT                   /protein_id="EDL21001.1"
FT                   /translation="MTEGSQIFLLPISTSDSTKEPLSPVASKAQDPSLLSNRLMIEKQQ
FT                   EEAEWESINGLLMTHGFKPLCLVKGADLRDFIVFDKQSSQKMRQILKTLMEETTRQQSM
FT                   IRELIETNQQLKSELQLEQNRAAHQEQRANDLQQIMDSVKSKIGELEDESLNRVCQQQN
FT                   RIKDLQKEYKMLQMKCQQYKKNRMEQEGTIASLQKEIHRLAKEEEERILTQNRVFAHLC
FT                   RRVPHSVLDKQLLCLIDYYECKLRKLHIQRQFEEDSQSEEKDFTNLGASPNYKGVLMSL
FT                   QKQLKESKSRIDVLVGEKLSLQKDLENRPTEHELRLYKQQVKKLEKTLKKNIKLQDLIG
FT                   QKKSDDTEKKDEPSKDSHQQALIEQSYFQVLCSINSIVHNPRAPVIIYKQSKGRAPNGN
FT                   KDIGQDCGFEHLVPIIEMWVDELTSLKDLYKSLKILSAELVPWHSLKKLDEKEGVKVGD
FT                   LLFMVDTMLEEVENQKETSSTPNSQTLQAIVSHFQKLFDVQSLNGVFPRMNEVYTRLGE
FT                   MNNAVRNLQELLELDSSSSLCVVVSTVGKLCEIINKDVSEQVKQVLGPEDLQSIIKKLE
FT                   EHEEFFPAFQAFANDLLEILEIDDLDAIVPAVKKLKILSY"
FT   CDS             join(9950085..9950093,9957982..9958104,9966265..9966355,
FT                   9966555..9966678,9967358..9967538,9972889..9973058,
FT                   9974700..9974756,9975248..9975329,9975421..9975509,
FT                   9978339..9978413,9986509..9986614,9988838..9989008,
FT                   9993338..9993484,9993587..9993755,9994890..9995004,
FT                   9995749..9995828,9996974..9997035)
FT                   /codon_start=1
FT                   /gene="Cep70"
FT                   /locus_tag="mCG_18107"
FT                   /product="centrosomal protein 70, isoform CRA_a"
FT                   /note="gene_id=mCG18107.2 transcript_id=mCT170558.0
FT                   protein_id=mCP93477.0 isoform=CRA_a"
FT                   /protein_id="EDL21002.1"
FT                   /translation="MTEGSQIFLLPISTSDSTKEPLSPVASKAQDPSLLSNRLMIEKQQ
FT                   EEAEWESINGLLMTHGFKPLCLVKGADLRDFIVFDKQSSQKMRQILKTLMEETTRQQSM
FT                   IRELIETNQQLKSELQLEQNRAAHQEQRANDLQQIMDSVKSKIGELEDESLNRVCQQQN
FT                   RIKDLQKEYKMLQMKCQQYKKNRMEQEGTIASLQKEIHRLAKEEEERILTQNRVFAHLC
FT                   RRVPHSVLDKQLLCLIDYYECKLRKLHIQRQFEEDSQSEEKDFTNLGASPNYKGVLMSL
FT                   QKQLKESKSRIDVLVGEKLSLQKDLENRPTEHELRLYKQQVKKLEKTLKKNIKLQDLIG
FT                   QKKSDDTEKKDEPSKDSHQQALIEQSYFQVLCSINSIVHNPRAPVIIYKQSKGRAPNGN
FT                   KDIGQDCGFEHLVPIIEMWVDELTSLKDLYKSLKILSAELVPWHSLKKLDEKEGVKVGD
FT                   LLFMVDTMLEEVENQKETSSTPNSQTLQAIVSHFQKLFDVQSLNGVFPRMNEVYTRLGE
FT                   MNNAVRNLQELLELDSSSSLCVVVSTVGKLCEIINKDVSEQVKQVLGPEDLQSIIKKLE
FT                   EHEEFFPAFQAFANDLLEILEIDDLDAIVPAVKKLKILSY"
FT   gene            complement(9996253..10001976)
FT                   /locus_tag="mCG_53155"
FT                   /note="gene_id=mCG53155.3"
FT   mRNA            complement(join(9996253..9997000,10001722..10001976))
FT                   /locus_tag="mCG_53155"
FT                   /product="mCG53155"
FT                   /note="gene_id=mCG53155.3 transcript_id=mCT53338.3 created
FT                   on 20-FEB-2003"
FT   CDS             complement(10001778..10001888)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53155"
FT                   /product="mCG53155"
FT                   /note="gene_id=mCG53155.3 transcript_id=mCT53338.3
FT                   protein_id=mCP41339.3"
FT                   /protein_id="EDL21003.1"
FT                   /translation="MSTGNFCAVLQPGSGVTAASKANTVHERSQIITVEV"
FT   gene            complement(10007216..>10057588)
FT                   /gene="D9Ertd280e"
FT                   /locus_tag="mCG_18100"
FT                   /note="gene_id=mCG18100.3"
FT   mRNA            complement(join(10007216..10008923,10009192..10009241,
FT                   10012435..10012540,10013894..10014025,10014454..10014552,
FT                   10015136..10015635,10016751..10016900,10017503..10017589,
FT                   10018082..10018150,10018630..10018692,10018775..10018837,
FT                   10019346..10019435,10019845..10019893,10021406..10021488,
FT                   10022145..10022315,10025148..10025268,10027004..10027059,
FT                   10029764..10029847,10030422..10030488,10035104..10035258,
FT                   10037827..10037868,10057108..10057587))
FT                   /gene="D9Ertd280e"
FT                   /locus_tag="mCG_18100"
FT                   /product="DNA segment, Chr 9, ERATO Doi 280, expressed,
FT                   transcript variant mCT19940"
FT                   /note="gene_id=mCG18100.3 transcript_id=mCT19940.2 created
FT                   on 10-JUL-2002"
FT   mRNA            complement(join(10007389..10008923,10009192..10009241,
FT                   10012435..10012540,10013894..10014025,10014454..10014552,
FT                   10015136..10015635,10016751..10016900,10017503..10017589,
FT                   10018082..10018150,10018630..10018692,10018775..10018837,
FT                   10019346..10019435,10019845..10019893,10021406..10021488,
FT                   10022145..10022315,10025148..10025268,10027004..10027059,
FT                   10029764..10029853,10030422..10030488,10031853..10031929,
FT                   10035124..10035258,10037827..10037868,10057108..>10057588))
FT                   /gene="D9Ertd280e"
FT                   /locus_tag="mCG_18100"
FT                   /product="DNA segment, Chr 9, ERATO Doi 280, expressed,
FT                   transcript variant mCT191511"
FT                   /note="gene_id=mCG18100.3 transcript_id=mCT191511.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(10008887..10008923,10009192..10009241,
FT                   10012435..10012540,10013894..10014025,10014454..10014552,
FT                   10015136..10015635,10016751..10016900,10017503..10017589,
FT                   10018082..10018150,10018630..10018692,10018775..10018837,
FT                   10019346..10019435,10019845..10019893,10021406..10021488,
FT                   10022145..10022315,10025148..10025268,10027004..10027059,
FT                   10029764..10029853,10030422..10030488,10031853..10031929,
FT                   10035124..10035258,10037827..10037868,10057108..>10057470))
FT                   /codon_start=1
FT                   /gene="D9Ertd280e"
FT                   /locus_tag="mCG_18100"
FT                   /product="DNA segment, Chr 9, ERATO Doi 280, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG18100.3 transcript_id=mCT191511.0
FT                   protein_id=mCP112485.0 isoform=CRA_a"
FT                   /protein_id="EDL21004.1"
FT                   /translation="RGQAGDSEMQPEEPCAPSAPGGPDVPERGQRSRDPGPRLSGQLLP
FT                   ELYSFVARVLFYLAPVYLAGYLGLSVTWLLLGALLWMWWRRNRRGKLGRLEAAFEFLEH
FT                   EREFISRELRGQHLPAWIHFPDVERVEWANKIIIQIWPYLSMIMENKIREKLEPKIREK
FT                   SIHLRTFTFTKLYFGQKCPKVNGVKVHTDKRNRRKVTLDLQICYIGDCEISVELQKIRG
FT                   GVSGVQLQGTLRVILEPLLVDKPFIGAVTVFFLQKPHLQINWTGLTNLLDMPGINELSD
FT                   SLLEDLIAAHLVLPNRVTVPVKKGLDVTNLRVPLPCGVIRVHLLEAKKLAQKDNFLGLG
FT                   GKSDPYAKVSIGLQHCRSRTIYKNLNPTWNEVFEFMVYEVPGQDLEVDLYDEDTDKDDF
FT                   LGSLQICLGDVMKNRVVDEWFALNDTTSGRLHLRLEWLSLLTDQEALTENDSGLSTAIL
FT                   VVFLENACNLPRNPFDYLNGEYRAKKLSRFVKNKASRDPSSYVKLTVGKKTFTSKTCPH
FT                   SKDPVWSQVFSFFVHSVAAEQLCLKVLDDELECALGVLEFPLCRILPCADLTLEQCFQL
FT                   DHSGLDSLISMRLVLRFLRVEGRELGSPYTGPDALKKGPLFIKKVATNQGCKAPPLNEG
FT                   LADVTSTSNPASYIKGASKSIDNISAATTDPEPMPEPQGPGPEPKGKDSARGLCESPGK
FT                   KKNPATTFLTVPGLHSPGPIKSPRPMSRPAFPFAWPLTRVAPSMSSLNSLASSCFDLTD
FT                   VSLNTEAGDSRQGRLGEIQLTVRYVCLRHCLRVLVNGCRNLTPCTSSGADPYVRIYLLP
FT                   ERRWASRKKTSVKQKTLEPLFDETFEFFVPMGEVQKRSLDVAVKNSRPLGSHRRKELGK
FT                   VLIDLSKQDLIKGFSQWYELTADGQPRS"
FT   CDS             complement(join(10008887..10008923,10009192..10009241,
FT                   10012435..10012540,10013894..10014025,10014454..10014552,
FT                   10015136..10015635,10016751..10016900,10017503..10017589,
FT                   10018082..10018150,10018630..10018692,10018775..10018837,
FT                   10019346..10019435,10019845..10019893,10021406..10021488,
FT                   10022145..10022315,10025148..10025268,10027004..10027059,
FT                   10029764..10029847,10030422..10030488,10035104..10035258,
FT                   10037827..10037868,10057108..10057446))
FT                   /codon_start=1
FT                   /gene="D9Ertd280e"
FT                   /locus_tag="mCG_18100"
FT                   /product="DNA segment, Chr 9, ERATO Doi 280, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG18100.3 transcript_id=mCT19940.2
FT                   protein_id=mCP21399.2 isoform=CRA_b"
FT                   /protein_id="EDL21005.1"
FT                   /translation="MQPEEPCAPSAPGGPDVPERGQRSRDPGPRLSGQLLPELYSFVAR
FT                   VLFYLAPVYLAGYLGLSVTWLLLGALLWMWWRRNRRGKLGRLEAAFEFLEHEREFISRE
FT                   LRGQHLPAWIHFPDVERVEWANKIIIQIWPYLSMIMENKIREKLEPKIREKSIHLRTFT
FT                   FTKLYFGQKVGTAPVSYIGDCEISVELQKIRGGVSGVQGTLRVILEPLLVDKPFIGAVT
FT                   VFFLQKPHLQINWTGLTNLLDMPGINELSDSLLEDLIAAHLVLPNRVTVPVKKGLDVTN
FT                   LRVPLPCGVIRVHLLEAKKLAQKDNFLGLGGKSDPYAKVSIGLQHCRSRTIYKNLNPTW
FT                   NEVFEFMVYEVPGQDLEVDLYDEDTDKDDFLGSLQICLGDVMKNRVVDEWFALNDTTSG
FT                   RLHLRLEWLSLLTDQEALTENDSGLSTAILVVFLENACNLPRNPFDYLNGEYRAKKLSR
FT                   FVKNKASRDPSSYVKLTVGKKTFTSKTCPHSKDPVWSQVFSFFVHSVAAEQLCLKVLDD
FT                   ELECALGVLEFPLCRILPCADLTLEQCFQLDHSGLDSLISMRLVLRFLRVEGRELGSPY
FT                   TGPDALKKGPLFIKKVATNQGCKAPPLNEGLADVTSTSNPASYIKGASKSIDNISAATT
FT                   DPEPMPEPQGPGPEPKGKDSARGLCESPGKKKNPATTFLTVPGLHSPGPIKSPRPMSRP
FT                   AFPFAWPLTRVAPSMSSLNSLASSCFDLTDVSLNTEAGDSRQGRLGEIQLTVRYVCLRH
FT                   CLRVLVNGCRNLTPCTSSGADPYVRIYLLPERRWASRKKTSVKQKTLEPLFDETFEFFV
FT                   PMGEVQKRSLDVAVKNSRPLGSHRRKELGKVLIDLSKQDLIKGFSQWYELTADGQPRS"
FT   gene            10084145..10085509
FT                   /locus_tag="mCG_18096"
FT                   /note="gene_id=mCG18096.2"
FT   mRNA            join(10084145..10084339,10084970..10085509)
FT                   /locus_tag="mCG_18096"
FT                   /product="mCG18096"
FT                   /note="gene_id=mCG18096.2 transcript_id=mCT19936.2 created
FT                   on 10-JUL-2002"
FT   gene            complement(10084151..10085488)
FT                   /locus_tag="mCG_147714"
FT                   /note="gene_id=mCG147714.0"
FT   mRNA            complement(10084151..10085488)
FT                   /locus_tag="mCG_147714"
FT                   /product="mCG147714"
FT                   /note="gene_id=mCG147714.0 transcript_id=mCT187977.0
FT                   created on 13-JAN-2004"
FT   CDS             join(10084338..10084339,10084970..10085180)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18096"
FT                   /product="mCG18096"
FT                   /note="gene_id=mCG18096.2 transcript_id=mCT19936.2
FT                   protein_id=mCP21257.1"
FT                   /protein_id="EDL21006.1"
FT                   /translation="MIVEDESPGPEMARSRPFCPPACGVSLGHGQFRMDALDDEPECTA
FT                   SAERGGGAGSLPSGQLCDSLLRALV"
FT   CDS             complement(10084490..10084747)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147714"
FT                   /product="mCG147714"
FT                   /note="gene_id=mCG147714.0 transcript_id=mCT187977.0
FT                   protein_id=mCP108541.0"
FT                   /protein_id="EDL21007.1"
FT                   /translation="MCVPITSDVYLPCNPLTSASLVCRFSSITLPPLYRFICPPQPSPL
FT                   PQYGAMLWPPPSQAPCHTGNIWMLPLGAPHTLPWLLLWST"
FT   gene            complement(10086243..10135429)
FT                   /gene="Mras"
FT                   /locus_tag="mCG_18105"
FT                   /note="gene_id=mCG18105.2"
FT   mRNA            complement(join(10086243..10087231,10088460..10088539,
FT                   10091673..10091772,10093196..10093349,10110127..10110336,
FT                   10135028..10135429))
FT                   /gene="Mras"
FT                   /locus_tag="mCG_18105"
FT                   /product="muscle and microspikes RAS, transcript variant
FT                   mCT170557"
FT                   /note="gene_id=mCG18105.2 transcript_id=mCT170557.0 created
FT                   on 10-JUL-2002"
FT   mRNA            complement(join(10086243..10087231,10088460..10088539,
FT                   10091673..10091772,10093196..10093349,10110127..10110336,
FT                   10124509..10124628))
FT                   /gene="Mras"
FT                   /locus_tag="mCG_18105"
FT                   /product="muscle and microspikes RAS, transcript variant
FT                   mCT19944"
FT                   /note="gene_id=mCG18105.2 transcript_id=mCT19944.1 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(10087132..10087231,10088460..10088539,
FT                   10091673..10091772,10093196..10093349,10110127..10110319))
FT                   /codon_start=1
FT                   /gene="Mras"
FT                   /locus_tag="mCG_18105"
FT                   /product="muscle and microspikes RAS, isoform CRA_a"
FT                   /note="gene_id=mCG18105.2 transcript_id=mCT170557.0
FT                   protein_id=mCP93475.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TPX5"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1100856"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TPX5"
FT                   /protein_id="EDL21008.1"
FT                   /translation="MATSAVPSENLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPT
FT                   IEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVD
FT                   RFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLN
FT                   VDKTFHDLVRVIRQQVPEKNQKKKKKTKWRGDRATGTHKLQCVIL"
FT   CDS             complement(join(10087132..10087231,10088460..10088539,
FT                   10091673..10091772,10093196..10093349,10110127..10110319))
FT                   /codon_start=1
FT                   /gene="Mras"
FT                   /locus_tag="mCG_18105"
FT                   /product="muscle and microspikes RAS, isoform CRA_a"
FT                   /note="gene_id=mCG18105.2 transcript_id=mCT19944.1
FT                   protein_id=mCP21316.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TPX5"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1100856"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TPX5"
FT                   /protein_id="EDL21009.1"
FT                   /translation="MATSAVPSENLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPT
FT                   IEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVD
FT                   RFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLN
FT                   VDKTFHDLVRVIRQQVPEKNQKKKKKTKWRGDRATGTHKLQCVIL"
FT   gene            <10158786..10173805
FT                   /locus_tag="mCG_51521"
FT                   /note="gene_id=mCG51521.2"
FT   mRNA            join(<10158786..10158889,10159625..10159696,
FT                   10161583..10161699,10163613..10163688,10164093..10164263,
FT                   10167264..10167346,10168661..10168815,10169815..10169986,
FT                   10173448..10173805)
FT                   /locus_tag="mCG_51521"
FT                   /product="mCG51521, transcript variant mCT51704"
FT                   /note="gene_id=mCG51521.2 transcript_id=mCT51704.2 created
FT                   on 10-JUL-2002"
FT   CDS             join(<10158788..10158889,10159625..10159696,
FT                   10161583..10161699,10163613..10163688,10164093..10164263,
FT                   10167264..10167346,10168661..10168815,10169815..10169986,
FT                   10173448..10173609)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51521"
FT                   /product="mCG51521, isoform CRA_b"
FT                   /note="gene_id=mCG51521.2 transcript_id=mCT51704.2
FT                   protein_id=mCP41346.2 isoform=CRA_b"
FT                   /protein_id="EDL21011.1"
FT                   /translation="VDVYQGWCGPCKPMVSLFQKMRIEVGLDRLHFASAEADRLDVLEK
FT                   YQGKCEPTFLFYTRGELVAVVKGANPTLLQKTILQQLEAEKKVPAEGGEWRAATDEELL
FT                   GALKWPPHRKDGGEDGDIAAISHKSHRHCAMSFPEPSYEKSGPAAFEDQRVRQAPTGKM
FT                   ACINSQDAREPGLDTTASSGKTCTLGIIKPDAVAHGKAEEIIMKEAFERLVHHMCSGPS
FT                   HLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESETIVSFTLYQPVSGLSTAQKCL
FT                   LMLCMEAGTERTPTESWRCSSPVSSSQIKTRKLHRVLRLKLWWAPWRTLACLSVSEDWN
FT                   AVLSSAGIKVTRPPEEPSVHAGRHRRLQR"
FT   mRNA            join(10169498..10169986,10173448..10173805)
FT                   /locus_tag="mCG_51521"
FT                   /product="mCG51521, transcript variant mCT170571"
FT                   /note="gene_id=mCG51521.2 transcript_id=mCT170571.0 created
FT                   on 10-JUL-2002"
FT   CDS             join(10169798..10169986,10173448..10173609)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51521"
FT                   /product="mCG51521, isoform CRA_a"
FT                   /note="gene_id=mCG51521.2 transcript_id=mCT170571.0
FT                   protein_id=mCP93489.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9B9"
FT                   /db_xref="MGI:MGI:1917047"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9B9"
FT                   /protein_id="EDL21010.1"
FT                   /translation="MHFSSSETIVSFTLYQPVSGLSTAQKCLLMLCMEAGTERTPTESW
FT                   RCSSPVSSSQIKTRKLHRVLRLKLWWAPWRTLACLSVSEDWNAVLSSAGIKVTRPPEEP
FT                   SVHAGRHRRLQR"
FT   gene            complement(10176953..10267541)
FT                   /gene="Armc8"
FT                   /locus_tag="mCG_18099"
FT                   /note="gene_id=mCG18099.2"
FT   mRNA            complement(join(10176953..10179355,10181719..10181812,
FT                   10182585..10182657,10186483..10186578,10194795..10194890,
FT                   10195887..10196036,10197937..10198029,10201156..10201242,
FT                   10203913..10203994,10204298..10204380,10219137..10219232,
FT                   10221789..10221989,10224003..10224063,10225541..10225631,
FT                   10225729..10225804,10227981..10228061,10231747..10231839,
FT                   10234444..10234541,10234812..10234954,10236337..10236408,
FT                   10250192..10250268,10267241..10267541))
FT                   /gene="Armc8"
FT                   /locus_tag="mCG_18099"
FT                   /product="armadillo repeat containing 8, transcript variant
FT                   mCT19939"
FT                   /note="gene_id=mCG18099.2 transcript_id=mCT19939.2 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(10179322..10179355,10181719..10181812,
FT                   10182585..10182657,10186483..10186578,10194795..10194890,
FT                   10195887..10196036,10197937..10198029,10201156..10201242,
FT                   10203913..10203994,10204298..10204380,10219137..10219232,
FT                   10221789..10221989,10224003..10224063,10225541..10225631,
FT                   10225729..10225804,10227981..10228061,10231747..10231839,
FT                   10234444..10234541,10234812..10234954,10236337..10236408,
FT                   10250192..10250268,10267241..10267285))
FT                   /codon_start=1
FT                   /gene="Armc8"
FT                   /locus_tag="mCG_18099"
FT                   /product="armadillo repeat containing 8, isoform CRA_b"
FT                   /note="gene_id=mCG18099.2 transcript_id=mCT19939.2
FT                   protein_id=mCP21376.2 isoform=CRA_b"
FT                   /db_xref="GOA:G3X920"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:1921375"
FT                   /db_xref="UniProtKB/TrEMBL:G3X920"
FT                   /protein_id="EDL21013.1"
FT                   /translation="MACLLETPIRMSVLSEVTASSRHYVDRLFDPDPQKVLQGVIDMKN
FT                   AVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDC
FT                   HIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYT
FT                   QEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSPSYKVRMQALKCFSVLAFENPQV
FT                   SMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDSCIVLKTL
FT                   PCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSA
FT                   ITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKIIETETMMDRIVTGLSESSVK
FT                   VRLAAVRCLHSLSRSVQQLRTSFQDHAVWKPLMKVLQNAPDEILVVASSMLCNLLLEFS
FT                   PSKEPILESGAVELLCGLTQSENPALRVNGIWALMNMAFQAEQKIKADILRSLSTEQLF
FT                   RLLSDSDMNVLMKTLGLLRNLLSTRPHIDKIMSTHGKQIMQAVTLILEGEHSIEVKEQT
FT                   LCILANIADGTTAKELIMTNDDILQKIKYYMGHSHVKLQLAAMFCISNLIWNEEEGSQE
FT                   RQDKLRDMGIVDILHKLSQSADSNLCDKAKTALQQYLA"
FT   mRNA            complement(join(10217455..10219232,10221789..10221989,
FT                   10224003..10224063,10225541..10225631,10225729..10225804,
FT                   10227981..10228061,10231747..10231839,10234444..10234541,
FT                   10234812..10234954,10236337..10236408,10250192..10250268,
FT                   10267241..10267541))
FT                   /gene="Armc8"
FT                   /locus_tag="mCG_18099"
FT                   /product="armadillo repeat containing 8, transcript variant
FT                   mCT170553"
FT                   /note="gene_id=mCG18099.2 transcript_id=mCT170553.0 created
FT                   on 10-JUL-2002"
FT   CDS             complement(join(10219071..10219232,10221789..10221989,
FT                   10224003..10224063,10225541..10225631,10225729..10225804,
FT                   10227981..10228061,10231747..10231839,10234444..10234541,
FT                   10234812..10234954,10236337..10236408,10250192..10250268,
FT                   10267241..10267285))
FT                   /codon_start=1
FT                   /gene="Armc8"
FT                   /locus_tag="mCG_18099"
FT                   /product="armadillo repeat containing 8, isoform CRA_a"
FT                   /note="gene_id=mCG18099.2 transcript_id=mCT170553.0
FT                   protein_id=mCP93471.0 isoform=CRA_a"
FT                   /protein_id="EDL21012.1"
FT                   /translation="MACLLETPIRMSVLSEVTASSRHYVDRLFDPDPQKVLQGVIDMKN
FT                   AVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDC
FT                   HIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYT
FT                   QEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSPSYKVRMQALKCFSVLAFENPQV
FT                   SMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDSCIVLKTL
FT                   PCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSA
FT                   ITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST
FT                   "
FT   gene            10274277..10282970
FT                   /gene="Dbr1"
FT                   /locus_tag="mCG_18106"
FT                   /note="gene_id=mCG18106.2"
FT   mRNA            join(10274277..10274603,10275054..10275178,
FT                   10276919..10276999,10277835..10277920,10278617..10278841,
FT                   10280500..10280580,10280795..10280940,10281790..10282970)
FT                   /gene="Dbr1"
FT                   /locus_tag="mCG_18106"
FT                   /product="debranching enzyme homolog 1 (S. cerevisiae)"
FT                   /note="gene_id=mCG18106.2 transcript_id=mCT19946.2 created
FT                   on 10-JUL-2002"
FT   CDS             join(10274407..10274603,10275054..10275178,
FT                   10276919..10276999,10277835..10277920,10278617..10278841,
FT                   10280500..10280580,10280795..10280940,10281790..10282498)
FT                   /codon_start=1
FT                   /gene="Dbr1"
FT                   /locus_tag="mCG_18106"
FT                   /product="debranching enzyme homolog 1 (S. cerevisiae)"
FT                   /note="gene_id=mCG18106.2 transcript_id=mCT19946.2
FT                   protein_id=mCP21247.2"
FT                   /protein_id="EDL21014.1"
FT                   /translation="MRVAVAGCCHGELDKIYETLALAERRGSGPVDLLLCCGDFQAVRN
FT                   EADLRCMAVPPKYRHMQTFYRYYSGEKKAPVLTIFIGGNHEASNHLQELPYGGWVAPNI
FT                   YYLGLAGVVKYRGVRIGGISGIFKSHDYRKGHFECPPYNSSTIRSIYHVRNIEVYKLKQ
FT                   LKQPVHIFLSHDWPRNIYHYGNKKQLLKTKSFFRQEVENSTLGSPAASELLEHLQPAYW
FT                   FSAHLHVKFAALMQHQATDKDQAGKETKFLALDKCLPHRDFLQVLEIEHDPSAPEYLEY
FT                   DVEWLTVLRATDDLINVTGGLWNMPEDNGLHTRWDYSATEETMKEVMEKLNHDPKVPCN
FT                   FTMTAACYDPSKPQTQVKLVHRINPQTTEFCAQLGITDINVMIQKAREEEHHQCGEYEQ
FT                   QGDPGTEESEEDRSEYNTDTSALSSINPDEIMLDEEEEEEEEEEAVSAHSDMNTPSVEP
FT                   ASDQASDLSTSFSDIRNLPSSMFVSSDDASRSPASGEGKCGETVESGDEKDLAKFPLKR
FT                   LSDEHEPEQRKKIKRRNQAIYAAVDDGDASAE"
FT   gene            10312597..>10320904
FT                   /locus_tag="mCG_18102"
FT                   /note="gene_id=mCG18102.1"
FT   mRNA            join(10312597..10312687,10313521..10314009,
FT                   10320290..>10320904)
FT                   /locus_tag="mCG_18102"
FT                   /product="mCG18102"
FT                   /note="gene_id=mCG18102.1 transcript_id=mCT19942.1 created
FT                   on 10-JUL-2002"
FT   CDS             join(10313599..10314009,10320290..10320904)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18102"
FT                   /product="mCG18102"
FT                   /note="gene_id=mCG18102.1 transcript_id=mCT19942.1
FT                   protein_id=mCP21232.2"
FT                   /db_xref="GOA:Q14BT6"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR007652"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:2143261"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BT6"
FT                   /protein_id="EDL21015.1"
FT                   /translation="MLKEIYLSLSLVLVFACGLLYQLTMRSQCFFACLPPFSFPQGLDG
FT                   LLRSGRSIMFIETSERVEPPPMVSCAVESAAKIYPEQPIIFFMKGLRDSVQLTSNTSYP
FT                   AFSLLSAINNVFFVPLDMERLFKDTPLFSWYTKVNSSTEKHWLHVSSDAARLAIIWKYG
FT                   GIYMDTDVISLQPIPEENFLAAQGSRHSSNGVFGFLPHHPFLWACMENFVEHYDSTIWG
FT                   NQGPQLMTRMLRVWCRLKDFHGLGDLKCLNISFLHPQRFYPIPYPQWKRYYQVWDKEPS
FT                   FNESYALHLWNYMNKEGKTVVRGSKTLVENLYQKHCPKTYRVLIQGAEGTVSKKPGTGS
FT                   R"
FT   gene            10329689..10369119
FT                   /gene="Dzip1l"
FT                   /locus_tag="mCG_18098"
FT                   /note="gene_id=mCG18098.3"
FT   mRNA            join(10329689..10330074,10332749..10332860,
FT                   10337442..10338018,10339910..10339994,10341840..10341958,
FT                   10342639..10342800,10347298..10347426,10349766..10349828,
FT                   10351125..10351265,10355071..10355101,10355789..10355842,
FT                   10359838..10359980,10361127..10361310,10363146..10363362,
FT                   10363731..10363921,10365918..10366057,10367835..10369119)
FT                   /gene="Dzip1l"
FT                   /locus_tag="mCG_18098"
FT                   /product="DAZ interacting protein 1-like, transcript
FT                   variant mCT19938"
FT                   /note="gene_id=mCG18098.3 transcript_id=mCT19938.3 created
FT                   on 14-JUN-2003"
FT   mRNA            join(10329689..10330074,10337442..10338018,
FT                   10339910..10339994,10341840..10341958,10342639..10342800,
FT                   10347298..10347426,10349766..10349828,10351125..10351265,
FT                   10355071..10355101,10355789..10355842,10359838..10359980,
FT                   10361127..10361310,10363146..10363362,10363734..10363921,
FT                   10365918..10366057,10367835..10369119)
FT                   /gene="Dzip1l"
FT                   /locus_tag="mCG_18098"
FT                   /product="DAZ interacting protein 1-like, transcript
FT                   variant mCT185186"
FT                   /note="gene_id=mCG18098.3 transcript_id=mCT185186.0 created
FT                   on 14-JUN-2003"
FT   CDS             join(10337518..10338018,10339910..10339994,
FT                   10341840..10341958,10342639..10342800,10347298..10347426,
FT                   10349766..10349828,10351125..10351265,10355071..10355101,
FT                   10355789..10355842,10359838..10359980,10361127..10361310,
FT                   10363146..10363362,10363731..10363921,10365918..10366057,
FT                   10367835..10367999)
FT                   /codon_start=1
FT                   /gene="Dzip1l"
FT                   /locus_tag="mCG_18098"
FT                   /product="DAZ interacting protein 1-like, isoform CRA_b"
FT                   /note="gene_id=mCG18098.3 transcript_id=mCT19938.3
FT                   protein_id=mCP21347.3 isoform=CRA_b"
FT                   /db_xref="GOA:B2RR42"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1919757"
FT                   /db_xref="UniProtKB/TrEMBL:B2RR42"
FT                   /protein_id="EDL21017.1"
FT                   /translation="MQYPAATAEGLSGPLSGAYTLPAFKFQPRRESIDWRRISAVDVDR
FT                   VARELDVATLQENIAGVTFCNLDGEVCNHCRQPVDPVLLKVLRLAQLIIEYLLHCQDCL
FT                   SASVAQLEARLQASLGQQQRGQQELGRQADELKGVREESRRRRKMISTLQQLLLQTSAH
FT                   SYHTCHLCDKTFMNATFLRGHIQRRHAGMADVGKQKQEQPLGEVLEELRAKLKWTQGEL
FT                   EAQREAERQRQVQELEMARQREMEAKKKFDEWKEKERSKLYGEIDKLKQLFWDEFKTVA
FT                   NQNSTLEEKLKALQSYSMTESHLGSLRDEESEERLKHAQEVQALQEKMEVQKTEWKRKM
FT                   KALHEERAAERRQLQEENERLHVSLSQDQKKAAAQSQRHINALRAQLQEQARLIESQEE
FT                   TIQTLSLRKVEEVQEMPKAVATEEDSSEEELEASLEERQEQRKVLAALRKNPTWLKQFR
FT                   PILEDTLEEKLEGLGIKRDTKGISAQTVRRLEPLLRTQREQIARSFREFPSLREKLNKE
FT                   VSSRVKQRWESTTQPDGQPPVKSQRVTLATREVRPKTRTLTVALPSKPAEPSTPTLQGH
FT                   SSHGPGLTQVSTPIPRPRVHGPSSTPVSPGSGLSSTPPFSSEEEPEGDVVQRVSLQPPK
FT                   VLPRSAAKPEDNWGWSDSETSEESAQPPGKGSGGLASSGTLVQSIVKNLEKQLETPAKK
FT                   PSGGVNMFLRPNAALQRASTPARKSQLSEDESDVEISSLEDLSQDLGQKGKPKPLSHSK
FT                   LPEKFDVSPWSSGSRPRIPGW"
FT   CDS             join(10337518..10338018,10339910..10339994,
FT                   10341840..10341958,10342639..10342800,10347298..10347426,
FT                   10349766..10349828,10351125..10351265,10355071..10355101,
FT                   10355789..10355842,10359838..10359980,10361127..10361310,
FT                   10363146..10363362,10363734..10363921,10365918..10366057,
FT                   10367835..10367999)
FT                   /codon_start=1
FT                   /gene="Dzip1l"
FT                   /locus_tag="mCG_18098"
FT                   /product="DAZ interacting protein 1-like, isoform CRA_a"
FT                   /note="gene_id=mCG18098.3 transcript_id=mCT185186.0
FT                   protein_id=mCP106444.0 isoform=CRA_a"
FT                   /protein_id="EDL21016.1"
FT                   /translation="MQYPAATAEGLSGPLSGAYTLPAFKFQPRRESIDWRRISAVDVDR
FT                   VARELDVATLQENIAGVTFCNLDGEVCNHCRQPVDPVLLKVLRLAQLIIEYLLHCQDCL
FT                   SASVAQLEARLQASLGQQQRGQQELGRQADELKGVREESRRRRKMISTLQQLLLQTSAH
FT                   SYHTCHLCDKTFMNATFLRGHIQRRHAGMADVGKQKQEQPLGEVLEELRAKLKWTQGEL
FT                   EAQREAERQRQVQELEMARQREMEAKKKFDEWKEKERSKLYGEIDKLKQLFWDEFKTVA
FT                   NQNSTLEEKLKALQSYSMTESHLGSLRDEESEERLKHAQEVQALQEKMEVQKTEWKRKM
FT                   KALHEERAAERRQLQEENERLHVSLSQDQKKAAAQSQRHINALRAQLQEQARLIESQEE
FT                   TIQTLSLRKVEEVQEMPKAVATEEDSSEEELEASLEERQEQRKVLAALRKNPTWLKQFR
FT                   PILEDTLEEKLEGLGIKRDTKGISAQTVRRLEPLLRTQREQIARSFREFPSLREKLNKE
FT                   VSSRVKQRWESTTQPDGQPPVKSQRVTLATREVRPKTRTLTVALPSKPAEPSTPTLQGH
FT                   SSHGPGLTQVSTPIPRPRVHGPSSTPVSPGSGLSTPPFSSEEEPEGDVVQRVSLQPPKV
FT                   LPRSAAKPEDNWGWSDSETSEESAQPPGKGSGGLASSGTLVQSIVKNLEKQLETPAKKP
FT                   SGGVNMFLRPNAALQRASTPARKSQLSEDESDVEISSLEDLSQDLGQKGKPKPLSHSKL
FT                   PEKFDVSPWSSGSRPRIPGW"
FT   gene            complement(10391033..10417513)
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /note="gene_id=mCG18101.2"
FT   mRNA            complement(join(10391033..10393128,10396269..10396379,
FT                   10398250..10398376,10398987..10399151,10417242..10417513))
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, transcript variant mCT55446"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT55446.1 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(10391033..10393128,10396257..10396379,
FT                   10398250..10398376,10398987..10399151,10417242..10417513))
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, transcript variant mCT170555"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT170555.0 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(10391033..10393128,10396269..10396379,
FT                   10398250..10398376,10398987..10399151,10409994..10410328))
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, transcript variant mCT19941"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT19941.2 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(10391033..10393128,10396257..10396379,
FT                   10398250..10398376,10398987..10399151,10409994..10410328))
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, transcript variant mCT170554"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT170554.0 created
FT                   on 11-JUL-2002"
FT   CDS             complement(join(10392957..10393128,10396269..10396379,
FT                   10398250..10398376,10398987..10399151,10417242..10417461))
FT                   /codon_start=1
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, isoform CRA_c"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT55446.1
FT                   protein_id=mCP41398.1 isoform=CRA_c"
FT                   /protein_id="EDL21020.1"
FT                   /translation="MSVTACQGLGFVVSLIGFAGIIAATCMDQWSTQDLYNNPVTAVFN
FT                   YQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCI
FT                   RIGSMDDSAKAKMTLTSGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGG
FT                   MVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLTPDDSNFKAVSYHASGQNVA
FT                   YRPGGFKASTGFGSNTRNKKIYDGGARTEDDEQSHPTKYDYV"
FT   CDS             complement(join(10392957..10393128,10396269..10396379,
FT                   10398250..10398376,10398987..10399151,10409994..10410213))
FT                   /codon_start=1
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, isoform CRA_b"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT19941.2
FT                   protein_id=mCP21231.2 isoform=CRA_b"
FT                   /protein_id="EDL21019.1"
FT                   /translation="MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQ
FT                   YEGLWRSCVQQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCI
FT                   RIGSMDDSAKAKMTLTSGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGG
FT                   MVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLTPDDSNFKAVSYHASGQNVA
FT                   YRPGGFKASTGFGSNTRNKKIYDGGARTEDDEQSHPTKYDYV"
FT   CDS             complement(join(10396265..10396379,10398250..10398376,
FT                   10398987..10399151,10417242..10417461))
FT                   /codon_start=1
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, isoform CRA_d"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT170555.0
FT                   protein_id=mCP93472.0 isoform=CRA_d"
FT                   /protein_id="EDL21021.1"
FT                   /translation="MSVTACQGLGFVVSLIGFAGIIAATCMDQWSTQDLYNNPVTAVFN
FT                   YQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCI
FT                   RIGSMDDSAKAKMTLTSGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGG
FT                   MVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLTPDDSK"
FT   CDS             complement(join(10396265..10396379,10398250..10398376,
FT                   10398987..10399151,10409994..10410213))
FT                   /codon_start=1
FT                   /gene="Cldn18"
FT                   /locus_tag="mCG_18101"
FT                   /product="claudin 18, isoform CRA_a"
FT                   /note="gene_id=mCG18101.2 transcript_id=mCT170554.0
FT                   protein_id=mCP93473.0 isoform=CRA_a"
FT                   /protein_id="EDL21018.1"
FT                   /translation="MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQ
FT                   YEGLWRSCVQQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCI
FT                   RIGSMDDSAKAKMTLTSGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGG
FT                   MVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLTPDDSK"
FT   gene            complement(10494231..10494595)
FT                   /pseudo
FT                   /locus_tag="mCG_116253"
FT                   /note="gene_id=mCG116253.1"
FT   mRNA            complement(10494231..10494595)
FT                   /pseudo
FT                   /locus_tag="mCG_116253"
FT                   /note="gene_id=mCG116253.1 transcript_id=mCT117370.1
FT                   created on 22-JUL-2002"
FT   gene            <10560843..10561361
FT                   /locus_tag="mCG_1032883"
FT                   /note="gene_id=mCG1032883.1"
FT   mRNA            <10560843..10561361
FT                   /locus_tag="mCG_1032883"
FT                   /product="mCG1032883"
FT                   /note="gene_id=mCG1032883.1 transcript_id=mCT150587.1
FT                   created on 22-JUL-2002"
FT   CDS             10560843..10561169
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032883"
FT                   /product="mCG1032883"
FT                   /note="gene_id=mCG1032883.1 transcript_id=mCT150587.1
FT                   protein_id=mCP68900.1"
FT                   /protein_id="EDL21022.1"
FT                   /translation="MNINELTPLQENNISFLFLFYRSVGFVSVILSYQQRGNKLSCKSF
FT                   CPHLEHIKTMPFFFLLADSFSPFAYQLIHHYILNEIARPRPSPKFQPDVGKWEAGFPCF
FT                   RIVT"
FT   gene            complement(10567411..10569365)
FT                   /locus_tag="mCG_1032756"
FT                   /note="gene_id=mCG1032756.1"
FT   mRNA            complement(10567411..10569365)
FT                   /locus_tag="mCG_1032756"
FT                   /product="mCG1032756"
FT                   /note="gene_id=mCG1032756.1 transcript_id=mCT150460.1
FT                   created on 22-JUL-2002"
FT   CDS             complement(10568266..10568988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032756"
FT                   /product="mCG1032756"
FT                   /note="gene_id=mCG1032756.1 transcript_id=mCT150460.1
FT                   protein_id=mCP68731.0"
FT                   /db_xref="GOA:Q3UUP3"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR029549"
FT                   /db_xref="MGI:MGI:98362"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UUP3"
FT                   /protein_id="EDL21023.1"
FT                   /translation="MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAE
FT                   WKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDP
FT                   LKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATSA
FT                   LPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYILFP
FT                   GMTKTGIDPYSSAHATAM"
FT   gene            complement(10642574..10643977)
FT                   /pseudo
FT                   /locus_tag="mCG_18097"
FT                   /note="gene_id=mCG18097.2"
FT   mRNA            complement(10642574..10643977)
FT                   /pseudo
FT                   /locus_tag="mCG_18097"
FT                   /note="gene_id=mCG18097.2 transcript_id=mCT19937.2 created
FT                   on 22-JUL-2002"
FT   gene            10718633..10731101
FT                   /locus_tag="mCG_60240"
FT                   /note="gene_id=mCG60240.2"
FT   mRNA            join(10718633..10719016,10720011..10720087,
FT                   10730980..10731101)
FT                   /locus_tag="mCG_60240"
FT                   /product="mCG60240"
FT                   /note="gene_id=mCG60240.2 transcript_id=mCT60423.2 created
FT                   on 22-JUL-2002"
FT   CDS             join(10718998..10719016,10720011..10720087,
FT                   10730980..10730988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_60240"
FT                   /product="mCG60240"
FT                   /note="gene_id=mCG60240.2 transcript_id=mCT60423.2
FT                   protein_id=mCP41386.2"
FT                   /protein_id="EDL21024.1"
FT                   /translation="MVHWKQGDEDVDNGEERVSHMDAIKDLTEDLKLI"
FT   gene            complement(11019987..11021875)
FT                   /locus_tag="mCG_147710"
FT                   /note="gene_id=mCG147710.0"
FT   mRNA            complement(join(11019987..11020298,11021638..11021875))
FT                   /locus_tag="mCG_147710"
FT                   /product="mCG147710"
FT                   /note="gene_id=mCG147710.0 transcript_id=mCT187973.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(11020056..11020265)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147710"
FT                   /product="mCG147710"
FT                   /note="gene_id=mCG147710.0 transcript_id=mCT187973.0
FT                   protein_id=mCP108536.0"
FT                   /protein_id="EDL21025.1"
FT                   /translation="MKKTLRSGTWVVSLRNSSRPLREDLKQVRHTGTSPSYGASECRSK
FT                   ARITWQKSHSDGSAEELGRVGAIS"
FT   gene            complement(11160248..11173104)
FT                   /gene="Fndc6"
FT                   /locus_tag="mCG_19504"
FT                   /note="gene_id=mCG19504.2"
FT   mRNA            complement(join(11160248..11161798,11163960..11164102,
FT                   11168787..11168937,11170894..11171018,11173014..11173104))
FT                   /gene="Fndc6"
FT                   /locus_tag="mCG_19504"
FT                   /product="fibronectin type III domain containing 6,
FT                   transcript variant mCT19767"
FT                   /note="gene_id=mCG19504.2 transcript_id=mCT19767.2 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(11160248..11161798,11163960..11164102,
FT                   11164220..11164327))
FT                   /gene="Fndc6"
FT                   /locus_tag="mCG_19504"
FT                   /product="fibronectin type III domain containing 6,
FT                   transcript variant mCT171132"
FT                   /note="gene_id=mCG19504.2 transcript_id=mCT171132.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(11161682..11161798,11163960..11164102,
FT                   11168787..11168937,11170894..11170998))
FT                   /codon_start=1
FT                   /gene="Fndc6"
FT                   /locus_tag="mCG_19504"
FT                   /product="fibronectin type III domain containing 6, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19504.2 transcript_id=mCT19767.2
FT                   protein_id=mCP21389.2 isoform=CRA_b"
FT                   /protein_id="EDL21027.1"
FT                   /translation="MEVTEHGLHLVIELEDLGPQFEFLVVYWRREPGAAEHVKMVRSGD
FT                   IPVHLETMEPGAMYCVKAQALVKAIGRHSAFSQPTCVEMQGESLPLALALFAFVGFMLI
FT                   LVVVLLSVWKMGQLLRYSCCPAVVLPDTLKITSSSQKLISCRKEEVDACAVAVLSSEHL
FT                   FGVWISQT"
FT   CDS             complement(join(11161682..11161798,11163960..11164102,
FT                   11164220..11164262))
FT                   /codon_start=1
FT                   /gene="Fndc6"
FT                   /locus_tag="mCG_19504"
FT                   /product="fibronectin type III domain containing 6, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19504.2 transcript_id=mCT171132.0
FT                   protein_id=mCP94050.0 isoform=CRA_a"
FT                   /protein_id="EDL21026.1"
FT                   /translation="MVVVVAIGGHTKSQGESLPLALALFAFVGFMLILVVVLLSVWKMG
FT                   QLLRYSCCPAVVLPDTLKITSSSQKLISCRKEEVDACAVAVLSSEHLFGVWISQT"
FT   gene            complement(11196349..11248530)
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /note="gene_id=mCG19501.2"
FT   mRNA            complement(join(11196349..11198159,11199750..11200462,
FT                   11210851..11211094,11248387..11248530))
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, transcript variant mCT19764"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT19764.2 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(11196349..11198159,11199750..11200462,
FT                   11210851..11211094,11248419..11248510))
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, transcript variant mCT170561"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT170561.0 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(11196349..11198159,11199750..11200462,
FT                   11210851..11211094,11247939..11248123))
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, transcript variant mCT170562"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT170562.0 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(11196349..11198159,11199750..11200462,
FT                   11209147..11209243))
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, transcript variant mCT170563"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT170563.0 created
FT                   on 11-JUL-2002"
FT   CDS             complement(join(11197965..11198159,11199750..11200462,
FT                   11210851..11211076))
FT                   /codon_start=1
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT170561.0
FT                   protein_id=mCP93481.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99M51"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR017304"
FT                   /db_xref="InterPro:IPR028526"
FT                   /db_xref="MGI:MGI:109601"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99M51"
FT                   /protein_id="EDL21028.1"
FT                   /translation="MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSM
FT                   NKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDTASPADDSFVDPGERL
FT                   YDLNMPAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEE
FT                   GDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEK
FT                   PENDPEWWKCRKINGMVGLVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNP
FT                   WYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYC
FT                   IGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS"
FT   CDS             complement(join(11197965..11198159,11199750..11200462,
FT                   11210851..11211076))
FT                   /codon_start=1
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT170562.0
FT                   protein_id=mCP93480.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99M51"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR017304"
FT                   /db_xref="InterPro:IPR028526"
FT                   /db_xref="MGI:MGI:109601"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99M51"
FT                   /protein_id="EDL21029.1"
FT                   /translation="MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSM
FT                   NKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDTASPADDSFVDPGERL
FT                   YDLNMPAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEE
FT                   GDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEK
FT                   PENDPEWWKCRKINGMVGLVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNP
FT                   WYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYC
FT                   IGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS"
FT   CDS             complement(join(11197965..11198159,11199750..11200462,
FT                   11210851..11211076))
FT                   /codon_start=1
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT19764.2
FT                   protein_id=mCP21318.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q99M51"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR017304"
FT                   /db_xref="InterPro:IPR028526"
FT                   /db_xref="MGI:MGI:109601"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99M51"
FT                   /protein_id="EDL21031.1"
FT                   /translation="MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSM
FT                   NKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDTASPADDSFVDPGERL
FT                   YDLNMPAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEE
FT                   GDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEK
FT                   PENDPEWWKCRKINGMVGLVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNP
FT                   WYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYC
FT                   IGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS"
FT   CDS             complement(join(11197965..11198159,11199750..11200462,
FT                   11209147..11209180))
FT                   /codon_start=1
FT                   /gene="Nck1"
FT                   /locus_tag="mCG_19501"
FT                   /product="non-catalytic region of tyrosine kinase adaptor
FT                   protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG19501.2 transcript_id=mCT170563.0
FT                   protein_id=mCP93479.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8BH99"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR028526"
FT                   /db_xref="MGI:MGI:109601"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BH99"
FT                   /protein_id="EDL21030.1"
FT                   /translation="MDWLNIFKDFFSIGKVKRKPSVPDTASPADDSFVDPGERLYDLNM
FT                   PAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEEGDSPL
FT                   GDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDP
FT                   EWWKCRKINGMVGLVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGK
FT                   VTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRK
FT                   FSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS"
FT   gene            complement(11254613..11273350)
FT                   /locus_tag="mCG_51522"
FT                   /note="gene_id=mCG51522.2"
FT   mRNA            complement(join(11254613..11256031,11273227..11273350))
FT                   /locus_tag="mCG_51522"
FT                   /product="mCG51522"
FT                   /note="gene_id=mCG51522.2 transcript_id=mCT51705.1 created
FT                   on 22-JUL-2002"
FT   CDS             complement(11254775..11256013)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51522"
FT                   /product="mCG51522"
FT                   /note="gene_id=mCG51522.2 transcript_id=mCT51705.1
FT                   protein_id=mCP41363.1"
FT                   /db_xref="GOA:D3YVE8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="MGI:MGI:2685365"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3YVE8"
FT                   /protein_id="EDL21032.1"
FT                   /translation="MDTSPSKKYPIKKRVKIHPNTVMVKYTSHYPQPGDDGYEEINEDY
FT                   GRFMEENPKKSLLSEMRRKGRTLFGTMDTQPSSSEDPRASGMGQFQSFAEKNIFQSRKM
FT                   WLVLFGSALAHGCVALITRLISDRSKVPSLELIFIRSVLQVLSVIVVCYYQEAPFGPSG
FT                   YRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILAFLLVDEKMAYVD
FT                   MATVVCSILGVCLVMIPNIADEDNSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIREK
FT                   ISMWTALFTFGWTGTIWGLSTMFVLQEPIIPLDGATWSYLIAICLCSTAAFLGVYYALD
FT                   KFHPALVSTVQHLEIVVAMVLQLLVLHIFPSVYDVFGGVIIMISVFVLAGYKLYWRNVR
FT                   REDYQEILDSPIK"
FT   gene            complement(11327285..11328276)
FT                   /pseudo
FT                   /locus_tag="mCG_19502"
FT                   /note="gene_id=mCG19502.2"
FT   mRNA            complement(11327285..11328276)
FT                   /pseudo
FT                   /locus_tag="mCG_19502"
FT                   /note="gene_id=mCG19502.2 transcript_id=mCT19765.2 created
FT                   on 22-JUL-2002"
FT   gene            11345631..11656780
FT                   /gene="Stag1"
FT                   /locus_tag="mCG_116377"
FT                   /note="gene_id=mCG116377.1"
FT   mRNA            join(11345631..11345852,11407226..11407327,
FT                   11414494..11414596,11440015..11440179,11459759..11459855,
FT                   11478656..11478732,11488389..11488593,11498569..11498720,
FT                   11505147..11505220,11536775..11536898,11547135..11547233,
FT                   11550779..11550858,11557917..11558024,11570031..11570145,
FT                   11584711..11584828,11591323..11591426,11591771..11591863,
FT                   11591968..11592057,11592192..11592395,11593508..11593578,
FT                   11594996..11595083,11612580..11612660,11640861..11640962,
FT                   11643001..11643149,11644088..11644216,11645314..11645519,
FT                   11649824..11649998,11651703..11651813,11652438..11652552,
FT                   11654611..11654691,11654777..11656780)
FT                   /gene="Stag1"
FT                   /locus_tag="mCG_116377"
FT                   /product="stromal antigen 1, transcript variant mCT117497"
FT                   /note="gene_id=mCG116377.1 transcript_id=mCT117497.1
FT                   created on 11-JUL-2002"
FT   mRNA            join(11345631..11345852,11365315..11365363,
FT                   11407226..11407327,11414494..11415166)
FT                   /gene="Stag1"
FT                   /locus_tag="mCG_116377"
FT                   /product="stromal antigen 1, transcript variant mCT170548"
FT                   /note="gene_id=mCG116377.1 transcript_id=mCT170548.0
FT                   created on 11-JUL-2002"
FT   CDS             join(11407299..11407327,11414494..11414596,
FT                   11440015..11440179,11459759..11459855,11478656..11478732,
FT                   11488389..11488593,11498569..11498720,11505147..11505220,
FT                   11536775..11536898,11547135..11547233,11550779..11550858,
FT                   11557917..11558024,11570031..11570145,11584711..11584828,
FT                   11591323..11591426,11591771..11591863,11591968..11592057,
FT                   11592192..11592395,11593508..11593578,11594996..11595083,
FT                   11612580..11612660,11640861..11640962,11643001..11643149,
FT                   11644088..11644216,11645314..11645519,11649824..11649998,
FT                   11651703..11651813,11652438..11652552,11654611..11654691,
FT                   11654777..11654800)
FT                   /codon_start=1
FT                   /gene="Stag1"
FT                   /locus_tag="mCG_116377"
FT                   /product="stromal antigen 1, isoform CRA_a"
FT                   /note="gene_id=mCG116377.1 transcript_id=mCT117497.1
FT                   protein_id=mCP68808.1 isoform=CRA_a"
FT                   /protein_id="EDL21033.1"
FT                   /translation="MITSELPVLQDSTNETTAHSDAGSELEETEVKGKRKRGRPGRPPS
FT                   TNKKPRKSPGEKSRIEAGIRGAGRGRANGHPQQNGDGDPVTLFEVVKLGKSAMQSVVDD
FT                   WIELYKQDRDIALLDLINFFIQCSGCRGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYP
FT                   LTMPGPQWKKFRSNFCEFIGVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTS
FT                   TLAAMKLMTALVNVALNLSIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQ
FT                   DEIENMMNSIFKGIFVHRYRDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLH
FT                   DRQGEVRLKCLKALQSLYTNRELFPKLELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTL
FT                   ILHGSEEALSNEDCENVYHLVYSAHRPVAVAAGEFLHKKLFSRHDPQAEEALAKRRGRN
FT                   SPNGNLIRMLVLFFLESELHEHAAYLVDSLWESSQELLKDWECMTELLLEEPVQGEEAM
FT                   SDRQESALIELMVCTIRQAAEAHPPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLP
FT                   MLLSKYSADAEKVANLLQIPQYFDLEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEA
FT                   CSKTYSILCSEEYTIQNRVDIARSQLIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLST
FT                   LKRLTSFHNAHDLTKWDLFGNCYRLLKTGIEHGAMPEQIVVQALQCSHYSILWQLVKIT
FT                   DGSPSKYYNDYGDIIKETLSKTRQIDKIQCAKTLILSLQQLFNELVQEQGPNLDRTSAH
FT                   VSGIKELARRFALTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYPPPNLAFLEVL
FT                   SEFSSKLLRQDKKTVHSYLEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNSG
FT                   SSSSKTSSVRSKKGRPPLHRKRVEDESLDNTWLNRTDTMIQTPGPLPTPQLTSTVLREN
FT                   SRPMGEQIQEPESEHGSEPDFLHNPQMQISWLGQPKLEDLNRKDRTGMNYMKVRAGVRH
FT                   AVRGLMEEDAEPIFEDVMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDS
FT                   AAIIEDDSGFGMPMF"
FT   CDS             join(11407299..11407327,11414494..11414644)
FT                   /codon_start=1
FT                   /gene="Stag1"
FT                   /locus_tag="mCG_116377"
FT                   /product="stromal antigen 1, isoform CRA_b"
FT                   /note="gene_id=mCG116377.1 transcript_id=mCT170548.0
FT                   protein_id=mCP93467.0 isoform=CRA_b"
FT                   /protein_id="EDL21034.1"
FT                   /translation="MITSELPVLQDSTNETTAHSDAGSELEETEVKGKRKRGRPGRPPV
FT                   CIIFYLYASMLSHK"
FT   gene            11579603..11581697
FT                   /pseudo
FT                   /locus_tag="mCG_140657"
FT                   /note="gene_id=mCG140657.0"
FT   mRNA            11579603..11581697
FT                   /pseudo
FT                   /locus_tag="mCG_140657"
FT                   /note="gene_id=mCG140657.0 transcript_id=mCT170549.0
FT                   created on 11-JUL-2002"
FT   gene            complement(11684551..11738974)
FT                   /gene="Pccb"
FT                   /locus_tag="mCG_19499"
FT                   /note="gene_id=mCG19499.2"
FT   mRNA            complement(join(11684551..11685319,11686881..11686980,
FT                   11687671..11687769,11688084..11688184,11688332..11688439,
FT                   11692082..11692205,11698909..11698990,11699915..11700035,
FT                   11703514..11703622,11717028..11717138,11727651..11727764,
FT                   11731597..11731653,11734785..11734853,11736459..11736578,
FT                   11738747..11738974))
FT                   /gene="Pccb"
FT                   /locus_tag="mCG_19499"
FT                   /product="propionyl Coenzyme A carboxylase, beta
FT                   polypeptide, transcript variant mCT19762"
FT                   /note="gene_id=mCG19499.2 transcript_id=mCT19762.2 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(11684551..11685319,11686881..11686980,
FT                   11687671..11687769,11688084..11688184,11688332..11688439,
FT                   11692082..11692205,11698909..11698990,11699915..11700035,
FT                   11703514..11703622,11717028..11717138,11727651..11727764,
FT                   11731597..11731653,11734785..11734853,11736459..11736518,
FT                   11738779..11738959))
FT                   /gene="Pccb"
FT                   /locus_tag="mCG_19499"
FT                   /product="propionyl Coenzyme A carboxylase, beta
FT                   polypeptide, transcript variant mCT170560"
FT                   /note="gene_id=mCG19499.2 transcript_id=mCT170560.0 created
FT                   on 11-JUL-2002"
FT   CDS             complement(join(11685198..11685319,11686881..11686980,
FT                   11687671..11687769,11688084..11688184,11688332..11688439,
FT                   11692082..11692205,11698909..11698990,11699915..11700035,
FT                   11703514..11703622,11717028..11717138,11727651..11727764,
FT                   11731597..11731653,11734785..11734853,11736459..11736578,
FT                   11738747..11738935))
FT                   /codon_start=1
FT                   /gene="Pccb"
FT                   /locus_tag="mCG_19499"
FT                   /product="propionyl Coenzyme A carboxylase, beta
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG19499.2 transcript_id=mCT19762.2
FT                   protein_id=mCP21272.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q7TMF4"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="MGI:MGI:1914154"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TMF4"
FT                   /protein_id="EDL21035.1"
FT                   /translation="MAAAIRIRAVAAGARLSVLNCGLGITTRGLCSQPVSVKERIDNKR
FT                   HAALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKF
FT                   PGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDS
FT                   GGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDT
FT                   SYLFITGPEVVKSVTNEDVTQEQLGGAKTHTTVSGVAHRAFDNDVDALCNLREFFNFLP
FT                   LSSQDPAPIRECHDPSDRLVPELDTVVPLESSKAYNMLDIIHAVIDEREFFEIMPSYAK
FT                   NIVVGFARMNGRTVGIVGNQPNVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGF
FT                   LPGTAQEYGGIIRHGAKLLYAFAEATVPKITVITRKAYGGAYDVMSSKHLLGDTNYAWP
FT                   TAEIAVMGAKGAVEIIFKGHQDVEAAQAEYVEKFANPFPAAVRGFVDDIIQPSSTRARI
FT                   CCDLEVLASKKVHRPWRKHANIPL"
FT   CDS             complement(join(11685198..11685319,11686881..11686980,
FT                   11687671..11687769,11688084..11688184,11688332..11688439,
FT                   11692082..11692205,11698909..11698990,11699915..11700035,
FT                   11703514..11703622,11717028..11717138,11727651..11727764,
FT                   11731597..11731653,11734785..11734853,11736459..11736518,
FT                   11738779..11738799))
FT                   /codon_start=1
FT                   /gene="Pccb"
FT                   /locus_tag="mCG_19499"
FT                   /product="propionyl Coenzyme A carboxylase, beta
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG19499.2 transcript_id=mCT170560.0
FT                   protein_id=mCP93478.0 isoform=CRA_b"
FT                   /protein_id="EDL21036.1"
FT                   /translation="MQRCWEESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLV
FT                   YVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYAD
FT                   IFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPEVVKSVTNE
FT                   DVTQEQLGGAKTHTTVSGVAHRAFDNDVDALCNLREFFNFLPLSSQDPAPIRECHDPSD
FT                   RLVPELDTVVPLESSKAYNMLDIIHAVIDEREFFEIMPSYAKNIVVGFARMNGRTVGIV
FT                   GNQPNVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAK
FT                   LLYAFAEATVPKITVITRKAYGGAYDVMSSKHLLGDTNYAWPTAEIAVMGAKGAVEIIF
FT                   KGHQDVEAAQAEYVEKFANPFPAAVRGFVDDIIQPSSTRARICCDLEVLASKKVHRPWR
FT                   KHANIPL"
FT   gene            11757723..11758052
FT                   /pseudo
FT                   /locus_tag="mCG_53673"
FT                   /note="gene_id=mCG53673.2"
FT   mRNA            11757723..11758052
FT                   /pseudo
FT                   /locus_tag="mCG_53673"
FT                   /note="gene_id=mCG53673.2 transcript_id=mCT53856.2 created
FT                   on 22-JUL-2002"
FT   gene            11778397..11802279
FT                   /locus_tag="mCG_15723"
FT                   /note="gene_id=mCG15723.2"
FT   mRNA            join(11778397..11779055,11800044..11802279)
FT                   /locus_tag="mCG_15723"
FT                   /product="mCG15723"
FT                   /note="gene_id=mCG15723.2 transcript_id=mCT19755.2 created
FT                   on 22-JUL-2002"
FT   CDS             join(11778914..11779055,11800044..11801635)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15723"
FT                   /product="mCG15723"
FT                   /note="gene_id=mCG15723.2 transcript_id=mCT19755.2
FT                   protein_id=mCP21401.1"
FT                   /protein_id="EDL21037.1"
FT                   /translation="MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCC
FT                   VCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYK
FT                   KLCEYITQTTLARDIIEAVDCSSDILALLNDGSLFCEETEKPSDSSFTLCLTHSPLPST
FT                   SEPTADPQASLSPMSESTLSIAIGSSVINGLPTYNGLSIDRFGINIPSPEHPNTIDVCN
FT                   TVDIKTEDLSDNLPPVCDTVATDLCSTGIDICSFSEDIKPGDSLLLSVEEVLRSLETVS
FT                   NTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKVAKLNR
FT                   KRSRSESDSEKVQPLPISTIIRGPTLGASAPVTVKRESKISLQPIATVPNGGTTPKISK
FT                   TVLLSTKSMKKSHEHGSKKSHSKSKPGILKKDKAVKEKMPSHHFMPGSPTKTVYKKPQE
FT                   KKGCKCGRATQNPSVLTCRGQRCPCYSNRKACLDCICRGCQNSYMANGEKKLEAFAVPE
FT                   KALEQTRLTLGINVTSIAVRNASTSTSVINVTGSPVTTFLAASTHDDKSLDEAIDMRFD
FT                   C"
FT   gene            complement(11801940..11950461)
FT                   /locus_tag="mCG_15724"
FT                   /note="gene_id=mCG15724.2"
FT   mRNA            complement(join(11801940..11807442,11824507..11824613,
FT                   11825794..11825912,11826382..11826557,11842973..11843062,
FT                   11844137..11844185,11847244..11847400,11852446..11852532,
FT                   11873981..11874055,11878988..11879090,11884587..11884690,
FT                   11892815..11893081,11909780..11912211,11950326..11950461))
FT                   /locus_tag="mCG_15724"
FT                   /product="mCG15724, transcript variant mCT19756"
FT                   /note="gene_id=mCG15724.2 transcript_id=mCT19756.2 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(11801940..11807442,11824507..11824613,
FT                   11825794..11825912,11826382..11826557,11842973..11843062,
FT                   11844137..11844185,11847244..11847400,11852446..11852532,
FT                   11873981..11874055,11878988..11879090,11884587..11884690,
FT                   11892815..11893081,11897287..11897592))
FT                   /locus_tag="mCG_15724"
FT                   /product="mCG15724, transcript variant mCT171130"
FT                   /note="gene_id=mCG15724.2 transcript_id=mCT171130.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(11807316..11807442,11824507..11824613,
FT                   11825794..11825912,11826382..11826557,11842973..11843062,
FT                   11844137..11844185,11847244..11847400,11852446..11852532,
FT                   11873981..11874055,11878988..11879090,11884587..11884690,
FT                   11892815..11893081,11909780..11911771))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15724"
FT                   /product="mCG15724, isoform CRA_b"
FT                   /note="gene_id=mCG15724.2 transcript_id=mCT19756.2
FT                   protein_id=mCP21218.1 isoform=CRA_b"
FT                   /db_xref="GOA:B2RXC8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:2442104"
FT                   /db_xref="UniProtKB/TrEMBL:B2RXC8"
FT                   /protein_id="EDL21039.1"
FT                   /translation="MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGIDCI
FT                   VVHHSVCADLVHIPVSQFKDVDLNSVFLSHENGLSSAEDYPHQALTGLPRGKKASTFQN
FT                   TCNLKDIAGEAISFASGKIKEFSLEKLRNSNHAAYRKGRKVKSDSFNRRSVDFDLLCGH
FT                   YNNDGTSPPFGLLRSSSVEEKSLSHRNSLDTNLTSMLFQNLSEEDLVTQILEKHKIDHF
FT                   SSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGGSISEGSGNEVISNSETVYMNVM
FT                   TRLAYYLRKLPFEFMQSGNNETVDLTELINNIPNLQLTPFSPLYGTEQPPKYEDIVHLS
FT                   ALDSGQFQTVELQDDKHNFKQTDIVKTTPNNTDSLCSLEVNDPGTLKPVQLQSPLLTIN
FT                   HLENVSSGNLMETLYIEEESDGKKSLLDKEQKAENGQGQEPLQVNEHKEFSDHDTYLKK
FT                   CPVSMQNEIGKIFEKPIMVHPSKEDSKLEVPTTDLRDQRHFVNPNSQEEIDKLLMDLES
FT                   FSQKMETSLGEPLAKGKSINSLNSHSHLTAQSHKDLEPKPIASSAMEKVSPSCLTRIIE
FT                   NNGHKMEEEDRALLLRIMESIEDFAQELVECKSGRGSLSQEKEMMQILQETLTTSSQPT
FT                   PSVCRSPVGEKPKDSTSVVLIQQTPEVIKIQNKPEKKPATSFPPAATLPSSPQPASPVP
FT                   CVSDVVNTPLSINIPQFYFPEGLPDTCSNHEQILSRIETAFKDIEDQKADIHEMGRIAK
FT                   VCGCPLYWKAPMFRAAGGEKTGFVTAQSFIAMWKKLLSNRHDDAAKFIWLLAKPSCSYL
FT                   EQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVVQRIFYTVNRSWSGKITSTEIRK
FT                   SNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDGDHDLYISQADLSRYNDQAS
FT                   SNRIIERIFSGAVTRGKTVQKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDG
FT                   ILSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPASDGRITLRDLKRCRMAH
FT                   IFYDTFFNLEKYLDHEQRDPFAVQKDVENDGPEPSDWDRFAAEEYEALVTEESAQVQLQ
FT                   EGSFEDYESDEPVSPSELGNKGNKIVTSSLSEKCGKLQSVDEE"
FT   CDS             complement(join(11807316..11807442,11824507..11824613,
FT                   11825794..11825912,11826382..11826557,11842973..11843062,
FT                   11844137..11844185,11847244..11847400,11852446..11852532,
FT                   11873981..11874055,11878988..11879090,11884587..11884690,
FT                   11892815..11893081,11897287..11897418))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15724"
FT                   /product="mCG15724, isoform CRA_a"
FT                   /note="gene_id=mCG15724.2 transcript_id=mCT171130.0
FT                   protein_id=mCP94048.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9E8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:2442104"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9E8"
FT                   /protein_id="EDL21038.1"
FT                   /translation="MMIKETSLRRDPDLRGELAFLARGCDFVLPSRFKKRLKSFQQTQI
FT                   QNKPEKKPATSFPPAATLPSSPQPASPVPCVSDVVNTPLSINIPQFYFPEGLPDTCSNH
FT                   EQILSRIETAFKDIEDQKADIHEMGRIAKVCGCPLYWKAPMFRAAGGEKTGFVTAQSFI
FT                   AMWKKLLSNRHDDAAKFIWLLAKPSCSYLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHS
FT                   RYITTVVQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYV
FT                   IYCKFWELDGDHDLYISQADLSRYNDQASSNRIIERIFSGAVTRGKTVQKEGRMSYADF
FT                   VWFLISEEDKRNPTSIEYWFRCMDVDGDGILSMYELEYFYEEQCERMEAMGIEPLPFHD
FT                   LLCQMLDLVKPASDGRITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVEND
FT                   GPEPSDWDRFAAEEYEALVTEESAQVQLQEGSFEDYESDEPVSPSELGNKGNKIVTSSL
FT                   SEKCGKLQSVDEE"
FT   gene            complement(11980029..11980437)
FT                   /pseudo
FT                   /locus_tag="mCG_1032773"
FT                   /note="gene_id=mCG1032773.1"
FT   mRNA            complement(11980029..11980437)
FT                   /pseudo
FT                   /locus_tag="mCG_1032773"
FT                   /note="gene_id=mCG1032773.1 transcript_id=mCT150477.1
FT                   created on 22-JUL-2002"
FT   gene            complement(12016082..12046624)
FT                   /locus_tag="mCG_140729"
FT                   /note="gene_id=mCG140729.0"
FT   mRNA            complement(join(12016082..12016107,12046064..12046624))
FT                   /locus_tag="mCG_140729"
FT                   /product="mCG140729"
FT                   /note="gene_id=mCG140729.0 transcript_id=mCT171108.0
FT                   created on 22-JUL-2002"
FT   gene            12040819..>12045767
FT                   /locus_tag="mCG_1032889"
FT                   /note="gene_id=mCG1032889.1"
FT   mRNA            join(12040819..12041143,12041663..12041800,
FT                   12045559..>12045767)
FT                   /locus_tag="mCG_1032889"
FT                   /product="mCG1032889"
FT                   /note="gene_id=mCG1032889.1 transcript_id=mCT150593.1
FT                   created on 22-JUL-2002"
FT   CDS             join(12041773..12041800,12045559..12045767)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032889"
FT                   /product="mCG1032889"
FT                   /note="gene_id=mCG1032889.1 transcript_id=mCT150593.1
FT                   protein_id=mCP68686.1"
FT                   /protein_id="EDL21041.1"
FT                   /translation="MCSTELTAKDKYSSHPSPEKPPVCRRWRRLQKSTRAEFFSVPNSN
FT                   QYIYNQPLDPRLRGHHGRRARKTVKARGLGHLL"
FT   CDS             complement(12046144..12046449)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140729"
FT                   /product="mCG140729"
FT                   /note="gene_id=mCG140729.0 transcript_id=mCT171108.0
FT                   protein_id=mCP94026.0"
FT                   /protein_id="EDL21040.1"
FT                   /translation="MTKETWGGKGLFGLHFHITVHHQRKSEQELKQGRDLETGADAEAM
FT                   EQCRFLTCSCGLIACFLIESRSTRPEMPPLTIDWALPPSITCKETALLLDPMEASS"
FT   gene            complement(12139457..>12143143)
FT                   /locus_tag="mCG_15722"
FT                   /note="gene_id=mCG15722.1"
FT   mRNA            complement(join(12139457..12140121,12142763..>12143143))
FT                   /locus_tag="mCG_15722"
FT                   /product="mCG15722"
FT                   /note="gene_id=mCG15722.1 transcript_id=mCT19754.2 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(12139657..12140121,12142763..12143143))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15722"
FT                   /product="mCG15722"
FT                   /note="gene_id=mCG15722.1 transcript_id=mCT19754.2
FT                   protein_id=mCP21400.2"
FT                   /protein_id="EDL21042.1"
FT                   /translation="MAVPETRPNHTIYINSLNEKIKKDELKKSPYAIFSQFGQILDILV
FT                   SQSLKMRGQSFVIFKEVSSTINALRSMQGFPFYGKPMHIQYAKTDSDIIAKMKGTFVER
FT                   DHKREKRKPKSQEKPAAKKRLFRWGSAPVVGAVQPVPGMPPMPQAPRVMHHMPGQPPYM
FT                   RPPGMILPPGLPPGQIPSRAMPPQQLIPGQMPHAQPLSENPPNHILFLTNLPEETNELM
FT                   LSMLFTQFPGFKEVRLVPGRHDIDFVEFDNEVQAGAARDVLQGFKITQNNAMKISFAKK
FT                   "
FT   gene            complement(12464451..>12556409)
FT                   /locus_tag="mCG_1032892"
FT                   /note="gene_id=mCG1032892.1"
FT   mRNA            complement(join(12464451..12464639,12464792..12464897,
FT                   12516158..12516321,12556251..>12556409))
FT                   /locus_tag="mCG_1032892"
FT                   /product="mCG1032892, transcript variant mCT150596"
FT                   /note="gene_id=mCG1032892.1 transcript_id=mCT150596.1
FT                   created on 22-JUL-2002"
FT   CDS             complement(join(12516295..12516321,12556251..>12556409))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032892"
FT                   /product="mCG1032892, isoform CRA_a"
FT                   /note="gene_id=mCG1032892.1 transcript_id=mCT150596.1
FT                   protein_id=mCP68698.1 isoform=CRA_a"
FT                   /protein_id="EDL21043.1"
FT                   /translation="KSRRQCLHPILILHHFQGRDKDKHTPRSHAGRKAAWNLSPLRTVL
FT                   EEDKPAVEDFLFMEEL"
FT   mRNA            complement(join(12555934..12556161,12556251..>12556409))
FT                   /locus_tag="mCG_1032892"
FT                   /product="mCG1032892, transcript variant mCT171109"
FT                   /note="gene_id=mCG1032892.1 transcript_id=mCT171109.0
FT                   created on 22-JUL-2002"
FT   CDS             complement(join(12556018..12556161,12556251..>12556409))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032892"
FT                   /product="mCG1032892, isoform CRA_b"
FT                   /note="gene_id=mCG1032892.1 transcript_id=mCT171109.0
FT                   protein_id=mCP94027.0 isoform=CRA_b"
FT                   /protein_id="EDL21044.1"
FT                   /translation="KSRRQCLHPILILHHFQGRDKDKHTPRSHAGRKAAWNLSPLRTVL
FT                   EEDKPAVEGTSKEITCLCPPLWLAMSPVSDLLCPVFNGNTRRSWAVCSLPVKTGT"
FT   gene            12606668..12613169
FT                   /locus_tag="mCG_140741"
FT                   /note="gene_id=mCG140741.0"
FT   mRNA            join(12606668..12607177,12613107..12613169)
FT                   /locus_tag="mCG_140741"
FT                   /product="mCG140741"
FT                   /note="gene_id=mCG140741.0 transcript_id=mCT171140.0
FT                   created on 23-JUL-2002"
FT   CDS             12606774..12606869
FT                   /codon_start=1
FT                   /locus_tag="mCG_140741"
FT                   /product="mCG140741"
FT                   /note="gene_id=mCG140741.0 transcript_id=mCT171140.0
FT                   protein_id=mCP94058.0"
FT                   /protein_id="EDL21045.1"
FT                   /translation="MLLICGLYVAPHFTLTDKSISIPGHITAQCA"
FT   gene            complement(12622048..>13066463)
FT                   /gene="Ephb1"
FT                   /locus_tag="mCG_140739"
FT                   /note="gene_id=mCG140739.1"
FT   mRNA            complement(join(12622048..12623513,12627480..12627635,
FT                   12629246..12629439,12635980..12636129,12669823..12670038,
FT                   12676977..12677224,12689961..12690083,12701779..12701843,
FT                   12702650..12702758,12707597..12707759,12715879..12716003,
FT                   12747597..12747932,12773416..12773571,12906758..12907439,
FT                   12935361..12935425,13066053..13066323))
FT                   /gene="Ephb1"
FT                   /locus_tag="mCG_140739"
FT                   /product="Eph receptor B1, transcript variant mCT171135"
FT                   /note="gene_id=mCG140739.1 transcript_id=mCT171135.0
FT                   created on 06-SEP-2002"
FT   mRNA            complement(join(12622489..12623513,12627480..12627635,
FT                   12629246..12629439,12635980..12636129,12669823..12670038,
FT                   12676977..12677224,12701779..12701843,12702650..12702758,
FT                   12707597..12707759,12715879..12716003,12747597..12747932,
FT                   12773416..12773571,12906758..12907439,12935361..12935425,
FT                   13066053..>13066463))
FT                   /gene="Ephb1"
FT                   /locus_tag="mCG_140739"
FT                   /product="Eph receptor B1, transcript variant mCT191533"
FT                   /note="gene_id=mCG140739.1 transcript_id=mCT191533.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(12623405..12623513,12627480..12627635,
FT                   12629246..12629439,12635980..12636129,12669823..12670038,
FT                   12676977..12677224,12701779..12701843,12702650..12702758,
FT                   12707597..12707759,12715879..12716003,12747597..12747932,
FT                   12773416..12773571,12906758..12907439,12935361..12935425,
FT                   13066053..>13066320))
FT                   /codon_start=1
FT                   /gene="Ephb1"
FT                   /locus_tag="mCG_140739"
FT                   /product="Eph receptor B1, isoform CRA_b"
FT                   /note="gene_id=mCG140739.1 transcript_id=mCT191533.0
FT                   protein_id=mCP112470.0 isoform=CRA_b"
FT                   /protein_id="EDL21047.1"
FT                   /translation="THTHTCTPTSTRARTAPRAHTPAHAHAALRGVRSRPERERTRRSH
FT                   PPGAQRRPGTRRVSAGARPGGRWPAMALDCLLLFLLASAVAAMEETLMDTRTATAELGW
FT                   TANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTV
FT                   RDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFG
FT                   GRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMT
FT                   GAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKAC
FT                   PAGTFKASQEAEGCSHCPSNSRSPSEASPICTCRTGYYRADFDPPEVACTSVPSGPRNV
FT                   ISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTE
FT                   CRVSISSLWAHTPYTFDIQAINGVSSKSPFPPQHVSVNITTNQAAPSTVPIMHQVSATM
FT                   RSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNSSMARSQTNTARIDGLRPGMVYVVQV
FT                   RARTVAGYGKFSGKMCFQTLTDDDYKSELREQLPLIAGSAAAGVVFVVSLVAISIVCSR
FT                   KRAYSKEAAYSDKLQHYSTGRGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDF
FT                   LSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGM
FT                   LRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLG
FT                   GKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYR
FT                   LPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQP
FT                   LLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGVTLAG
FT                   HQKKILSSIHSMRVQMNQSPSVMA"
FT   CDS             complement(join(12623405..12623513,12627480..12627635,
FT                   12629246..12629439,12635980..12636129,12669823..12670038,
FT                   12676977..12677224,12689961..12690083,12701779..12701843,
FT                   12702650..12702758,12707597..12707759,12715879..12716003,
FT                   12747597..12747932,12773416..12773571,12906758..12907439,
FT                   12935361..12935425,13066053..13066110))
FT                   /codon_start=1
FT                   /gene="Ephb1"
FT                   /locus_tag="mCG_140739"
FT                   /product="Eph receptor B1, isoform CRA_a"
FT                   /note="gene_id=mCG140739.1 transcript_id=mCT171135.0
FT                   protein_id=mCP94053.0 isoform=CRA_a"
FT                   /protein_id="EDL21046.1"
FT                   /translation="MALDCLLLFLLASAVAAMEETLMDTRTATAELGWTANPASGWEEV
FT                   SGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPG
FT                   SCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVR
FT                   SFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIAR
FT                   GTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEA
FT                   EGCSHCPSNSRSPSEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIIL
FT                   EWHPPRETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAH
FT                   TPYTFDIQAINGVSSKSPFPPQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPE
FT                   QPNGIILDYEIRYYEKEHNEFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKF
FT                   SGKMCFQTLTDDDYKSELREQLPLIAGSAAAGVVFVVSLVAISIVCSRKRAYSKEAAYS
FT                   DKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYK
FT                   GRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVM
FT                   IITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVN
FT                   SNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGI
FT                   VMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRF
FT                   AEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRD
FT                   SFLTAGFTSLQLVTQMTSEDLLRIGVTLAGHQKKILSSIHSMRVQMNQSPSVMA"
FT   gene            12638391..12643147
FT                   /gene="9630041A04Rik"
FT                   /locus_tag="mCG_147718"
FT                   /note="gene_id=mCG147718.0"
FT   mRNA            join(12638391..12638734,12639518..12639611,
FT                   12642611..12643147)
FT                   /gene="9630041A04Rik"
FT                   /locus_tag="mCG_147718"
FT                   /product="RIKEN cDNA 9630041A04"
FT                   /note="gene_id=mCG147718.0 transcript_id=mCT187981.0
FT                   created on 13-JAN-2004"
FT   CDS             join(12638529..12638734,12639518..12639611,
FT                   12642611..12642928)
FT                   /codon_start=1
FT                   /gene="9630041A04Rik"
FT                   /locus_tag="mCG_147718"
FT                   /product="RIKEN cDNA 9630041A04"
FT                   /note="gene_id=mCG147718.0 transcript_id=mCT187981.0
FT                   protein_id=mCP108544.0"
FT                   /protein_id="EDL21048.1"
FT                   /translation="MLASQPRGPGFDSQKQYKEGQICWPALVIPMLDKGICLGLMVSQP
FT                   KLLGGLVANNRPHLKTVWTTPELRKSIRLEDADQPHEGTEQEVDDIAAGKAFTSQIRPE
FT                   SVKLLLAPSLPALNSQWKRLLLAAELQLSLCNKEVLPRMPGNCRKNGLSTFGKSSSGPA
FT                   AAFLLEAKLLLETLQFISLLRTMMQEMEKEKDSEHLVGCWDW"
FT   gene            <13210348..13250547
FT                   /gene="Ky"
FT                   /locus_tag="mCG_116015"
FT                   /note="gene_id=mCG116015.2"
FT   mRNA            join(<13210348..13210879,13213712..13213774,
FT                   13217577..13217639,13225893..13225967,13227922..13227984,
FT                   13230002..13230084,13231300..13231408,13232504..13232621,
FT                   13242205..13242393,13243602..13243792,13246490..13247662)
FT                   /gene="Ky"
FT                   /locus_tag="mCG_116015"
FT                   /product="kyphoscoliosis peptidase, transcript variant
FT                   mCT191546"
FT                   /note="gene_id=mCG116015.2 transcript_id=mCT191546.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(13210351..13210879,13213712..13213774,
FT                   13217577..13217639,13225893..13225967,13227922..13227984,
FT                   13230002..13230084,13231300..13231408,13232504..13232621,
FT                   13242205..13242334,13243585..13243792,13246490..13250547)
FT                   /gene="Ky"
FT                   /locus_tag="mCG_116015"
FT                   /product="kyphoscoliosis peptidase, transcript variant
FT                   mCT117131"
FT                   /note="gene_id=mCG116015.2 transcript_id=mCT117131.1
FT                   created on 11-JUL-2002"
FT   CDS             join(<13210576..13210879,13213712..13213774,
FT                   13217577..13217639,13225893..13225967,13227922..13227984,
FT                   13230002..13230084,13231300..13231408,13232504..13232621,
FT                   13242205..13242393,13243602..13243792,13246490..13247385)
FT                   /codon_start=1
FT                   /gene="Ky"
FT                   /locus_tag="mCG_116015"
FT                   /product="kyphoscoliosis peptidase, isoform CRA_a"
FT                   /note="gene_id=mCG116015.2 transcript_id=mCT191546.0
FT                   protein_id=mCP112463.0 isoform=CRA_a"
FT                   /protein_id="EDL21049.1"
FT                   /translation="IWQSQRNCARRTWRRGSALSRALALSRARQQRARGHLQPRQPREQ
FT                   PLRAGREGGGTMELKKDSNAVAIDMLLIVHSEKRRAAQATHLDPQANPGALLQNRGGFQ
FT                   GVRNGIRKWQELEENSFQGNLPEKQCLQQPQVITSYDNQGTQLTVEIHPQDAMPQLLKK
FT                   FSLAKRLQGDKNGNMRPRQPGGKDAHAYPWDRSSLKSMPLDLRLFEKLDASASQVTVKS
FT                   GLNELVSDLLQEAHSDLERVRAIWIWICHHIEYDVEAAQEKDRQAFKPTDILRTQKTNC
FT                   DGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFSGEFDHAWNAVYLEGRWHLVDST
FT                   WGSGLVDTTTSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHK
FT                   SEFYNKGMLSAHPETSMIRTVNGKATITIESRAPTLFMFMLNGKQEHGLLSLRKNGMKL
FT                   EVYPPTMGTHKLQIFAKGNSEIYSSVLEYTLKCNYVDFSVQLPSELHQPVGPSWFSEQM
FT                   GITKPSHSDPIIHTSDGRCAISFSVEEGVSVLASLHGDDGPITEETQRRYIFQLNRGKR
FT                   TELKVQLPHAGKFALKIFVKKRQEQGNFIFVFNYLLCCANTKVNWPMFPESFGNWGQDN
FT                   ELLEPLSGVLPANRNIAFKLKLHGIAKALVKGQDTWPLTLNPEGYWEGSCNTAGCQEVY
FT                   VMVLENANHNFYSYILKYKVNDQ"
FT   CDS             join(13210744..13210879,13213712..13213774,
FT                   13217577..13217639,13225893..13225967,13227922..13227984,
FT                   13230002..13230084,13231300..13231408,13232504..13232621,
FT                   13242205..13242334,13243585..13243792,13246490..13247385)
FT                   /codon_start=1
FT                   /gene="Ky"
FT                   /locus_tag="mCG_116015"
FT                   /product="kyphoscoliosis peptidase, isoform CRA_b"
FT                   /note="gene_id=mCG116015.2 transcript_id=mCT117131.1
FT                   protein_id=mCP68754.1 isoform=CRA_b"
FT                   /protein_id="EDL21050.1"
FT                   /translation="MELKKDSNAVAIDMLLIVHSEKRRAAQATHLDPQANPGALLQNRG
FT                   GFQGVRNGIRKWQELEENSFQGNLPEKQCLQQPQVITSYDNQGTQLTVEIHPQDAMPQL
FT                   LKKFSLAKRLQGDKNGNMRPRQPGGKDAHAYPWDRSSLKSMPLDLRLFEKLDASASQVT
FT                   VKSGLNELVSDLLQEAHSDLERVRAIWIWICHHIEYDVEAAQEKDRQAFKPTDILRTQK
FT                   TNCDGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFSGEFDHAWNAVYLEGRWHLV
FT                   FLYSSYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHKSEFYNKGMLSA
FT                   HPETSMIRTVNGKATITIESRAPTLFMFMLNGKQEHGLLSLRKNGMKLEVYPPTMGTHK
FT                   LQIFAKGNSEIYSSVLEYTLKCNYVDFSVQLPSELHQPVGPSWFSEQMGITKPSHSDPI
FT                   IHTSDGRCAISFSVEEGVSVLASLHGDDGPITEETQRRYIFQLNRGKRTELKVQLPHAG
FT                   KFALKIFVKKRQEQGNFIFVFNYLLCCANTKVNWPMFPESFGNWGQDNELLEPLSGVLP
FT                   ANRNIAFKLKLHGIAKALVKGQDTWPLTLNPEGYWEGSCNTAGCQEVYVMVLENANHNF
FT                   YSYILKYKVNDQ"
FT   gene            13256307..13257603
FT                   /pseudo
FT                   /locus_tag="mCG_116021"
FT                   /note="gene_id=mCG116021.1"
FT   mRNA            13256307..13257603
FT                   /pseudo
FT                   /locus_tag="mCG_116021"
FT                   /note="gene_id=mCG116021.1 transcript_id=mCT117137.1
FT                   created on 23-JUL-2002"
FT   gene            13260739..13260915
FT                   /pseudo
FT                   /locus_tag="mCG_1032798"
FT                   /note="gene_id=mCG1032798.1"
FT   mRNA            13260739..13260915
FT                   /pseudo
FT                   /locus_tag="mCG_1032798"
FT                   /note="gene_id=mCG1032798.1 transcript_id=mCT150502.1
FT                   created on 23-JUL-2002"
FT   gene            complement(13291190..13331250)
FT                   /locus_tag="mCG_116019"
FT                   /note="gene_id=mCG116019.1"
FT   mRNA            complement(join(13291190..13291617,13299120..13299206,
FT                   13300734..13300931,13302782..13302896,13305930..13306067,
FT                   13307028..13307158,13307452..13307685,13311959..13312072,
FT                   13317951..13318073,13319927..13320022,13323467..13323644,
FT                   13324348..13324416,13330968..13331250))
FT                   /locus_tag="mCG_116019"
FT                   /product="mCG116019, transcript variant mCT117135"
FT                   /note="gene_id=mCG116019.1 transcript_id=mCT117135.1
FT                   created on 23-JUL-2002"
FT   mRNA            complement(join(13291190..13291617,13293314..13293593,
FT                   13294936..13295141,13299120..13299206,13300734..13300931,
FT                   13302782..13302896,13305930..13306067,13307028..13307158,
FT                   13307452..13307685,13311959..13312072,13317951..13318073,
FT                   13319927..13320022,13323467..13323644,13324348..13324416,
FT                   13326352..13326384,13328251..13328288,13330599..>13330798))
FT                   /locus_tag="mCG_116019"
FT                   /product="mCG116019, transcript variant mCT191547"
FT                   /note="gene_id=mCG116019.1 transcript_id=mCT191547.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(13291190..13291617,13299120..13299206,
FT                   13300734..13300931,13302782..13302896,13305930..13306067,
FT                   13307028..13307158,13307452..13307685,13311959..13312072,
FT                   13317951..13318073,13319927..13320022,13323467..13323644,
FT                   13324348..13324416,13325929..13325950,13326352..13326384,
FT                   13328251..13328288,13330599..13330798))
FT                   /locus_tag="mCG_116019"
FT                   /product="mCG116019, transcript variant mCT171116"
FT                   /note="gene_id=mCG116019.1 transcript_id=mCT171116.0
FT                   created on 23-JUL-2002"
FT   CDS             complement(join(13291459..13291617,13293314..13293593,
FT                   13294936..13295141,13299120..13299206,13300734..13300931,
FT                   13302782..13302896,13305930..13306067,13307028..13307158,
FT                   13307452..13307685,13311959..13312072,13317951..13318073,
FT                   13319927..13320022,13323467..13323644,13324348..13324416,
FT                   13326352..13326384,13328251..13328288,13330599..>13330796))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116019"
FT                   /product="mCG116019, isoform CRA_b"
FT                   /note="gene_id=mCG116019.1 transcript_id=mCT191547.0
FT                   protein_id=mCP112464.0 isoform=CRA_b"
FT                   /protein_id="EDL21052.1"
FT                   /translation="GRAAANCGAVSALATVVPLGSRPHGPRPQLVAAHLPRGFPMPGCG
FT                   CPVVAPLGSSSSLWDSGLAGQTTAMNWWPSNLQRWKSRSSRTQSCCQNKEDLEMEALLE
FT                   GIQNRGHSGGFLTSCEAELQELMKQIDIMVAHKKSEWEGQTHALETCLDIRDRELKALR
FT                   SQLDMKHKEVGILHQQIEEHEKTKQEMAMEYKEELLKLQEELSRLKRSYEKLQKKQLRE
FT                   FRGNTKSFREDRSEIERLTGKIEEFRQKSLDWEKQRLIYQQQVSSLEAQRKALAEQSEI
FT                   IQAQLANRKQKLESVELSSQSEIQHLNSKLERAKDTICANELEIERLNIRVNDLMGTNM
FT                   TILQDHRQKEEKLRESEKLLEALQEEQKELKASLQSQETFILEAKMQEKLQTTLKAVGT
FT                   QQSVERPLEDCQKERKYSSPGQGVLDNVLSQLDFSHSSEELLQAEVTRLEGSLESVSAT
FT                   CKQLSQELMEKYEELKRMEGHNNEYRTEIKKLKEQILQADQTYSSALEGMKMEISQLTR
FT                   ELHQRDITIASAKCSSSDMEKQLKAEMQKAEEKAVEHKEILSQLESLKLENHRLSETVM
FT                   KLELGLHEAKEISLADLQENYIEALNKLVSENQQLQKDLMSTKSELEHATNMCKKKDGE
FT                   IFNPAHSRAAGFKNAELKPIHGQHRHDGIKTEQYKTGHHSPRGQTLDSIDPVARGPSPL
FT                   SSHISPGSSTVSLPSNFLFETHCLPSVLDINDVNFSDSLSDCMNDQEEFVSSGSLPTSP
FT                   LGSIATRFLEEEELRSHHILERLDAHIEELKRESEKTVRQFTALV"
FT   CDS             complement(join(13291459..13291617,13299120..13299206,
FT                   13300734..13300931,13302782..13302896,13305930..13306067,
FT                   13307028..13307158,13307452..13307685,13311959..13312072,
FT                   13317951..13318073,13319927..13320022,13323467..13323644,
FT                   13324348..13324391))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116019"
FT                   /product="mCG116019, isoform CRA_a"
FT                   /note="gene_id=mCG116019.1 transcript_id=mCT117135.1
FT                   protein_id=mCP68554.1 isoform=CRA_a"
FT                   /protein_id="EDL21051.1"
FT                   /translation="MEALLEGIQNRGHSGGFLTSCEAELQELMKQIDIMVAHKKSEWEG
FT                   QTHALETCLDIRDRELKALRSQLDMKHKEVGILHQQIEEHEKTKQEMAMEYKEELLKLQ
FT                   EELSRLKRSYEKLQKKQLREFRGNTKSFREDRSEIERLTGKIEEFRQKSLDWEKQRLIY
FT                   QQQVSSLEAQRKALAEQSEIIQAQLANRKQKLESVELSSQSEIQHLNSKLERAKDTICA
FT                   NELEIERLNIRVNDLMGTNMTILQDHRQKEEKLRESEKLLEALQEEQKELKASLQSQET
FT                   FILEAKMQEKLQTTLKAVGTQQSVERPLEDCQKERKYSSPGQGVLDNVLSQLDFSHSSE
FT                   ELLQAEVTRLEGSLESVSATCKQLSQELMEKYEELKRMEGHNNEYRTEIKKLKEQILQA
FT                   DQTYSSALEGMKMEISQLTRELHQRDITIASAKCSSSDMEKQLKAEMQKAEEKAVEHKE
FT                   ILSQLESLKLENHRLSETVMKLELGLHEGSLPTSPLGSIATRFLEEEELRSHHILERLD
FT                   AHIEELKRESEKTVRQFTALV"
FT   CDS             complement(join(13291459..13291617,13299120..13299206,
FT                   13300734..13300931,13302782..13302896,13305930..13306067,
FT                   13307028..13307158,13307452..13307685,13311959..13312072,
FT                   13317951..13318073,13319927..13320022,13323467..13323644,
FT                   13324348..13324391))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116019"
FT                   /product="mCG116019, isoform CRA_a"
FT                   /note="gene_id=mCG116019.1 transcript_id=mCT171116.0
FT                   protein_id=mCP94034.0 isoform=CRA_a"
FT                   /protein_id="EDL21053.1"
FT                   /translation="MEALLEGIQNRGHSGGFLTSCEAELQELMKQIDIMVAHKKSEWEG
FT                   QTHALETCLDIRDRELKALRSQLDMKHKEVGILHQQIEEHEKTKQEMAMEYKEELLKLQ
FT                   EELSRLKRSYEKLQKKQLREFRGNTKSFREDRSEIERLTGKIEEFRQKSLDWEKQRLIY
FT                   QQQVSSLEAQRKALAEQSEIIQAQLANRKQKLESVELSSQSEIQHLNSKLERAKDTICA
FT                   NELEIERLNIRVNDLMGTNMTILQDHRQKEEKLRESEKLLEALQEEQKELKASLQSQET
FT                   FILEAKMQEKLQTTLKAVGTQQSVERPLEDCQKERKYSSPGQGVLDNVLSQLDFSHSSE
FT                   ELLQAEVTRLEGSLESVSATCKQLSQELMEKYEELKRMEGHNNEYRTEIKKLKEQILQA
FT                   DQTYSSALEGMKMEISQLTRELHQRDITIASAKCSSSDMEKQLKAEMQKAEEKAVEHKE
FT                   ILSQLESLKLENHRLSETVMKLELGLHEGSLPTSPLGSIATRFLEEEELRSHHILERLD
FT                   AHIEELKRESEKTVRQFTALV"
FT   gene            13331029..13338962
FT                   /locus_tag="mCG_51921"
FT                   /note="gene_id=mCG51921.2"
FT   mRNA            join(13331029..13331392,13334470..13334595,
FT                   13338735..13338962)
FT                   /locus_tag="mCG_51921"
FT                   /product="mCG51921, transcript variant mCT52104"
FT                   /note="gene_id=mCG51921.2 transcript_id=mCT52104.1 created
FT                   on 23-JUL-2002"
FT   mRNA            join(13331513..13331624,13334470..13334595,
FT                   13338735..13338962)
FT                   /locus_tag="mCG_51921"
FT                   /product="mCG51921, transcript variant mCT171136"
FT                   /note="gene_id=mCG51921.2 transcript_id=mCT171136.0 created
FT                   on 23-JUL-2002"
FT   mRNA            join(13333218..13334595,13338735..13338962)
FT                   /locus_tag="mCG_51921"
FT                   /product="mCG51921, transcript variant mCT171137"
FT                   /note="gene_id=mCG51921.2 transcript_id=mCT171137.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(13334497..13334595,13338735..13338860)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51921"
FT                   /product="mCG51921, isoform CRA_a"
FT                   /note="gene_id=mCG51921.2 transcript_id=mCT171137.0
FT                   protein_id=mCP94054.0 isoform=CRA_a"
FT                   /protein_id="EDL21054.1"
FT                   /translation="MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGG
FT                   TTESVKEQEMKWTDLALQGLHENVPPAGN"
FT   CDS             join(13334497..13334595,13338735..13338860)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51921"
FT                   /product="mCG51921, isoform CRA_a"
FT                   /note="gene_id=mCG51921.2 transcript_id=mCT52104.1
FT                   protein_id=mCP41321.0 isoform=CRA_a"
FT                   /protein_id="EDL21055.1"
FT                   /translation="MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGG
FT                   TTESVKEQEMKWTDLALQGLHENVPPAGN"
FT   CDS             join(13334497..13334595,13338735..13338860)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51921"
FT                   /product="mCG51921, isoform CRA_a"
FT                   /note="gene_id=mCG51921.2 transcript_id=mCT171136.0
FT                   protein_id=mCP94055.0 isoform=CRA_a"
FT                   /protein_id="EDL21056.1"
FT                   /translation="MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGG
FT                   TTESVKEQEMKWTDLALQGLHENVPPAGN"
FT   gene            13398026..13398917
FT                   /locus_tag="mCG_147720"
FT                   /note="gene_id=mCG147720.0"
FT   mRNA            join(13398026..13398088,13398252..13398917)
FT                   /locus_tag="mCG_147720"
FT                   /product="mCG147720"
FT                   /note="gene_id=mCG147720.0 transcript_id=mCT187983.0
FT                   created on 13-JAN-2004"
FT   CDS             13398619..13398741
FT                   /codon_start=1
FT                   /locus_tag="mCG_147720"
FT                   /product="mCG147720"
FT                   /note="gene_id=mCG147720.0 transcript_id=mCT187983.0
FT                   protein_id=mCP108546.0"
FT                   /protein_id="EDL21057.1"
FT                   /translation="MLTLQGRFSTPGLFSARELNFLRARRALYQLSPSPRFFES"
FT   gene            13422857..13438405
FT                   /gene="Amotl2"
FT                   /locus_tag="mCG_6207"
FT                   /note="gene_id=mCG6207.2"
FT   mRNA            join(13422857..13422944,13425117..13425912,
FT                   13428548..13428842,13429678..13429822,13430094..13430186,
FT                   13433310..13433605,13434261..13434571,13434961..13435169,
FT                   13435787..13435963,13436642..13438405)
FT                   /gene="Amotl2"
FT                   /locus_tag="mCG_6207"
FT                   /product="angiomotin like 2, transcript variant mCT170575"
FT                   /note="gene_id=mCG6207.2 transcript_id=mCT170575.0 created
FT                   on 11-JUL-2002"
FT   CDS             join(13425179..13425912,13428548..13428842,
FT                   13429678..13429822,13430094..13430186,13433310..13433605,
FT                   13434261..13434571,13434961..13435169,13435787..13435963,
FT                   13436642..13436700)
FT                   /codon_start=1
FT                   /gene="Amotl2"
FT                   /locus_tag="mCG_6207"
FT                   /product="angiomotin like 2, isoform CRA_a"
FT                   /note="gene_id=mCG6207.2 transcript_id=mCT170575.0
FT                   protein_id=mCP93493.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8K371"
FT                   /db_xref="InterPro:IPR009114"
FT                   /db_xref="InterPro:IPR024646"
FT                   /db_xref="MGI:MGI:1929286"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K371"
FT                   /protein_id="EDL21058.1"
FT                   /translation="MRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGA
FT                   GGTGSPQASLEIGAPEDSQVLQQATRQEPQGQEHQGGETHLAENRLYRLCPQPSKGEEL
FT                   PTYEEAKAHSQYYAAQQAGSRPHVGDRDPRGGVSGGGRRQDEALRELRHGHVRSLSERL
FT                   LQLSLERNGARVPSHMSSSHSFPQLARSQQGPQPRGPPAEGPEPRGPPPQYPHAVMAQE
FT                   TAAVTDPRYRPRSSPHFQHAEVRILQAQVPPVFLQQQQYQYLPQPQEHSPPLHPAALGH
FT                   GPPSSFGPPAVEGPPSAQATLGSAHLAQMETVLRENARLQRDNERLQRELESTSEKAGR
FT                   IEKLENEIQRLSEAHESLMRTSSKREALEKTMRNKMDGEMRRLQDFNRDLRERLESANR
FT                   HLASKTQEAQAGSQDMVAKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRHAELLEQAL
FT                   GNAQSRAARAEEELRKKQAYVEKVERLQQALGQLQAACEKREQLELRLRTRLEQELKAL
FT                   RAQQRQTGTLAGGGGSHGGSAELSALRLSEQLREKEEQILALEADMTKWEQKYLEERAM
FT                   RQFAMDAAATAAAQRDTTLIRHSPQPSPSSSFNEGLLPGNHRHQEMESRLKVLHAQILE
FT                   KDAVIKVLQQRSRKDPGKATQGTLRPAKSVPSIFAAAVGTQGWQGLVSSERQTDARPAG
FT                   DRVPAEEPPATAPLPAHTKHGSRDGSTQTDGPADNTSACLASEPDGLLGCNSSQRTPSL
FT                   DSIAATRVQDLSDMVEILI"
FT   mRNA            join(13427629..13428842,13429678..13429822,
FT                   13430094..13430186,13433310..13433605,13434261..13434571,
FT                   13434961..13435169,13435787..13435963,13436642..13438405)
FT                   /gene="Amotl2"
FT                   /locus_tag="mCG_6207"
FT                   /product="angiomotin like 2, transcript variant mCT5836"
FT                   /note="gene_id=mCG6207.2 transcript_id=mCT5836.1 created on
FT                   11-JUL-2002"
FT   CDS             join(13428741..13428842,13429678..13429822,
FT                   13430094..13430186,13433310..13433605,13434261..13434571,
FT                   13434961..13435169,13435787..13435963,13436642..13436700)
FT                   /codon_start=1
FT                   /gene="Amotl2"
FT                   /locus_tag="mCG_6207"
FT                   /product="angiomotin like 2, isoform CRA_b"
FT                   /note="gene_id=mCG6207.2 transcript_id=mCT5836.1
FT                   protein_id=mCP21283.1 isoform=CRA_b"
FT                   /protein_id="EDL21059.1"
FT                   /translation="METVLRENARLQRDNERLQRELESTSEKAGRIEKLENEIQRLSEA
FT                   HESLMRTSSKREALEKTMRNKMDGEMRRLQDFNRDLRERLESANRHLASKTQEAQAGSQ
FT                   DMVAKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRHAELLEQALGNAQSRAARAEEEL
FT                   RKKQAYVEKVERLQQALGQLQAACEKREQLELRLRTRLEQELKALRAQQRQTGTLAGGG
FT                   GSHGGSAELSALRLSEQLREKEEQILALEADMTKWEQKYLEERAMRQFAMDAAATAAAQ
FT                   RDTTLIRHSPQPSPSSSFNEGLLPGNHRHQEMESRLKVLHAQILEKDAVIKVLQQRSRK
FT                   DPGKATQGTLRPAKSVPSIFAAAVGTQGWQGLVSSERQTDARPAGDRVPAEEPPATAPL
FT                   PAHTKHGSRDGSTQTDGPADNTSACLASEPDGLLGCNSSQRTPSLDSIAATRVQDLSDM
FT                   VEILI"
FT   gene            <13539017..13621650
FT                   /locus_tag="mCG_6211"
FT                   /note="gene_id=mCG6211.2"
FT   mRNA            join(<13539017..13539115,13539263..13539349,
FT                   13575570..13575691,13581267..13581366,13582986..13583120,
FT                   13585443..13585496,13589324..13589468,13595241..13595341,
FT                   13599416..13599541,13601845..13601931,13604591..13604660,
FT                   13610554..13610686,13611829..13611938,13612061..13612220,
FT                   13619382..13619518,13620195..13621650)
FT                   /locus_tag="mCG_6211"
FT                   /product="mCG6211"
FT                   /note="gene_id=mCG6211.2 transcript_id=mCT5831.2 created on
FT                   23-JUL-2002"
FT   CDS             join(<13539265..13539349,13575570..13575691,
FT                   13581267..13581366,13582986..13583120,13585443..13585496,
FT                   13589324..13589468,13595241..13595341,13599416..13599541,
FT                   13601845..13601931,13604591..13604660,13610554..13610686,
FT                   13611829..13611938,13612061..13612220,13619382..13619518,
FT                   13620195..13620306)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6211"
FT                   /product="mCG6211"
FT                   /note="gene_id=mCG6211.2 transcript_id=mCT5831.2
FT                   protein_id=mCP21317.2"
FT                   /protein_id="EDL21060.1"
FT                   /translation="PRSPALAAAPAGPSVSLYLSEDEVRRLLGLDAELYYVRNDLISHY
FT                   ALSFNLLVPSETNFLHFTWHAKSKVEYKLGFQVDNFVAMGMPQVNISAQGEVPRTLSVF
FT                   RVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNTSR
FT                   TIYDPVHAAPTTSTRVFYISVGVCCAVIFLVAIILAVLHLHSMKRIELDDSISASSSSQ
FT                   GLSQPSTQTTQYLRADTPNNATPITSYPTLRIEKNDLRSVTLLEAKAKVKDIAISRERI
FT                   TLKDVLQEGTFGRIFHGILVDEKDPNKEKQTFVKTVKDQASEVQVTMMLTESCKLRGLH
FT                   HRNLLPITHVCIEEGEKPMVVLPYMNWGNLKLFLRQCKLVEANNPQAISQQDLVHMAIQ
FT                   IACGMSYLARREVIHRDLAARNCVIDDTLQVKITDNALSRDLFPMDYHCLGDNENRPVR
FT                   WMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPIN
FT                   CPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALGAYV"
FT   gene            13722438..13810098
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /note="gene_id=mCG1040582.3"
FT   mRNA            join(13722438..13722719,13760797..13760934,
FT                   13764252..13764414,13781930..13782157,13783250..13783348,
FT                   13784333..13784469,13786664..13786739,13787253..13787417,
FT                   13788481..13788670,13791029..13791194,13793554..13793717,
FT                   13796434..13796498,13798923..13799046,13799864..13800058,
FT                   13809843..13810029)
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 2a1, transcript variant mCT161074"
FT                   /note="gene_id=mCG1040582.3 transcript_id=mCT161074.2
FT                   created on 11-JUL-2002"
FT   mRNA            join(13722438..13722719,13760797..13760934,
FT                   13764252..13764414,13781930..13782157,13783250..13783348,
FT                   13784333..13784469,13786664..13786739,13787253..13787417,
FT                   13788481..13788670,13791029..13791194,13793554..13793717,
FT                   13796434..13796498,13798923..13799046,13799864..13802372)
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 2a1, transcript variant mCT117130"
FT                   /note="gene_id=mCG1040582.3 transcript_id=mCT117130.1
FT                   created on 11-JUL-2002"
FT   mRNA            join(<13722503..13722719,13760797..13760934,
FT                   13764252..13764414,13781930..13782157,13783250..13783348,
FT                   13784333..13784469,13786664..13786739,13787253..13787417,
FT                   13791029..13791194,13793554..13793717,13796434..13796498,
FT                   13798923..13799046,13799864..13800058,13809843..13810098)
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 2a1, transcript variant mCT191506"
FT                   /note="gene_id=mCG1040582.3 transcript_id=mCT191506.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<13722570..13722719,13760797..13760934,
FT                   13764252..13764414,13781930..13782157,13783250..13783348,
FT                   13784333..13784469,13786664..13786739,13787253..13787417,
FT                   13791029..13791171)
FT                   /codon_start=1
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 2a1, isoform CRA_b"
FT                   /note="gene_id=mCG1040582.3 transcript_id=mCT191506.0
FT                   protein_id=mCP112462.0 isoform=CRA_b"
FT                   /protein_id="EDL21062.1"
FT                   /translation="PRPVATTLARSGDVASVTMGLLPKPGARQGSGTSSVPARRCSRSV
FT                   FNNIKVFVLCHGLLQLCQLLYSAYFKSSLTTIEKRFGLSSSSSGLISSLNEISNAILII
FT                   FVSYFGSRVNRPRMIGIGGLLLAAGAFVLTLPHFLSEPYQYASTTAGNSSHFQTDLCQK
FT                   HLPGLLPSKCHSTVPDTQKETSSMWSLMVVAQLLAGVGTVPIQPFGISYVDDFAEPTNS
FT                   PLYISILFAIAVFGPAFGYLLGSVMLRIFVDYGRVDTATVNLSPGDPRWIGAWWLGLLI
FT                   SSGFLIVTSLPFFFFPRAMSRGAERSVIAEETMKMEEDKSRGSLMDFIKRFPRIFLRLL
FT                   MNPLFMLVVLSQCTFSSVIAGLSTFLNKFLEKQYDASAAYANLLIAHQVLYIRSLPPAA
FT                   GTACAQIPSSTLSAETMESSTSPPAMLAAAAST"
FT   CDS             join(13722624..13722719,13760797..13760934,
FT                   13764252..13764414,13781930..13782157,13783250..13783348,
FT                   13784333..13784469,13786664..13786739,13787253..13787417,
FT                   13788481..13788670,13791029..13791194,13793554..13793717,
FT                   13796434..13796498,13798923..13799046,13799864..13799984)
FT                   /codon_start=1
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 2a1, isoform CRA_a"
FT                   /note="gene_id=mCG1040582.3 transcript_id=mCT117130.1
FT                   protein_id=mCP68753.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TED0"
FT                   /db_xref="InterPro:IPR002350"
FT                   /db_xref="InterPro:IPR004156"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1346021"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TED0"
FT                   /protein_id="EDL21061.1"
FT                   /translation="MGLLPKPGARQGSGTSSVPARRCSRSVFNNIKVFVLCHGLLQLCQ
FT                   LLYSAYFKSSLTTIEKRFGLSSSSSGLISSLNEISNAILIIFVSYFGSRVNRPRMIGIG
FT                   GLLLAAGAFVLTLPHFLSEPYQYASTTAGNSSHFQTDLCQKHLPGLLPSKCHSTVPDTQ
FT                   KETSSMWSLMVVAQLLAGVGTVPIQPFGISYVDDFAEPTNSPLYISILFAIAVFGPAFG
FT                   YLLGSVMLRIFVDYGRVDTATVNLSPGDPRWIGAWWLGLLISSGFLIVTSLPFFFFPRA
FT                   MSRGAERSVIAEETMKMEEDKSRGSLMDFIKRFPRIFLRLLMNPLFMLVVLSQCTFSSV
FT                   IAGLSTFLNKFLEKQYDASAAYANLLIGAVNLPAAALGMLFGGILMKRFVFPLQTIPRV
FT                   AATIMTISIILCAPLFFMGCSTPAVAEVYPPSTPSSIHPQPPACRRDCLCPDSVFHPVC
FT                   GDNGVEYLSPCHAGCSSLNVSSAASKQPIYLNCSCVTGGSASAKTGSCPTSCAQLLLPS
FT                   IFLISFVALIACVSHNPLYMMVLRVVNQDEKSFAIGVQFLLMRLLAWLPSPSLYGLLID
FT                   SSCIRWNYLCSGRRGACAYYDNDALRNRYLGLQVIYKVLGTLLLFFISWRVKKNREYSL
FT                   QENASGLI"
FT   CDS             join(13722624..13722719,13760797..13760934,
FT                   13764252..13764414,13781930..13782157,13783250..13783348,
FT                   13784333..13784469,13786664..13786739,13787253..13787417,
FT                   13788481..13788670,13791029..13791194,13793554..13793717,
FT                   13796434..13796498,13798923..13799046,13799864..13799984)
FT                   /codon_start=1
FT                   /gene="Slco2a1"
FT                   /locus_tag="mCG_1040582"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 2a1, isoform CRA_a"
FT                   /note="gene_id=mCG1040582.3 transcript_id=mCT161074.2
FT                   protein_id=mCP90082.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TED0"
FT                   /db_xref="InterPro:IPR002350"
FT                   /db_xref="InterPro:IPR004156"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1346021"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TED0"
FT                   /protein_id="EDL21063.1"
FT                   /translation="MGLLPKPGARQGSGTSSVPARRCSRSVFNNIKVFVLCHGLLQLCQ
FT                   LLYSAYFKSSLTTIEKRFGLSSSSSGLISSLNEISNAILIIFVSYFGSRVNRPRMIGIG
FT                   GLLLAAGAFVLTLPHFLSEPYQYASTTAGNSSHFQTDLCQKHLPGLLPSKCHSTVPDTQ
FT                   KETSSMWSLMVVAQLLAGVGTVPIQPFGISYVDDFAEPTNSPLYISILFAIAVFGPAFG
FT                   YLLGSVMLRIFVDYGRVDTATVNLSPGDPRWIGAWWLGLLISSGFLIVTSLPFFFFPRA
FT                   MSRGAERSVIAEETMKMEEDKSRGSLMDFIKRFPRIFLRLLMNPLFMLVVLSQCTFSSV
FT                   IAGLSTFLNKFLEKQYDASAAYANLLIGAVNLPAAALGMLFGGILMKRFVFPLQTIPRV
FT                   AATIMTISIILCAPLFFMGCSTPAVAEVYPPSTPSSIHPQPPACRRDCLCPDSVFHPVC
FT                   GDNGVEYLSPCHAGCSSLNVSSAASKQPIYLNCSCVTGGSASAKTGSCPTSCAQLLLPS
FT                   IFLISFVALIACVSHNPLYMMVLRVVNQDEKSFAIGVQFLLMRLLAWLPSPSLYGLLID
FT                   SSCIRWNYLCSGRRGACAYYDNDALRNRYLGLQVIYKVLGTLLLFFISWRVKKNREYSL
FT                   QENASGLI"
FT   gene            13826077..13899649
FT                   /gene="Rab6b"
FT                   /locus_tag="mCG_16153"
FT                   /note="gene_id=mCG16153.2"
FT   mRNA            join(13826077..13826354,13854911..13854969,
FT                   13875192..13875245,13875436..13875541,13876913..13877024,
FT                   13878189..13878282,13881485..13881551,13895563..13899649)
FT                   /gene="Rab6b"
FT                   /locus_tag="mCG_16153"
FT                   /product="RAB6B, member RAS oncogene family"
FT                   /note="gene_id=mCG16153.2 transcript_id=mCT15896.2 created
FT                   on 16-SEP-2002"
FT   CDS             join(13826285..13826354,13854911..13854969,
FT                   13875192..13875245,13875436..13875541,13876913..13877024,
FT                   13878189..13878282,13881485..13881551,13895563..13895627)
FT                   /codon_start=1
FT                   /gene="Rab6b"
FT                   /locus_tag="mCG_16153"
FT                   /product="RAB6B, member RAS oncogene family"
FT                   /note="gene_id=mCG16153.2 transcript_id=mCT15896.2
FT                   protein_id=mCP21219.2"
FT                   /db_xref="GOA:Q0PD53"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:107283"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PD53"
FT                   /protein_id="EDL21064.1"
FT                   /translation="MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQAT
FT                   IGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQT
FT                   SKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEEGEQRAKELSVMFIETSAKTGYNV
FT                   KQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCSC"
FT   gene            complement(13902382..13916408)
FT                   /gene="Srprb"
FT                   /locus_tag="mCG_16157"
FT                   /note="gene_id=mCG16157.2"
FT   mRNA            complement(join(13902382..13904623,13905271..13905325,
FT                   13906416..13906552,13911802..13911884,13913053..13913130,
FT                   13915558..13915652,13916183..13916408))
FT                   /gene="Srprb"
FT                   /locus_tag="mCG_16157"
FT                   /product="signal recognition particle receptor, B subunit"
FT                   /note="gene_id=mCG16157.2 transcript_id=mCT16044.2 created
FT                   on 11-JUL-2002"
FT   CDS             complement(join(13904410..13904623,13905271..13905325,
FT                   13906416..13906552,13911802..13911884,13913053..13913130,
FT                   13915558..13915652,13916183..13916330))
FT                   /codon_start=1
FT                   /gene="Srprb"
FT                   /locus_tag="mCG_16157"
FT                   /product="signal recognition particle receptor, B subunit"
FT                   /note="gene_id=mCG16157.2 transcript_id=mCT16044.2
FT                   protein_id=mCP21240.2"
FT                   /protein_id="EDL21065.1"
FT                   /translation="MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVALLAV
FT                   LLTLVFWKFIWSRKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVN
FT                   NNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLID
FT                   SMALKNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQ
FT                   LGKKGKEFEFSQLPLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA"
FT   gene            complement(13923141..13944785)
FT                   /gene="Trf"
FT                   /locus_tag="mCG_16156"
FT                   /note="gene_id=mCG16156.2"
FT   mRNA            complement(join(13923141..13923342,13924730..13924913,
FT                   13926047..13926231,13929428..13929492,13930049..13930178,
FT                   13931602..13931772,13933472..13933504,13934051..13934141,
FT                   13935142..13935293,13936300..13936477,13937186..13937364,
FT                   13937835..13937890,13939294..13939426,13940214..13940390,
FT                   13941091..13941199,13942149..13942321,13944430..13944785))
FT                   /gene="Trf"
FT                   /locus_tag="mCG_16156"
FT                   /product="transferrin"
FT                   /note="gene_id=mCG16156.2 transcript_id=mCT16045.2 created
FT                   on 19-JUL-2002"
FT   CDS             complement(join(13923308..13923342,13924730..13924913,
FT                   13926047..13926231,13929428..13929492,13930049..13930178,
FT                   13931602..13931772,13933472..13933504,13934051..13934141,
FT                   13935142..13935293,13936300..13936477,13937186..13937364,
FT                   13937835..13937890,13939294..13939426,13940214..13940390,
FT                   13941091..13941199,13942149..13942321,13944430..13944472))
FT                   /codon_start=1
FT                   /gene="Trf"
FT                   /locus_tag="mCG_16156"
FT                   /product="transferrin"
FT                   /note="gene_id=mCG16156.2 transcript_id=mCT16045.2
FT                   protein_id=mCP21269.2"
FT                   /protein_id="EDL21066.1"
FT                   /translation="MRLTVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHM
FT                   KTVLPPDGPRLACVKKTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFY
FT                   GSVEHPQTYYYAVAVVKKGTDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRS
FT                   PLEKAVSSFFSGSCVPCADPVAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVA
FT                   FVKHTTIFEVLPEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKEDL
FT                   IWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVT
FT                   AIRNQQEGVCPEGSIDNSPVKWCALSHLERTKCDEWSIISEGKIECESAETTEDCIEKI
FT                   VNGEADAMTLDGGHAYIAGQCGLVPVMAEYYESSNCAIPSQQGIFPKGYYAVAVVKASD
FT                   TSITWNNLKGKKSCHTGVDRTAGWNIPMGMLYNRINHCKFDEFFSQGCAPGYEKNSTLC
FT                   DLCIGPLKCAPNNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLDNTEGKNPAEWAKNLKQ
FT                   EDFELLCPDGTRKPVKDFASCHLAQAPNHVVVSRKEKAARVKAVLTSQETLFGGSDCTG
FT                   NFCLFKSTTKDLLFRDDTKCFVKLPEGTTPEKYLGAEYMQSVGNMRKCSTSRLLEACTF
FT                   HKH"
FT   gene            complement(13964782..14003187)
FT                   /gene="1300017J02Rik"
FT                   /locus_tag="mCG_16155"
FT                   /note="gene_id=mCG16155.2"
FT   mRNA            complement(join(13964782..13964923,13966052..13966238,
FT                   13968901..13969085,13970831..13970895,13973636..13973777,
FT                   13977287..13977442,13980460..13980516,13981889..13981979,
FT                   13982569..13982711,13983869..13984040,13986744..13986922,
FT                   13988969..13989024,13991484..13991631,13993407..13993568,
FT                   13995069..13995177,13996579..13996751,14003062..14003187))
FT                   /gene="1300017J02Rik"
FT                   /locus_tag="mCG_16155"
FT                   /product="RIKEN cDNA 1300017J02"
FT                   /note="gene_id=mCG16155.2 transcript_id=mCT16043.2 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(13964889..13964923,13966052..13966238,
FT                   13968901..13969085,13970831..13970895,13973636..13973777,
FT                   13977287..13977442,13980460..13980516,13981889..13981979,
FT                   13982569..13982711,13983869..13984040,13986744..13986922,
FT                   13988969..13989024,13991484..13991631,13993407..13993568,
FT                   13995069..13995177,13996579..13996751,14003062..14003104))
FT                   /codon_start=1
FT                   /gene="1300017J02Rik"
FT                   /locus_tag="mCG_16155"
FT                   /product="RIKEN cDNA 1300017J02"
FT                   /note="gene_id=mCG16155.2 transcript_id=mCT16043.2
FT                   protein_id=mCP21252.2"
FT                   /protein_id="EDL21067.1"
FT                   /translation="MRLLICALLCLGTLGLCLALPEKTIRWCVVSDHEATKCSSFRDNM
FT                   KKVLPAGGPAVTCVRKMSHPECIRDISANKVDAVTVDGALVAEADLPHHSLKPIMAEYY
FT                   GSKDDPKTHYYVVAMAKKGTGFQLNQLRGKKSCHTGLGWSAGWYVPLSTLLPSGSRETA
FT                   AATFFSSSCVPCADGKMFPSLCQLCAGKGTDKCACSSREPYFGSWGALKCLQDGTADVS
FT                   FVKHLTVFEAMPTKADRDQYELLCMDNTRRPVEEYEQCYLARVPSHVVVARSVDGKEDS
FT                   IQELLRVAQEHFGKDKSSPFQLFGSPHGEDLLFTDAAHGLLRVPRKMDISLYLGYEFLS
FT                   AFRNLKRGLEDSQRVKWCAVGQQERTKCDQWSAVSGGALACATEETPEDCIAATMKGEA
FT                   DAMSLDGGFAYVAGHCGLVPVLAENYLSTHSSGRLGSKCVNAPLEGYYVVAVVKKSDVG
FT                   ITWKSLQGKKSCHTAVGTSEGWNVPMGLIYNQTGSCKFDAFFSRSCAPGSDPDSPLCAL
FT                   CVGGNNPAHMCAANNAEGYHGSSGALRCLVEKGDVAFMKHPTVLQNTDGKNPEPWAKGL
FT                   KHEDFELLCLDGTRKPVTEAQSCHLARVPNRAVFSRKDKADFVRRILFNQQELFGRNGF
FT                   EYMMFQMFESSAKDLLFSDDTECLSNLQNKTTYKTYLGPQYLTLMDNFRQCLSSELLDA
FT                   CTFHKY"
FT   gene            14017643..14065196
FT                   /gene="Topbp1"
FT                   /locus_tag="mCG_16151"
FT                   /note="gene_id=mCG16151.2"
FT   mRNA            join(14017643..14017823,14018549..14018639,
FT                   14021183..14021317,14022255..14022398,14023960..14024141,
FT                   14025238..14025434,14027515..14027691,14030437..14030603,
FT                   14032619..14032782,14032924..14033171,14035718..14036076,
FT                   14036777..14036949,14038052..14038263,14040818..14041104,
FT                   14045094..14045264,14045354..14045463,14046465..14046588,
FT                   14050686..14050832,14050938..14051040,14053055..14053247,
FT                   14056692..14056912,14058312..14058460,14058689..14058800,
FT                   14059554..14059717,14060505..14060642,14061447..14061536,
FT                   14061690..14061851,14064551..14065196)
FT                   /gene="Topbp1"
FT                   /locus_tag="mCG_16151"
FT                   /product="topoisomerase (DNA) II beta binding protein"
FT                   /note="gene_id=mCG16151.2 transcript_id=mCT15895.2 created
FT                   on 02-AUG-2002"
FT   CDS             join(14018556..14018639,14021183..14021317,
FT                   14022255..14022398,14023960..14024141,14025238..14025434,
FT                   14027515..14027691,14030437..14030603,14032619..14032782,
FT                   14032924..14033171,14035718..14036076,14036777..14036949,
FT                   14038052..14038263,14040818..14041104,14045094..14045264,
FT                   14045354..14045463,14046465..14046588,14050686..14050832,
FT                   14050938..14051040,14053055..14053247,14056692..14056912,
FT                   14058312..14058460,14058689..14058800,14059554..14059717,
FT                   14060505..14060642,14061447..14061536,14061690..14061851,
FT                   14064551..14064685)
FT                   /codon_start=1
FT                   /gene="Topbp1"
FT                   /locus_tag="mCG_16151"
FT                   /product="topoisomerase (DNA) II beta binding protein"
FT                   /note="gene_id=mCG16151.2 transcript_id=mCT15895.2
FT                   protein_id=mCP21355.2"
FT                   /protein_id="EDL21068.1"
FT                   /translation="MSRNDQEPFLVKFLKSSDNSECFFKALESIKELQSEDYLQIITDE
FT                   EALKIRENDKSLYICDRFSGTVFDHLKQLGCRIVGPQVVTFCMRHQQCVPRAEHPVYNM
FT                   IMSDVTVSCTSLDKDKREEVHKYVQMMGGRVYRDLNVSVTHLIAGEVGSKKYLVAANLK
FT                   KPILLPSWIKTLWEKSQEKKITKYTDVNMEDFKCPIFLGCIICVTGLNGIHRKTVQQLT
FT                   AKHGGQYMGQLKMNECTHLIVQEPKGQKYECARRWNVHCVTLQWFHDSIEKGFCQDESI
FT                   YKAETRVEAKMVPDTSTPTAQSNAESHTLADVSHISNINGSCVNETMFGSTTSKLECSL
FT                   ENLENLDISMFQAPEDLLDGCRIYLCGFSGRKLDKLRRLINSGGGVRFNQLNEDVTHVI
FT                   VGDYDDDVRQFWSKSSHRPHVVGAKWLLECFTKGYILPEESYIHTNYQPAGIAVSDQPG
FT                   NQTAVLDKSGSFSKSALVPAERLQQADEDLLAQYGNDDSTMVEAKLSEALEPEVGPCPG
FT                   SAHREPCDDSTHISVQEENKSSVSHCILDDSTVREEGLFSQKSFLVLGFSVENKCNIVD
FT                   IIREHAGKIVSLPSRIVADYAVVPLLGCEVDVTVGEVVTNTWLVTCIDNQTLVDPKSNP
FT                   LFTPVSVMSGVTPLEDCVISFSQCVGAERDSLVFLANHLGASVQEFFVRKANAKKGMLA
FT                   STHLIVKEPTGSKYEAAKKWSLPAVNISWLLETARIGKRADENHFLVDNAPKQEQVLET
FT                   KIPNGVSSNPDLPAHPDAHLEIHRKKAVTPLDMNRFQSRAFRAVISQQRGQDPTFPPVR
FT                   QPLTKEPSLHLDTPSKFLSKDKLFKPSFDVTDALAALETPNAASQKRKLSSPLSEVIVR
FT                   NLTVALANSSRNTDSHSASPQLKGAHLEEEETRKPLDSVVVCVSKKLSKKQSELNGVAA
FT                   SLGAEYRWSFDETVTHFIYQGRANDSNREYKSAKERGVHIVSEHWLLECAQEYKHLPES
FT                   LYPHTYNPKMSLDINTVQDGRLCNSRAPLAVSASKDDGPDHLSVEGNETNTMGTNDKES
FT                   PLLNGSGRDDCKGALTQALEMRENFQKQLQEIMSATCIVKTPAQKTCMSRSSCNSASST
FT                   PDSARSVRSGRSRVLEALRQSRQAVPDVNTEPSQNEQIIWDDPTAREERARLASNLQWP
FT                   SDPTQHSELQVEIKMPDDSPSRKPVYHSEIAEQASCVTQAPGHPGSEEPEPPVAERPLI
FT                   PEPQAPAVASPLAKPPVAPQPADKIETQEETHRKVKKQYVFQMSSLNSQERIDYCRLIK
FT                   DLGGSVIEKQCSDPSCTHMVVGYPLRNEKYLASMAAGKWVLHRSYLDACKTAGRFVQEE
FT                   DYEWGSSSILDALPDVTEHQQKLALAAMRWRKRIQQSQESGIVEGAFSGWKAILRVDRP
FT                   REAGFKRLLQAGGAKVLSGHPEPLLKDATHLFCDFNKLKPDDCRVFIAEATAQNMVCLK
FT                   TEYIADYLMLESPPCADNYRVSEAALFHNKKGGPGLPQKRKTPAENVVKRPRVH"
FT   gene            complement(14067871..14080348)
FT                   /gene="Cdv3"
FT                   /locus_tag="mCG_115601"
FT                   /note="gene_id=mCG115601.0"
FT   mRNA            complement(join(14067871..14070082,14071049..14071208,
FT                   14074641..14074783,14078743..14078819,14079818..14080348))
FT                   /gene="Cdv3"
FT                   /locus_tag="mCG_115601"
FT                   /product="carnitine deficiency-associated gene expressed in
FT                   ventricle 3, transcript variant mCT116709"
FT                   /note="gene_id=mCG115601.0 transcript_id=mCT116709.1
FT                   created on 02-AUG-2002"
FT   mRNA            complement(join(14067877..14070798,14071049..14071208,
FT                   14074641..14074783,14078743..14078819,14079818..14080348))
FT                   /gene="Cdv3"
FT                   /locus_tag="mCG_115601"
FT                   /product="carnitine deficiency-associated gene expressed in
FT                   ventricle 3, transcript variant mCT171371"
FT                   /note="gene_id=mCG115601.0 transcript_id=mCT171371.0
FT                   created on 02-AUG-2002"
FT   CDS             complement(join(14069932..14070082,14071049..14071208,
FT                   14074641..14074783,14078743..14078819,14079818..14080045))
FT                   /codon_start=1
FT                   /gene="Cdv3"
FT                   /locus_tag="mCG_115601"
FT                   /product="carnitine deficiency-associated gene expressed in
FT                   ventricle 3, isoform CRA_a"
FT                   /note="gene_id=mCG115601.0 transcript_id=mCT116709.1
FT                   protein_id=mCP68833.1 isoform=CRA_a"
FT                   /protein_id="EDL21069.1"
FT                   /translation="MAETEERSLDNFFAKRDKKKKKERSSRAANAASGAGGSSAAAGSR
FT                   PGDGGSLGSGARSGDGGSLGSGSRSGDGGSSDENEWKEFEQREVDYSGLRVQAMQISEK
FT                   EDDDNEKREDPGDNWEEGGGGSGAEKSSGPWNKTAPVQAPPAPVTVTETPEPAMPSGVY
FT                   RPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRKDKEMEKSFEVVRHKNRDRE
FT                   EVSKNQALKLQLDNQYAVLENQKYSHTQYS"
FT   CDS             complement(join(14070783..14070798,14071049..14071208,
FT                   14074641..14074783,14078743..14078819,14079818..14080045))
FT                   /codon_start=1
FT                   /gene="Cdv3"
FT                   /locus_tag="mCG_115601"
FT                   /product="carnitine deficiency-associated gene expressed in
FT                   ventricle 3, isoform CRA_b"
FT                   /note="gene_id=mCG115601.0 transcript_id=mCT171371.0
FT                   protein_id=mCP94290.0 isoform=CRA_b"
FT                   /protein_id="EDL21070.1"
FT                   /translation="MAETEERSLDNFFAKRDKKKKKERSSRAANAASGAGGSSAAAGSR
FT                   PGDGGSLGSGARSGDGGSLGSGSRSGDGGSSDENEWKEFEQREVDYSGLRVQAMQISEK
FT                   EDDDNEKREDPGDNWEEGGGGSGAEKSSGPWNKTAPVQAPPAPVTVTETPEPAMPSGVY
FT                   RPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRNRYLK"
FT   gene            14095796..14115289
FT                   /locus_tag="mCG_1032900"
FT                   /note="gene_id=mCG1032900.0"
FT   mRNA            join(14095796..14095894,14114938..14115289)
FT                   /locus_tag="mCG_1032900"
FT                   /product="mCG1032900"
FT                   /note="gene_id=mCG1032900.0 transcript_id=mCT150604.1
FT                   created on 02-AUG-2002"
FT   CDS             14114969..14115193
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032900"
FT                   /product="mCG1032900"
FT                   /note="gene_id=mCG1032900.0 transcript_id=mCT150604.1
FT                   protein_id=mCP68897.1"
FT                   /protein_id="EDL21071.1"
FT                   /translation="MKAFPSQKRELYPRSNSYPRSPLHPGQAKPCPCHGGRLKAKSVGA
FT                   QPFHLYNGAAQGYLVDFCLQSWCKDLSLK"
FT   gene            complement(14127103..14137933)
FT                   /locus_tag="mCG_1032901"
FT                   /note="gene_id=mCG1032901.1"
FT   mRNA            complement(join(14127103..14127700,14137860..14137933))
FT                   /locus_tag="mCG_1032901"
FT                   /product="mCG1032901"
FT                   /note="gene_id=mCG1032901.1 transcript_id=mCT150605.1
FT                   created on 02-AUG-2002"
FT   CDS             complement(14127207..14127641)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032901"
FT                   /product="mCG1032901"
FT                   /note="gene_id=mCG1032901.1 transcript_id=mCT150605.1
FT                   protein_id=mCP68503.1"
FT                   /protein_id="EDL21072.1"
FT                   /translation="MRKTVPFSTLSTCGCVSAKARREKRELFPEAPPLDDQGSHPGSLW
FT                   CQVALEELHLCVFSGNEFSCQLHKPRGGSQCSTPLGTLLTARAMYSTPASLLLETAPAP
FT                   EVLVDRKSIVCRSASQWLRGKEKTKHSVQECKCGKKNIYI"
FT   gene            complement(14139643..14195935)
FT                   /gene="Bfsp2"
FT                   /locus_tag="mCG_16146"
FT                   /note="gene_id=mCG16146.2"
FT   mRNA            complement(join(14139643..14139865,14141278..14141498,
FT                   14147557..14147688,14163502..14163663,14164746..14164902,
FT                   14168010..14168092,14195251..14195935))
FT                   /gene="Bfsp2"
FT                   /locus_tag="mCG_16146"
FT                   /product="beaded filament structural protein 2, phakinin,
FT                   transcript variant mCT15890"
FT                   /note="gene_id=mCG16146.2 transcript_id=mCT15890.2 created
FT                   on 02-AUG-2002"
FT   mRNA            complement(join(14139643..14139865,14141278..14141498,
FT                   14147557..14147688,14163502..14163663,14164002..14164037))
FT                   /gene="Bfsp2"
FT                   /locus_tag="mCG_16146"
FT                   /product="beaded filament structural protein 2, phakinin,
FT                   transcript variant mCT171384"
FT                   /note="gene_id=mCG16146.2 transcript_id=mCT171384.0 created
FT                   on 02-AUG-2002"
FT   CDS             complement(join(14139862..14139865,14141278..14141498,
FT                   14147557..14147688,14163502..14163663,14164746..14164902,
FT                   14168010..14168092,14195251..14195868))
FT                   /codon_start=1
FT                   /gene="Bfsp2"
FT                   /locus_tag="mCG_16146"
FT                   /product="beaded filament structural protein 2, phakinin,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16146.2 transcript_id=mCT15890.2
FT                   protein_id=mCP21391.2 isoform=CRA_a"
FT                   /protein_id="EDL21073.1"
FT                   /translation="MEGSRQRTRDREASREAHDQAGAGNQKPLDPVNLPGTTEAERMSK
FT                   RRVAADLPSGTNSSMPVQRHRVSSLRGTHSPSSLDSPPASRTSAVGSLVRAPGVYVGVA
FT                   PSGGIGGLGARVTRRALGISSVFLQGLRSSGLANVPAPGPERDHTTVEDLGGCLVEYMT
FT                   KVHALEQVSQELETQLRAHLESKAKSSGGWDALRASWASSYQQVGEAVLENARLLLQME
FT                   TIQAGADDFKERYENEQPFRKAAEEEVSSLYKVIDEANLTKTDLEHQIESLKEELGFLS
FT                   RSYEEDVKVLYKQLAGSELEQADVPMGTGLDDVLETIRVQWERDVEKNRAEAGALLQAK
FT                   QQTEVVHVSQTQEEKLAAALSVELHDTSRQVQSLQAETESLRALKRGLENSLHDAQHWH
FT                   DMELQNLGAVVGRLEAELAEIRSETEQQQQERAHLLACKSQLQKDVASYHALLDREENN
FT                   "
FT   CDS             complement(join(14139862..14139865,14141278..14141498,
FT                   14147557..14147688,14163502..14163603))
FT                   /codon_start=1
FT                   /gene="Bfsp2"
FT                   /locus_tag="mCG_16146"
FT                   /product="beaded filament structural protein 2, phakinin,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16146.2 transcript_id=mCT171384.0
FT                   protein_id=mCP94303.0 isoform=CRA_b"
FT                   /protein_id="EDL21074.1"
FT                   /translation="MGTGLDDVLETIRVQWERDVEKNRAEAGALLQAKQQTEVVHVSQT
FT                   QEEKLAAALSVELHDTSRQVQSLQAETESLRALKRGLENSLHDAQHWHDMELQNLGAVV
FT                   GRLEAELAEIRSETEQQQQERAHLLACKSQLQKDVASYHALLDREENN"
FT   gene            <14141393..14176217
FT                   /locus_tag="mCG_145984"
FT                   /note="gene_id=mCG145984.0"
FT   mRNA            join(<14141393..14141536,14141871..14142107,
FT                   14142419..14142517,14143128..14143236,14174776..14176217)
FT                   /locus_tag="mCG_145984"
FT                   /product="mCG145984"
FT                   /note="gene_id=mCG145984.0 transcript_id=mCT186092.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<14141879..14142107,14142419..14142517,
FT                   14143128..14143171)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145984"
FT                   /product="mCG145984"
FT                   /note="gene_id=mCG145984.0 transcript_id=mCT186092.0
FT                   protein_id=mCP107616.0"
FT                   /protein_id="EDL21075.1"
FT                   /translation="LSDHDSCIGTSGADVYVGYGCFGWGSWEKMHPRLPFLSSRPWMDR
FT                   VPAFTPPVKLSHPHCLFSPNTVAWDWMFITQDRVSLYSSGHLLCRPDWLRTHRAPSACQ
FT                   AAGMKEAHRGQKRHWNPWN"
FT   gene            14187605..>14208545
FT                   /locus_tag="mCG_1051020"
FT                   /note="gene_id=mCG1051020.0"
FT   mRNA            join(14187605..14187687,14188264..14188467,
FT                   14207715..14207878,14208141..>14208545)
FT                   /locus_tag="mCG_1051020"
FT                   /product="mCG1051020"
FT                   /note="gene_id=mCG1051020.0 transcript_id=mCT194809.0
FT                   created on 27-JAN-2005"
FT   gene            complement(14198452..>14223039)
FT                   /locus_tag="mCG_16148"
FT                   /note="gene_id=mCG16148.2"
FT   mRNA            complement(join(14198452..14200299,14204804..14204958,
FT                   14214626..14214837,14215181..14216176,14222982..>14223039))
FT                   /locus_tag="mCG_16148"
FT                   /product="mCG16148"
FT                   /note="gene_id=mCG16148.2 transcript_id=mCT15892.2 created
FT                   on 02-AUG-2002"
FT   CDS             14208470..>14208545
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051020"
FT                   /product="mCG1051020"
FT                   /note="gene_id=mCG1051020.0 transcript_id=mCT194809.0
FT                   protein_id=mCP115838.0"
FT                   /protein_id="EDL21076.1"
FT                   /translation="MRSLLGSLYSSRLPPTQQKHADVVP"
FT   CDS             complement(join(14215548..14216176,14222982..14223039))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16148"
FT                   /product="mCG16148"
FT                   /note="gene_id=mCG16148.2 transcript_id=mCT15892.2
FT                   protein_id=mCP21221.2"
FT                   /protein_id="EDL21077.1"
FT                   /translation="MDLSPAVEPVISGHFWNPPGFLLTLALTKALVLAVHEPSPRESLQ
FT                   TLPSGSPPGTMVTAPHSPTRLSSVLTLNPTPDGPSSQAAATLETTVSHPEGHPPTDTTS
FT                   TVMGTAAVPHPESPLPTGSPPAAMTTTPSHSESLPPGGCYPHHYPANKASRNHQPPHSG
FT                   PTGHHSSAPQTPGLFQEGGWWFDSHSHTRTGWPLGQEGKPEGTKPELSTSGAEASSGED
FT                   LPNLQG"
FT   gene            14237723..>14259191
FT                   /locus_tag="mCG_1032902"
FT                   /note="gene_id=mCG1032902.1"
FT   mRNA            join(14237723..14238033,14256839..14256950,
FT                   14258998..>14259191)
FT                   /locus_tag="mCG_1032902"
FT                   /product="mCG1032902"
FT                   /note="gene_id=mCG1032902.1 transcript_id=mCT150606.1
FT                   created on 02-AUG-2002"
FT   CDS             14259064..>14259191
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032902"
FT                   /product="mCG1032902"
FT                   /note="gene_id=mCG1032902.1 transcript_id=mCT150606.1
FT                   protein_id=mCP68505.1"
FT                   /protein_id="EDL21078.1"
FT                   /translation="MRLLGGSCDPGRGREGEGCGDSCFQLDWLIKSVFGSYQRTKHR"
FT   gene            14272361..14279077
FT                   /locus_tag="mCG_1032760"
FT                   /note="gene_id=mCG1032760.1"
FT   mRNA            join(14272361..14272695,14275554..14275632,
FT                   14278798..14279077)
FT                   /locus_tag="mCG_1032760"
FT                   /product="mCG1032760"
FT                   /note="gene_id=mCG1032760.1 transcript_id=mCT150464.1
FT                   created on 02-AUG-2002"
FT   CDS             join(14272588..14272695,14275554..14275632,
FT                   14278798..14278847)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032760"
FT                   /product="mCG1032760"
FT                   /note="gene_id=mCG1032760.1 transcript_id=mCT150464.1
FT                   protein_id=mCP68507.1"
FT                   /protein_id="EDL21079.1"
FT                   /translation="MESLEVRKEYMNWHWEPSTAYPKLRAPENPLFSKFMAASSGKDLV
FT                   SILLLFLQQKSVHHLWRTIASHWNGSTHQLHKT"
FT   gene            complement(14470267..14477955)
FT                   /locus_tag="mCG_56775"
FT                   /note="gene_id=mCG56775.2"
FT   mRNA            complement(join(14470267..14471188,14477919..14477955))
FT                   /locus_tag="mCG_56775"
FT                   /product="mCG56775"
FT                   /note="gene_id=mCG56775.2 transcript_id=mCT56958.2 created
FT                   on 02-AUG-2002"
FT   CDS             complement(14470992..14471129)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56775"
FT                   /product="mCG56775"
FT                   /note="gene_id=mCG56775.2 transcript_id=mCT56958.2
FT                   protein_id=mCP41333.2"
FT                   /protein_id="EDL21080.1"
FT                   /translation="MGCEDVRSSEGFHTLSSRVRQMRSVSLASLSHRCSCLSRVLELVQ
FT                   "
FT   gene            14604371..14604756
FT                   /pseudo
FT                   /locus_tag="mCG_1032776"
FT                   /note="gene_id=mCG1032776.1"
FT   mRNA            14604371..14604756
FT                   /pseudo
FT                   /locus_tag="mCG_1032776"
FT                   /note="gene_id=mCG1032776.1 transcript_id=mCT150480.1
FT                   created on 02-AUG-2002"
FT   gene            14719058..14733280
FT                   /locus_tag="mCG_140767"
FT                   /note="gene_id=mCG140767.0"
FT   mRNA            join(14719058..14719673,14721226..14721351,
FT                   14721969..14722119,14724632..14724784,14728112..14728199,
FT                   14731764..14731920,14732517..14732638,14732837..14733280)
FT                   /locus_tag="mCG_140767"
FT                   /product="mCG140767"
FT                   /note="gene_id=mCG140767.0 transcript_id=mCT171367.0
FT                   created on 02-AUG-2002"
FT   CDS             join(14719293..14719673,14721226..14721351,
FT                   14721969..14722119,14724632..14724784,14728112..14728199,
FT                   14731764..14731920,14732517..14732638,14732837..14732840)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140767"
FT                   /product="mCG140767"
FT                   /note="gene_id=mCG140767.0 transcript_id=mCT171367.0
FT                   protein_id=mCP94286.0"
FT                   /protein_id="EDL21081.1"
FT                   /translation="MGTASSLVSPTGGEVIEDTYGAGGGEACEIPVEVKPKARLLRSSF
FT                   RRGAGAGPGSLPRAAGGGGLLGASFKSTGSSVPELEYAAAEFERLKKEYEIFRVSKNQE
FT                   LLSMGRREAKLDTENKRLRAELQALQKTYQKILREKEGALEAKYQAMERAVTFEHDRDR
FT                   VKRQFKIFRETKENEIQDLLRAKRELESKLQRLQAQGIQVFDPGESDSDDNCTDVTAAG
FT                   TQCEYWASRALGSEHSIGSMIQLPQPFRGPEFAHSSIDVEGPFANINRDVENQYLTVRK
FT                   WEIEKSSLVILFLHSTLPSFLLEDCEEAFLQNPEGKPGLIYHRLEDGKVTCDSVQQFLD
FT                   QVSNLGKTTKAKIIEHSGDPAEGVCKIYVGVEKIIKQVNMRFSVKFSSKIASW"
FT   gene            14734730..>14740220
FT                   /locus_tag="mCG_115611"
FT                   /note="gene_id=mCG115611.1"
FT   mRNA            join(14734730..14734903,14737416..14737519,
FT                   14737941..14738055,14739298..14739441,14740056..>14740220)
FT                   /locus_tag="mCG_115611"
FT                   /product="mCG115611"
FT                   /note="gene_id=mCG115611.1 transcript_id=mCT116719.1
FT                   created on 02-AUG-2002"
FT   CDS             join(14734850..14734903,14737416..14737519,
FT                   14737941..14738055,14739298..14739441,14740056..14740220)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115611"
FT                   /product="mCG115611"
FT                   /note="gene_id=mCG115611.1 transcript_id=mCT116719.1
FT                   protein_id=mCP68702.1"
FT                   /protein_id="EDL21082.1"
FT                   /translation="MEAFQQASSSAHELGFEKYYQRLDDLVVAPAPIPPLLVSGGPGSG
FT                   KSLLLSKWIQLQQKHFPNTLILSHFVGRPMSTSSESSLIIKRLTLKLMQHFWAVSALTL
FT                   DPAKLLEEFPHWLEKLSARHQGSIIIIIDSIDQVQQVEKHMKWLIDPLPVNVRVIVSVN
FT                   VETCPTAWRYGQIQKFQNRSCFTGQARKGS"
FT   gene            14746609..14760554
FT                   /locus_tag="mCG_16149"
FT                   /note="gene_id=mCG16149.2"
FT   mRNA            join(14746609..14746703,14748595..14748759,
FT                   14750027..14750121,14751074..14751196,14752402..14752588,
FT                   14752735..14752976,14754058..14754133,14755161..14755288,
FT                   14756060..14756300,14757348..14757473,14757865..14757980,
FT                   14758677..14760554)
FT                   /locus_tag="mCG_16149"
FT                   /product="mCG16149"
FT                   /note="gene_id=mCG16149.2 transcript_id=mCT15893.2 created
FT                   on 02-AUG-2002"
FT   CDS             join(14746668..14746703,14748595..14748759,
FT                   14750027..14750121,14751074..14751196,14752402..14752588,
FT                   14752735..14752976,14754058..14754133,14755161..14755288,
FT                   14756060..14756300,14757348..14757473,14757865..14757980,
FT                   14758677..14758857)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16149"
FT                   /product="mCG16149"
FT                   /note="gene_id=mCG16149.2 transcript_id=mCT15893.2
FT                   protein_id=mCP21253.2"
FT                   /protein_id="EDL21083.1"
FT                   /translation="MPSDRDKEWMTQILCLINVSHNGVSESELMELYPEMSWLSLTSII
FT                   HSLHKMHLLTYSCGLLRFQHLQAWETVRLQYLEDPALVSSYREKLISYFTSQLSQDRVT
FT                   WRSADELPWLFQQQGSKQKLHSCLLNLLVAQNLYKRGHFAELLSYWQFVGKDKGAMATE
FT                   YFESLKQYENSEGEENMLCLADLYETLGRFLKDLGLLSQAVVPLQRSLEIRETALDPDH
FT                   PRVAQSLHQLAGVYVQWKKFGDAEQLYKQALEISENAYGADHPHAARELEALATLYHKQ
FT                   NKYEQAEHFRKKSVIIRQQATRRKGSLYGFALLRRRALQLEELTLGKDKPENARTLNEL
FT                   GVLYFLQNNLETAEQFLKRSLEMRERVLGPDHPDCAQSLNNLAALCNEKKQYEKAEELY
FT                   ERALDIRRRALAPDHPSLAYTVKHLAILYKKTGKVDKAVPLYELAVEIRQKSFGPKHPS
FT                   VATALVNLAVLHSQMKKHSEALPLYERALKIYEDSLGRMHPRVGETLKNLAVLSYEEGN
FT                   FEKAAELYKRAMEIKEAETSLLGGKAPSRQSSSGDTFLFKTTHSPNVFLPQGQS"
FT   gene            14762469..14763096
FT                   /pseudo
FT                   /locus_tag="mCG_1032802"
FT                   /note="gene_id=mCG1032802.1"
FT   mRNA            14762469..14763096
FT                   /pseudo
FT                   /locus_tag="mCG_1032802"
FT                   /note="gene_id=mCG1032802.1 transcript_id=mCT150506.1
FT                   created on 02-AUG-2002"
FT   gene            complement(14763354..14779633)
FT                   /gene="Ube1dc1"
FT                   /locus_tag="mCG_16152"
FT                   /note="gene_id=mCG16152.2"
FT   mRNA            complement(join(14763354..14764435,14765983..14766089,
FT                   14766272..14766350,14766584..14766719,14770620..14770747,
FT                   14770911..14771015,14771747..14771831,14772360..14772446,
FT                   14773431..14773540,14776748..14776837,14776924..14776969,
FT                   14779321..14779633))
FT                   /gene="Ube1dc1"
FT                   /locus_tag="mCG_16152"
FT                   /product="ubiquitin-activating enzyme E1-domain containing
FT                   1"
FT                   /note="gene_id=mCG16152.2 transcript_id=mCT16041.2 created
FT                   on 02-AUG-2002"
FT   CDS             complement(join(14764352..14764435,14765983..14766089,
FT                   14766272..14766350,14766584..14766719,14770620..14770747,
FT                   14770911..14771015,14771747..14771831,14772360..14772446,
FT                   14773431..14773540,14776748..14776837,14776924..14776969,
FT                   14779321..14779475))
FT                   /codon_start=1
FT                   /gene="Ube1dc1"
FT                   /locus_tag="mCG_16152"
FT                   /product="ubiquitin-activating enzyme E1-domain containing
FT                   1"
FT                   /note="gene_id=mCG16152.2 transcript_id=mCT16041.2
FT                   protein_id=mCP21390.2"
FT                   /db_xref="GOA:Q8VE47"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="MGI:MGI:1913913"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VE47"
FT                   /protein_id="EDL21084.1"
FT                   /translation="MADSVERLRQRVEELEQELARERTRRSGGDGHCGRTRIQEMSDEV
FT                   LDSNPYSRLMALKRMGIVSDYKKIRTYAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYD
FT                   KVELANMNRLFFQPYQAGLSKVHAAEHTLRNINPDVLFEVHNYNITTVEHFEHFMNRIS
FT                   NGGLEEGQPVDLVLSCVDNFEARMAINTACNELGQTWMESGVSENAVSGHIQLMIPGES
FT                   ACFACAPPLVVASNIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLKFGTVSFYL
FT                   GYNAMQDFFPTMFMKPNPQCDDKNCRKQQEEYKKRAAALPTQEAEPQEEAEVVHEDNEW
FT                   GIELVSEVSEEELKNSSGPVPTLPEGITVAYTVPKKTEDSASEVTVEDSGESLEDLMAR
FT                   MKNM"
FT   gene            14780263..14844459
FT                   /gene="Acad11"
FT                   /locus_tag="mCG_16154"
FT                   /note="gene_id=mCG16154.2"
FT   mRNA            join(14780263..14780433,14790185..14790284,
FT                   14792377..14792502,14792890..14793051,14795125..14795289,
FT                   14797789..14797930,14798256..14798377,14799349..14799455,
FT                   14800719..14800845,14806824..14806901,14808247..14808385,
FT                   14812162..14812269,14813995..14814093,14830124..14830190,
FT                   14831049..14831134,14831874..14831945,14832757..14832911,
FT                   14839628..14839744,14840831..14840940,14843396..14844459)
FT                   /gene="Acad11"
FT                   /locus_tag="mCG_16154"
FT                   /product="acyl-Coenzyme A dehydrogenase family, member 11"
FT                   /note="gene_id=mCG16154.2 transcript_id=mCT16042.2 created
FT                   on 02-AUG-2002"
FT   CDS             join(14780291..14780433,14790185..14790284,
FT                   14792377..14792502,14792890..14793051,14795125..14795289,
FT                   14797789..14797930,14798256..14798377,14799349..14799455,
FT                   14800719..14800845,14806824..14806901,14808247..14808385,
FT                   14812162..14812269,14813995..14814093,14830124..14830190,
FT                   14831049..14831134,14831874..14831945,14832757..14832911,
FT                   14839628..14839744,14840831..14840940,14843396..14843510)
FT                   /codon_start=1
FT                   /gene="Acad11"
FT                   /locus_tag="mCG_16154"
FT                   /product="acyl-Coenzyme A dehydrogenase family, member 11"
FT                   /note="gene_id=mCG16154.2 transcript_id=mCT16042.2
FT                   protein_id=mCP21236.2"
FT                   /protein_id="EDL21085.1"
FT                   /translation="METDVTSDTVEVLPQHKFDLRSLEAYLNQHLPGFGSDSRAVLTVT
FT                   QYRSGQSNPTFFLQKGSQAYVLRKKPPGSLLPKAHKIDREFKIQKALFSIGFPVAKPLL
FT                   YCRDASVIGTEFYVMEHVQGRIFRDFSIPGVSSAERAAIYVSVAETLAWLHSLDIRSLK
FT                   LDKYGTGVGYCKRQVSTWTKQYQASAHQSIPAMDQLSTWLMKNLPDSDSEECLVHGDFK
FT                   LDNIVFHPKECRVIAVLDWELSTFGHPLTDLAHLSLFYYWPRTLPMINRGSHIPENTGI
FT                   PLMEELISIYCHRRGIDPNLPNWNFFMALSFFKLAGISQGVYRRYLMGNNSSEDSFLTA
FT                   NTVQPLAETGLQLSKRTLRTTPPQADAKSQLFAQSRRGQEVLTRVKQFMKQHVFPAEKE
FT                   VAEYYAQSGNSAEKWGHPLVIEKLKEMAKAEGLWNLFLPAVSGLSQVDYALIAEETGKC
FT                   FFAPDVFNCQAPDTGNMEVLHLYGSEQQKKQWLEPLLRGDITSVFCMTEPNVSSSDATN
FT                   IECTIQRDGGGYIVNGKKWWSSGAGNPKCKIAIVLGRMESPSASRHRQHSMILVPMDTP
FT                   GVELIRPLSVFGYMDNMHGGHWEVHFNHVRVPASNLILGEGRGFEISQGRLGPGRIHHC
FT                   MRTVGLAERILQIMCDRAVQREAFKKKLYEHEVVAHWIAKSRIAIEEIRLLTLKAAHSI
FT                   DTLGSASARKEIAMIKVAAPKAVCKIADWAIQVHGGAGVSQDYPLANMYAIIRTLRLAD
FT                   GPDEVHLSAIAKMELQDQARRLTARM"
FT   gene            complement(14814784..14843747)
FT                   /gene="Ccrl1"
FT                   /locus_tag="mCG_52492"
FT                   /note="gene_id=mCG52492.2"
FT   mRNA            complement(join(14814784..14816414,14818939..14819204,
FT                   14843233..14843747))
FT                   /gene="Ccrl1"
FT                   /locus_tag="mCG_52492"
FT                   /product="chemokine (C-C motif) receptor-like 1, transcript
FT                   variant mCT171389"
FT                   /note="gene_id=mCG52492.2 transcript_id=mCT171389.0 created
FT                   on 02-AUG-2002"
FT   mRNA            complement(join(14814784..14816414,14818939..14819681))
FT                   /gene="Ccrl1"
FT                   /locus_tag="mCG_52492"
FT                   /product="chemokine (C-C motif) receptor-like 1, transcript
FT                   variant mCT52675"
FT                   /note="gene_id=mCG52492.2 transcript_id=mCT52675.2 created
FT                   on 02-AUG-2002"
FT   CDS             complement(14815353..14816405)
FT                   /codon_start=1
FT                   /gene="Ccrl1"
FT                   /locus_tag="mCG_52492"
FT                   /product="chemokine (C-C motif) receptor-like 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG52492.2 transcript_id=mCT171389.0
FT                   protein_id=mCP94308.0 isoform=CRA_a"
FT                   /protein_id="EDL21086.1"
FT                   /translation="MALELNQSAEYYYEENEMNYTHDYSQYEVICIKEEVRQFAKVFLP
FT                   AFFTVAFVTGLAGNSVVVAIYAYYKKQRTKTDVYILNLAVADLLLLITLPFWAVNAVHG
FT                   WILGKMMCKVTSALYTVNFVSGMQFLACISIDRYWAITKAPSQSGAGRPCWIICCCVWM
FT                   AAILLSIPQLVFYTVNQNARCTPIFPHHLGTSLKASIQMLEIGIGFVVPFLIMGVCYAS
FT                   TARALIKMPNIKKSRPLRVLLAVVVVFIVTQLPYNVVKFCQAIDAIYLLITSCDMSKRM
FT                   DVAIQVTESIALFHSCLNPILYVFMGASFKNYIMKVAKKYGSWRRQRQNVEEIPFDSEG
FT                   PTEPTSSFTI"
FT   CDS             complement(14815353..14816405)
FT                   /codon_start=1
FT                   /gene="Ccrl1"
FT                   /locus_tag="mCG_52492"
FT                   /product="chemokine (C-C motif) receptor-like 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG52492.2 transcript_id=mCT52675.2
FT                   protein_id=mCP41394.2 isoform=CRA_a"
FT                   /protein_id="EDL21087.1"
FT                   /translation="MALELNQSAEYYYEENEMNYTHDYSQYEVICIKEEVRQFAKVFLP
FT                   AFFTVAFVTGLAGNSVVVAIYAYYKKQRTKTDVYILNLAVADLLLLITLPFWAVNAVHG
FT                   WILGKMMCKVTSALYTVNFVSGMQFLACISIDRYWAITKAPSQSGAGRPCWIICCCVWM
FT                   AAILLSIPQLVFYTVNQNARCTPIFPHHLGTSLKASIQMLEIGIGFVVPFLIMGVCYAS
FT                   TARALIKMPNIKKSRPLRVLLAVVVVFIVTQLPYNVVKFCQAIDAIYLLITSCDMSKRM
FT                   DVAIQVTESIALFHSCLNPILYVFMGASFKNYIMKVAKKYGSWRRQRQNVEEIPFDSEG
FT                   PTEPTSSFTI"
FT   gene            complement(14867991..14978919)
FT                   /locus_tag="mCG_115602"
FT                   /note="gene_id=mCG115602.1"
FT   mRNA            complement(join(14867991..14869132,14873523..14873622,
FT                   14877188..14877331,14878982..14879122,14879364..14879543,
FT                   14881665..14881838,14882222..14882264,14882399..14882568,
FT                   14883676..14883788,14884119..14884193,14887420..14887519,
FT                   14889226..14889317,14891054..14891231,14892353..14892469,
FT                   14893362..14893475,14895506..14895673,14896773..14896952,
FT                   14897703..14897822,14898732..14898806,14899209..14899393,
FT                   14901287..14901422,14903289..14903367,14904126..14904241,
FT                   14905624..14905825,14906901..14907055,14908686..14908731,
FT                   14909194..14909348,14912603..14912687,14913739..14913941,
FT                   14915210..14915314,14917016..14917117,14918467..14918529,
FT                   14919751..14919910,14919994..14920097,14924332..14924485,
FT                   14925884..14925966,14929369..14929512,14930425..14930520,
FT                   14930731..14930806,14932287..14932408,14934353..14934409,
FT                   14935168..14935323,14936512..14936619,14938041..14938140,
FT                   14944421..14944590,14944679..14944758,14944873..14945039,
FT                   14946008..14946099,14946639..14946734,14946829..14947035,
FT                   14949532..14949732,14953134..14953175,14953575..14953724,
FT                   14954463..14954538,14962759..14962841,14978737..14978919))
FT                   /locus_tag="mCG_115602"
FT                   /product="mCG115602"
FT                   /note="gene_id=mCG115602.1 transcript_id=mCT116710.1
FT                   created on 05-AUG-2002"
FT   CDS             complement(join(14869026..14869132,14873523..14873622,
FT                   14877188..14877331,14878982..14879122,14879364..14879543,
FT                   14881665..14881838,14882222..14882264,14882399..14882568,
FT                   14883676..14883788,14884119..14884193,14887420..14887519,
FT                   14889226..14889317,14891054..14891231,14892353..14892469,
FT                   14893362..14893475,14895506..14895673,14896773..14896952,
FT                   14897703..14897822,14898732..14898806,14899209..14899393,
FT                   14901287..14901422,14903289..14903367,14904126..14904241,
FT                   14905624..14905825,14906901..14907055,14908686..14908731,
FT                   14909194..14909348,14912603..14912687,14913739..14913941,
FT                   14915210..14915314,14917016..14917117,14918467..14918529,
FT                   14919751..14919910,14919994..14920097,14924332..14924485,
FT                   14925884..14925966,14929369..14929512,14930425..14930520,
FT                   14930731..14930806,14932287..14932408,14934353..14934409,
FT                   14935168..14935323,14936512..14936619,14938041..14938140,
FT                   14944421..14944590,14944679..14944758,14944873..14945039,
FT                   14946008..14946099,14946639..14946734,14946829..14947035,
FT                   14949532..14949732,14953134..14953175,14953575..14953724,
FT                   14954463..14954538,14962759..14962826))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115602"
FT                   /product="mCG115602"
FT                   /note="gene_id=mCG115602.1 transcript_id=mCT116710.1
FT                   protein_id=mCP68839.1"
FT                   /db_xref="GOA:G3X922"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="MGI:MGI:2676368"
FT                   /db_xref="UniProtKB/TrEMBL:G3X922"
FT                   /protein_id="EDL21088.1"
FT                   /translation="MNIIRENKDLACFYTTKHSWRGKYKRVFSVGTHAVTTYNPNTLEV
FT                   TNQWPYGDICSISPVGKGQGTEFNLTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDF
FT                   AEGKITGRRYNCYKHHWSDAKKPVVLEVTPGGFDQINPVTNRVLCSYDYRNIEGFVDLS
FT                   DYQGGFCILYGGFSRLHLFSSEQREEIIKSAIEHAGNYIGISLRIRKEPLEFEQYLNLR
FT                   FGKYSTDESITSLAEFVVQKISPRHSEPVKRVLAVTETCLVERDPATYNIATLKPLGEV
FT                   FALVCDSENPQLFTIEFIKGQVRKYSSTERDSLLASLLDGVRASGNRDVCVKMAPTHKG
FT                   QRWGLLSMPIDEEVESLHLRFLAAPPNGNFADAVFRFNANISYSGVLHAVTQDGLFSEN
FT                   KEKLINNAITALLSQEGDVVASNAELESQFQAVRRLVASKAGFLAFTQLPKFRERLGMK
FT                   VVKALKRSNNGVIHAAVDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNS
FT                   HVDHGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMA
FT                   IVKGAGLVMKAIIEEGDREIATKMQELALSEGALPRHLHTAMFTISSDQRMLTNRQLSR
FT                   HLVGLWTADNTTATNLLKRILPPGLLAYLDSSDPVPEKDADRMHVRDNVKIAMDQYGKF
FT                   NKVPEWQRLAGKAAKEVEKFAKEKVDLVLMHWRDRMGIAQKENINQKPVVLRKRRQRIK
FT                   IEANWDLFYYRFSQDHARSNLIWNFKTREELKDALESEMRTFNIDRELGSASVISWNHH
FT                   EFEVKYECLAEEIKIGDYYLRLLLEEDENEESGSIKRSYEFFNELYHRFLLTPKVNMKC
FT                   LCLQALAIVYGRCHEEIGPFTDTRYIIGMLERCTDKLERDRLILFLNKLILNKKNVKDL
FT                   MDSNGIRILVDLLTLAHLHVSRATVPLQSNVIEASPDMKRESEKEWYFGNADKERSGPY
FT                   GFHEMQELWAKGMLNAKTRCWAQGMDGWRPLQAIPQLKWCLLASGQAVLNETDLATLIL
FT                   NMLITMCGYFPSRDQDNAIIRPLPRVKRLLSDSTCLPHVIQLLLTFDPILVEKVAILLH
FT                   HIMQDNPQLPRLYLSGVFFFIMMYTGSNVLPVARFLKYTHSKQAFKSEETKGQDIFQRS
FT                   ILGHILPEAMVCYLENYEPEKFSEIFLGEFDTPEAIWSSEMRRLMIEKIAAHLADFTPR
FT                   LQSNTRALYQYCPIPVINYPQLENELFCNIYYLKQLCDTLRFPDWPIKDPVKLLKDSLD
FT                   AWKKEVEKKPPMMSIDDAYEVLNLPIGQGLHDESKIRKAYFRLAQKYHPDKNPEGRDMF
FT                   EKVNKAYEFLCTKSTKIVDGPDPENIILILKTQSILFNRHKEELQPYKYAGYPMLIRTI
FT                   TMETSDDLLFSKESPLLPAAAELAFHTVNCSALNAEELRRENGLEVLQEAFSRCVAVLN
FT                   RSSKPSDMSVQVCGHISRCYSVAAQFEECREKITEMPGIIKDLCRVLYFGKCIPRVAAL
FT                   AVECVSSFAVDFWLQTHLFQAGILWYLLVYLFNYDYTLEESGIQKNEETNQQEVANSLA
FT                   KLSVHALSRLGGYLSEDQATPENPTVRKSLAGMLTPYIARKLAVASATETLKMLNSNTE
FT                   SPYLMWNNSTRAELLEFLESQQENMIKKGDCDKTYGAEFVYSEHAKELIVGEIFVRVYN
FT                   EVPTFQLEVPKEFAASLLDYIGSQAQYLHTFMAITHAAKVESEQHGDRLPRVEMALEAL
FT                   RNVIKYNPGSESECIGHFKLIFSLLRVHGAGQVQQLALEVVNIVTSNQDCVNNIAESMV
FT                   LSNLLALLHSLPSSRQLVLETLYALASNTKIIKEAMAKGALIYLLDMFCNSTHPQVRSQ
FT                   TAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFEGTHENPELIWNDS
FT                   SRDKVSTTVREMMLEHFKNQRDNPDVNWKLPEDFAVVFGEAEGELAVGGVFLRIFIAQP
FT                   AWVLRKPREFLIALLEKLTELLEKNNPHGETLETLTMATVCLFSAQPQLADQVPPLGHL
FT                   PKVIQAMNHRNNAIPKSAIRVIHVLSDNELCVRAMASLETIGPLMNGMRKRADTVGLAC
FT                   EAINRMFQKEQSELVAQALKAELVPYLLKLLEGVGLENLDSPAATKAQIVKALKAMTRS
FT                   LQYGEQVSEILSRSSVWSAFKDQKHDLFISDSQTAGYLTGPGVAGYLTAGTSSSAMSNL
FT                   PPPVDHEAGDLGYQT"
FT   gene            complement(14885541..14886516)
FT                   /pseudo
FT                   /locus_tag="mCG_115606"
FT                   /note="gene_id=mCG115606.1"
FT   mRNA            complement(14885541..14886516)
FT                   /pseudo
FT                   /locus_tag="mCG_115606"
FT                   /note="gene_id=mCG115606.1 transcript_id=mCT116714.1
FT                   created on 05-AUG-2002"
FT   gene            complement(15004224..>15053774)
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /note="gene_id=mCG14747.3"
FT   mRNA            complement(join(15004224..15007504,15016791..15016960,
FT                   15022881..15022984,15025410..15025492,15030304..15030436,
FT                   15032222..15032314,15035976..15036074,15040055..15040207,
FT                   15040646..15040732,15042842..15042937,15053587..>15053774))
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /product="acid phosphatase, prostate, transcript variant
FT                   mCT191535"
FT                   /note="gene_id=mCG14747.3 transcript_id=mCT191535.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(15004224..15007504,15016791..15016960,
FT                   15022881..15022984,15025410..15025492,15030304..15030436,
FT                   15032222..15032314,15035976..15036032,15040055..15040207,
FT                   15040646..15040732,15042842..15042937,15053587..15053751))
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /product="acid phosphatase, prostate, transcript variant
FT                   mCT170552"
FT                   /note="gene_id=mCG14747.3 transcript_id=mCT170552.0 created
FT                   on 11-JUL-2002"
FT   CDS             complement(join(15007386..15007504,15016791..15016960,
FT                   15022881..15022984,15025410..15025492,15030304..15030436,
FT                   15032222..15032314,15035976..15036074,15040055..15040207,
FT                   15040646..15040732,15042842..15042937,15053587..>15053772))
FT                   /codon_start=1
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /product="acid phosphatase, prostate, isoform CRA_b"
FT                   /note="gene_id=mCG14747.3 transcript_id=mCT191535.0
FT                   protein_id=mCP112474.0 isoform=CRA_b"
FT                   /protein_id="EDL21090.1"
FT                   /translation="TSLPKASEVQHLLRLPEAALSPTMGAVPLPLSPTASLSLGFLLLL
FT                   SLCLDPGQAKELKFVTLVFRHGDRGPIETFPTDPITESSWPQGFGQLTQWGMEQHYELG
FT                   SYIRKRYGRFLNDTYKHDQIYIRSTDVDRTLMSAMTNLAALFPPEGISIWNPRLLWQPI
FT                   PVHTVSLSEDRLLYLPFRDCPRFEELKSETLESEEFLKRLHPYKSFLDTLSSLSGFDDQ
FT                   DLFGIWSKVYDPLFCESVHNFTLPSWATEDAMIKLKELSELSLLSLYGIHKQKEKSRLQ
FT                   GGVLVNEILKNMKLATQPQKYKKLVMYSAHDTTVSGLQMALDVYNGVLPPYASCHMMEL
FT                   YHDKGGHFVEMYYRNETQNEPYPLTLPGCTHSCPLEKFAELLDPVISQDWATECMATSS
FT                   HQVLRVILATTFCLVTGILVILLLVLIRHGPCWQRDVYRNI"
FT   CDS             complement(join(15007386..15007504,15016791..15016960,
FT                   15022881..15022984,15025410..15025492,15030304..15030436,
FT                   15032222..15032314,15035976..15036032,15040055..15040207,
FT                   15040646..15040732,15042842..15042937,15053587..15053703))
FT                   /codon_start=1
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /product="acid phosphatase, prostate, isoform CRA_a"
FT                   /note="gene_id=mCG14747.3 transcript_id=mCT170552.0
FT                   protein_id=mCP93470.0 isoform=CRA_a"
FT                   /protein_id="EDL21089.1"
FT                   /translation="MGAVPLPLSPTASLSLGFLLLLSLCLDPGQAKELKFVTLVFRHGD
FT                   RGPIETFPTDPITESSWPQGFGQLTQWGMEQHYELGSYIRKRYGRFLNDTYKHDQIYIR
FT                   STDVDRTLMSAMTNLAALFPPEGISIWNPRLLWQPIPVHTVSLSEDRLKSETLESEEFL
FT                   KRLHPYKSFLDTLSSLSGFDDQDLFGIWSKVYDPLFCESVHNFTLPSWATEDAMIKLKE
FT                   LSELSLLSLYGIHKQKEKSRLQGGVLVNEILKNMKLATQPQKYKKLVMYSAHDTTVSGL
FT                   QMALDVYNGVLPPYASCHMMELYHDKGGHFVEMYYRNETQNEPYPLTLPGCTHSCPLEK
FT                   FAELLDPVISQDWATECMATSSHQVLRVILATTFCLVTGILVILLLVLIRHGPCWQRDV
FT                   YRNI"
FT   mRNA            complement(join(15014975..15016443,15016791..15016960,
FT                   15022881..15022984,15025410..15025492,15030304..15030436,
FT                   15032222..15032314,15035976..15036074,15040055..15040207,
FT                   15040646..15040732,15042842..15042937,15053587..15053751))
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /product="acid phosphatase, prostate, transcript variant
FT                   mCT19812"
FT                   /note="gene_id=mCG14747.3 transcript_id=mCT19812.2 created
FT                   on 11-JUL-2002"
FT   CDS             complement(join(15016433..15016443,15016791..15016960,
FT                   15022881..15022984,15025410..15025492,15030304..15030436,
FT                   15032222..15032314,15035976..15036074,15040055..15040207,
FT                   15040646..15040732,15042842..15042937,15053587..15053703))
FT                   /codon_start=1
FT                   /gene="Acpp"
FT                   /locus_tag="mCG_14747"
FT                   /product="acid phosphatase, prostate, isoform CRA_c"
FT                   /note="gene_id=mCG14747.3 transcript_id=mCT19812.2
FT                   protein_id=mCP21324.2 isoform=CRA_c"
FT                   /protein_id="EDL21091.1"
FT                   /translation="MGAVPLPLSPTASLSLGFLLLLSLCLDPGQAKELKFVTLVFRHGD
FT                   RGPIETFPTDPITESSWPQGFGQLTQWGMEQHYELGSYIRKRYGRFLNDTYKHDQIYIR
FT                   STDVDRTLMSAMTNLAALFPPEGISIWNPRLLWQPIPVHTVSLSEDRLLYLPFRDCPRF
FT                   EELKSETLESEEFLKRLHPYKSFLDTLSSLSGFDDQDLFGIWSKVYDPLFCESVHNFTL
FT                   PSWATEDAMIKLKELSELSLLSLYGIHKQKEKSRLQGGVLVNEILKNMKLATQPQKYKK
FT                   LVMYSAHDTTVSGLQMALDVYNGVLPPYASCHMMELYHDKGGHFVEMYYRNETQNEPYP
FT                   LTLPGCTHSCPLEKFAELLDPVISQDWATECMATSSHQGRN"
FT   gene            complement(15227119..15227560)
FT                   /pseudo
FT                   /locus_tag="mCG_14744"
FT                   /note="gene_id=mCG14744.2"
FT   mRNA            complement(15227119..15227560)
FT                   /pseudo
FT                   /locus_tag="mCG_14744"
FT                   /note="gene_id=mCG14744.2 transcript_id=mCT19809.2 created
FT                   on 05-AUG-2002"
FT   gene            15276027..15781786
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /note="gene_id=mCG14749.2"
FT   mRNA            join(15276027..15276430,15281156..15281239,
FT                   15281934..15282085,15283387..15283599,15414917..15415097,
FT                   15609120..15609299,15638302..15638373,15639514..15639588,
FT                   15660128..15660211,15663139..15663228,15735307..15735405,
FT                   15738856..15738942,15739556..15739615,15754914..15755047,
FT                   15765774..15765828,15767065..15767116,15769541..15769674,
FT                   15773936..15774172,15779985..15781786)
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, transcript variant mCT19814"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT19814.2 created
FT                   on 05-AUG-2002"
FT   mRNA            join(15276027..15276430,15281156..15281239,
FT                   15281934..15282085,15283387..15283599,15414917..15415097,
FT                   15609120..15609511)
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, transcript variant mCT50638"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT50638.2 created
FT                   on 05-AUG-2002"
FT   mRNA            join(<15298047..15298356,15414917..15415097,
FT                   15609120..15609299,15638302..15638373,15639514..15639588,
FT                   15660128..15660211,15663139..15663228,15754914..15755047,
FT                   15765774..15765828,15767065..15767116,15769541..15769674,
FT                   15773936..15774172,15779985..15781782)
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, transcript variant mCT191541"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT191541.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<15298049..15298356,15414917..15415097,
FT                   15609120..15609299,15638302..15638373,15639514..15639588,
FT                   15660128..15660211,15663139..15663228,15735307..15735405,
FT                   15738856..15738942,15739556..15739615,15754914..15755047,
FT                   15765774..15765828,15767065..15767116,15769541..15769674,
FT                   15773936..15774172,15779985..15781782)
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, transcript variant mCT191540"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT191540.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<15298322..15298356,15414917..15415097,
FT                   15609120..15609299,15638302..15638373,15639514..15639588,
FT                   15660128..15660211,15663139..15663228,15735307..15735405,
FT                   15738856..15738942,15739556..15739615,15754914..15755047,
FT                   15765774..15765828,15767065..15767116,15769541..15769674,
FT                   15773936..15774172,15779985..15780119)
FT                   /codon_start=1
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, isoform CRA_a"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT191540.0
FT                   protein_id=mCP112476.0 isoform=CRA_a"
FT                   /protein_id="EDL21092.1"
FT                   /translation="ILFLVSEAGTPRMKKMSNIYESAANTLGIFNSPCLTKVELRVACK
FT                   GISDRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTCINPVYSKLFTVDFYFEEVQRLR
FT                   FEVHDISSNHNGLKEADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELS
FT                   GNDDYVELAFNARKLDDKDFFSKSDPFLEIFRMNDDATQQLVHRTEVVMNNLSPAWKSF
FT                   KVSVNSLCSGDPDRRLKCIVWDWDSNGKHDFIGEFTSTFKEMRGAMEGKQVQWECINPK
FT                   YKAKKKNYKNSGMVILNQCKIHKMHSFLDYIMGGCQIQFTVAIDFTASNGDPRNSCSLH
FT                   YIHPYQPNEYLKALVAVGEICQDYDSDKMFPAFGFGARIPPEYTVSHDFAINFNEDNPE
FT                   CAGIQGVVEAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQYFILLILTDGV
FT                   ITDMADTREAIVHASHLPMSVIIVGVGNADFSDMQMLDGDDGILRSPKGEPVLRDIVQF
FT                   VPFRNFKHASPAALAKSVLAEVPNQVVDYYNGKGIKPKCSSEVYESSRTLAP"
FT   CDS             join(<15298322..15298356,15414917..15415097,
FT                   15609120..15609299,15638302..15638373,15639514..15639588,
FT                   15660128..15660211,15663139..15663228,15754914..15755047,
FT                   15765774..15765828,15767065..15767116,15769541..15769674,
FT                   15773936..15774172,15779985..15780119)
FT                   /codon_start=1
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, isoform CRA_b"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT191541.0
FT                   protein_id=mCP112477.0 isoform=CRA_b"
FT                   /protein_id="EDL21093.1"
FT                   /translation="ILFLVSEAGTPRMKKMSNIYESAANTLGIFNSPCLTKVELRVACK
FT                   GISDRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTCINPVYSKLFTVDFYFEEVQRLR
FT                   FEVHDISSNHNGLKEADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELS
FT                   GNDDYVELAFNARKLDDKDFFSKSDPFLEIFRMNDDATQQLVHRTEVVMNNLSPAWKSF
FT                   KVSVNSLCSGDPDRRLKVAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALVAVGEICQD
FT                   YDSDKMFPAFGFGARIPPEYTVSHDFAINFNEDNPECAGIQGVVEAYQSCLPKLQLYGP
FT                   TNIAPIIQKVAKSASEETNTKEASQYFILLILTDGVITDMADTREAIVHASHLPMSVII
FT                   VGVGNADFSDMQMLDGDDGILRSPKGEPVLRDIVQFVPFRNFKHASPAALAKSVLAEVP
FT                   NQVVDYYNGKGIKPKCSSEVYESSRTLAP"
FT   CDS             join(15414918..15415097,15609120..15609299,
FT                   15638302..15638373,15639514..15639588,15660128..15660211,
FT                   15663139..15663228,15735307..15735405,15738856..15738942,
FT                   15739556..15739615,15754914..15755047,15765774..15765828,
FT                   15767065..15767116,15769541..15769674,15773936..15774172,
FT                   15779985..15780119)
FT                   /codon_start=1
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, isoform CRA_c"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT19814.2
FT                   protein_id=mCP21367.2 isoform=CRA_c"
FT                   /protein_id="EDL21094.1"
FT                   /translation="MKKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPD
FT                   PCVILKMQSHGQWFEVDRTEVIRTCINPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNG
FT                   LKEADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELSGNDDYVELAFNA
FT                   RKLDDKDFFSKSDPFLEIFRMNDDATQQLVHRTEVVMNNLSPAWKSFKVSVNSLCSGDP
FT                   DRRLKCIVWDWDSNGKHDFIGEFTSTFKEMRGAMEGKQVQWECINPKYKAKKKNYKNSG
FT                   MVILNQCKIHKMHSFLDYIMGGCQIQFTVAIDFTASNGDPRNSCSLHYIHPYQPNEYLK
FT                   ALVAVGEICQDYDSDKMFPAFGFGARIPPEYTVSHDFAINFNEDNPECAGIQGVVEAYQ
FT                   SCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQYFILLILTDGVITDMADTREAIV
FT                   HASHLPMSVIIVGVGNADFSDMQMLDGDDGILRSPKGEPVLRDIVQFVPFRNFKHASPA
FT                   ALAKSVLAEVPNQVVDYYNGKGIKPKCSSEVYESSRTLAP"
FT   CDS             join(15414918..15415097,15609120..15609377)
FT                   /codon_start=1
FT                   /gene="Cpne4"
FT                   /locus_tag="mCG_14749"
FT                   /product="copine IV, isoform CRA_d"
FT                   /note="gene_id=mCG14749.2 transcript_id=mCT50638.2
FT                   protein_id=mCP41400.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q8CEQ2"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="MGI:MGI:1921270"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CEQ2"
FT                   /protein_id="EDL21095.1"
FT                   /translation="MKKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPD
FT                   PCVILKMQSHGQWFEVDRTEVIRTCINPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNG
FT                   LKEADFLGGMECTLGQVDRRCLLSPPLQAFLPSSDPCSLFL"
FT   gene            15800483..15824683
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /note="gene_id=mCG14748.2"
FT   mRNA            join(15800483..15800756,15801666..15801850,
FT                   15802814..15802905,15804244..15804342,15808931..15809030,
FT                   15811082..15811142,15818431..15818539,15820829..15820906,
FT                   15822278..15822355,15824111..15824683)
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /product="mitochondrial ribosomal protein L3, transcript
FT                   variant mCT19813"
FT                   /note="gene_id=mCG14748.2 transcript_id=mCT19813.2 created
FT                   on 19-JUL-2002"
FT   mRNA            join(15800483..15800756,15801666..15801850,
FT                   15802814..15802905,15804244..15804342,15808931..15809030,
FT                   15811082..15811142,15818431..15818539,15820829..15820906,
FT                   15822278..15822761)
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /product="mitochondrial ribosomal protein L3, transcript
FT                   variant mCT170745"
FT                   /note="gene_id=mCG14748.2 transcript_id=mCT170745.0 created
FT                   on 19-JUL-2002"
FT   mRNA            join(<15800545..15800756,15801760..15801850,
FT                   15802814..15802905,15804244..15804342,15808931..15809030,
FT                   15811082..15811142,15818431..15818539,15820829..15820906,
FT                   15822278..15822355,15824111..15824584)
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /product="mitochondrial ribosomal protein L3, transcript
FT                   variant mCT191536"
FT                   /note="gene_id=mCG14748.2 transcript_id=mCT191536.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(15800665..15800756,15801666..15801850,
FT                   15802814..15802905,15804244..15804342,15808931..15809030,
FT                   15811082..15811142,15818431..15818539,15820829..15820906,
FT                   15822278..15822355,15824111..15824263)
FT                   /codon_start=1
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /product="mitochondrial ribosomal protein L3, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG14748.2 transcript_id=mCT19813.2
FT                   protein_id=mCP21350.2 isoform=CRA_c"
FT                   /protein_id="EDL21098.1"
FT                   /translation="MPGWRLLAQAGARVLGCGARGLGADPGLERRKNILFFVRNLHSKS
FT                   STWWDEHLSEENLSFVKQLVSDENKTQLTSKLNPLKDEPWPLHPWEPGSFRVGLIALKL
FT                   GMMPLWTKDGQKHAVTLLQVQDCHVLKYTPKEDHNGKIAALTVGGKTVSRFYKPDSRLE
FT                   FYRDLGLPPKQIHKIFHVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRW
FT                   GFKGQPASHGQTKTHRRPGAISTGDIARVWPGTKMPGRMGNQNRTVYGLKVWRVNTKHN
FT                   IIYVNGSVPGHKNCLVKIKDSTLPAYKDSCKNLPFPTYFPDGDEEELPEDLFDESVWQP
FT                   SEPSITFA"
FT   CDS             join(15800665..15800756,15801666..15801850,
FT                   15802814..15802905,15804244..15804342,15808931..15809030,
FT                   15811082..15811142,15818431..15818539,15820829..15820906,
FT                   15822278..15822376)
FT                   /codon_start=1
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /product="mitochondrial ribosomal protein L3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG14748.2 transcript_id=mCT170745.0
FT                   protein_id=mCP93663.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3Z456"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="MGI:MGI:2137204"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z456"
FT                   /protein_id="EDL21096.1"
FT                   /translation="MPGWRLLAQAGARVLGCGARGLGADPGLERRKNILFFVRNLHSKS
FT                   STWWDEHLSEENLSFVKQLVSDENKTQLTSKLNPLKDEPWPLHPWEPGSFRVGLIALKL
FT                   GMMPLWTKDGQKHAVTLLQVQDCHVLKYTPKEDHNGKIAALTVGGKTVSRFYKPDSRLE
FT                   FYRDLGLPPKQIHKIFHVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRW
FT                   GFKGQPASHGQTKTHRRPGAISTGDIARVWPGTKMPGRMGNQNRTVYGLKVWRVNTKHN
FT                   IIYVNGSVPGHKNCLVKVCTAVC"
FT   CDS             join(<15800739..15800756,15801760..15801850,
FT                   15802814..15802905,15804244..15804342,15808931..15809030,
FT                   15811082..15811142,15818431..15818539,15820829..15820906,
FT                   15822278..15822355,15824111..15824263)
FT                   /codon_start=1
FT                   /gene="Mrpl3"
FT                   /locus_tag="mCG_14748"
FT                   /product="mitochondrial ribosomal protein L3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG14748.2 transcript_id=mCT191536.0
FT                   protein_id=mCP112475.0 isoform=CRA_b"
FT                   /protein_id="EDL21097.1"
FT                   /translation="PRLREKQLVSDENKTQLTSKLNPLKDEPWPLHPWEPGSFRVGLIA
FT                   LKLGMMPLWTKDGQKHAVTLLQVQDCHVLKYTPKEDHNGKIAALTVGGKTVSRFYKPDS
FT                   RLEFYRDLGLPPKQIHKIFHVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVM
FT                   KRWGFKGQPASHGQTKTHRRPGAISTGDIARVWPGTKMPGRMGNQNRTVYGLKVWRVNT
FT                   KHNIIYVNGSVPGHKNCLVKIKDSTLPAYKDSCKNLPFPTYFPDGDEEELPEDLFDESV
FT                   WQPSEPSITFA"
FT   gene            complement(15811795..15815073)
FT                   /locus_tag="mCG_147712"
FT                   /note="gene_id=mCG147712.0"
FT   mRNA            complement(join(15811795..15812151,15812187..15815073))
FT                   /locus_tag="mCG_147712"
FT                   /product="mCG147712"
FT                   /note="gene_id=mCG147712.0 transcript_id=mCT187975.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(15812443..15812829)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147712"
FT                   /product="mCG147712"
FT                   /note="gene_id=mCG147712.0 transcript_id=mCT187975.0
FT                   protein_id=mCP108539.0"
FT                   /protein_id="EDL21099.1"
FT                   /translation="MKQNPTRQNPPPPFLSIQEDWNYQKGERKTLRSSAAVYELKASTE
FT                   HRPGKTKLYTKPVTSLATSHLLTKASDSMPSQSSLYVLQGMECDSHSTVYKLTGLMHGI
FT                   LGLVVIHKFKSKIIWSVTESSLAS"
FT   gene            complement(15878225..15881122)
FT                   /gene="Nudt16"
FT                   /locus_tag="mCG_4793"
FT                   /note="gene_id=mCG4793.1"
FT   mRNA            complement(join(15878225..15878321,15879608..15879827,
FT                   15880610..15880879,15880960..15881122))
FT                   /gene="Nudt16"
FT                   /locus_tag="mCG_4793"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 16, transcript variant mCT170570"
FT                   /note="gene_id=mCG4793.1 transcript_id=mCT170570.0 created
FT                   on 11-JUL-2002"
FT   mRNA            complement(join(15878660..15879827,15880610..15880879,
FT                   15880960..15881122))
FT                   /gene="Nudt16"
FT                   /locus_tag="mCG_4793"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 16, transcript variant mCT3740"
FT                   /note="gene_id=mCG4793.1 transcript_id=mCT3740.1 created on
FT                   11-JUL-2002"
FT   CDS             complement(join(15879648..15879827,15880610..15880879,
FT                   15880960..15881097))
FT                   /codon_start=1
FT                   /gene="Nudt16"
FT                   /locus_tag="mCG_4793"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 16, isoform CRA_a"
FT                   /note="gene_id=mCG4793.1 transcript_id=mCT170570.0
FT                   protein_id=mCP93488.0 isoform=CRA_a"
FT                   /protein_id="EDL21100.1"
FT                   /translation="MEGHRKVELSEALALGPDWRHACHALLYAPDPRKLFGRIPMRFAV
FT                   LMQMRFDGRLGFPGGFVDAQDSCLEDGLNRELREELGEAMSAFRVERSDYRSSHIAARP
FT                   RVVAHFYAKRLTLEQLQAVEARAPQAKDHGLEVLGLVRVPLYVLRDGEGGLPAFLENSF
FT                   IGAAREQLLEALQDLKLLDPGIIAKLKIPDSK"
FT   CDS             complement(join(15879648..15879827,15880610..15880879,
FT                   15880960..15881097))
FT                   /codon_start=1
FT                   /gene="Nudt16"
FT                   /locus_tag="mCG_4793"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 16, isoform CRA_a"
FT                   /note="gene_id=mCG4793.1 transcript_id=mCT3740.1
FT                   protein_id=mCP21241.1 isoform=CRA_a"
FT                   /protein_id="EDL21101.1"
FT                   /translation="MEGHRKVELSEALALGPDWRHACHALLYAPDPRKLFGRIPMRFAV
FT                   LMQMRFDGRLGFPGGFVDAQDSCLEDGLNRELREELGEAMSAFRVERSDYRSSHIAARP
FT                   RVVAHFYAKRLTLEQLQAVEARAPQAKDHGLEVLGLVRVPLYVLRDGEGGLPAFLENSF
FT                   IGAAREQLLEALQDLKLLDPGIIAKLKIPDSK"
FT   gene            complement(15892962..15894697)
FT                   /gene="1700080E11Rik"
FT                   /locus_tag="mCG_4454"
FT                   /note="gene_id=mCG4454.1"
FT   mRNA            complement(join(15892962..15893267,15894049..15894318,
FT                   15894402..15894697))
FT                   /gene="1700080E11Rik"
FT                   /locus_tag="mCG_4454"
FT                   /product="RIKEN cDNA 1700080E11"
FT                   /note="gene_id=mCG4454.1 transcript_id=mCT3728.1 created on
FT                   11-JUL-2002"
FT   CDS             complement(join(15893058..15893267,15894049..15894318,
FT                   15894402..15894542))
FT                   /codon_start=1
FT                   /gene="1700080E11Rik"
FT                   /locus_tag="mCG_4454"
FT                   /product="RIKEN cDNA 1700080E11"
FT                   /note="gene_id=mCG4454.1 transcript_id=mCT3728.1
FT                   protein_id=mCP21238.2"
FT                   /protein_id="EDL21102.1"
FT                   /translation="MATPTKIDLEDALALGPSWRHLCHVMLYAPDPGVLFGGRILLNYA
FT                   VLMSMRFDGRLGFPGGFVDDRSPSLEEGLNKELLKKLGEGVSTFSILSTDYRSSLAESK
FT                   SKVVAHFYVKCLTLEQLQAVEAGAPQAKDHGLEVLGLVRVPLYTLRDGMGGLPAFLENS
FT                   FIGVAREQLLEALQDLGILAPETASDLKERTVQRKQTLRLIGT"
FT   gene            15958953..15965893
FT                   /locus_tag="mCG_1032909"
FT                   /note="gene_id=mCG1032909.0"
FT   mRNA            join(15958953..15959114,15965745..15965893)
FT                   /locus_tag="mCG_1032909"
FT                   /product="mCG1032909"
FT                   /note="gene_id=mCG1032909.0 transcript_id=mCT150613.0
FT                   created on 05-AUG-2002"
FT   CDS             15965756..15965779
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032909"
FT                   /product="mCG1032909"
FT                   /note="gene_id=mCG1032909.0 transcript_id=mCT150613.0
FT                   protein_id=mCP68527.1"
FT                   /protein_id="EDL21103.1"
FT                   /translation="MTWIDTE"
FT   gene            complement(15999177..15999839)
FT                   /locus_tag="mCG_1032910"
FT                   /note="gene_id=mCG1032910.0"
FT   mRNA            complement(join(15999177..15999382,15999408..15999839))
FT                   /locus_tag="mCG_1032910"
FT                   /product="mCG1032910"
FT                   /note="gene_id=mCG1032910.0 transcript_id=mCT150614.0
FT                   created on 05-AUG-2002"
FT   CDS             complement(join(15999355..15999382,15999408..15999544))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032910"
FT                   /product="mCG1032910"
FT                   /note="gene_id=mCG1032910.0 transcript_id=mCT150614.0
FT                   protein_id=mCP68701.1"
FT                   /protein_id="EDL21104.1"
FT                   /translation="MTYTGGEGPRKISKNAGQKRGGVPKATTSRFLMLILLSPQGAPGK
FT                   GVPSTTSQK"
FT   gene            complement(16000102..16156738)
FT                   /gene="Nek11"
FT                   /locus_tag="mCG_56220"
FT                   /note="gene_id=mCG56220.3"
FT   mRNA            complement(join(16000102..16000936,16043502..16043616,
FT                   16049532..16049625,16051247..16051366,16054016..16054101,
FT                   16055817..16055895,16056006..16056155,16070423..16070487,
FT                   16078817..16078935,16101149..16101314,16154064..16154375,
FT                   16156409..>16156502))
FT                   /gene="Nek11"
FT                   /locus_tag="mCG_56220"
FT                   /product="NIMA (never in mitosis gene a)-related expressed
FT                   kinase 11, transcript variant mCT191505"
FT                   /note="gene_id=mCG56220.3 transcript_id=mCT191505.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(16000106..16000936,16043502..16043616,
FT                   16049532..16049625,16051247..16051366,16054016..16054101,
FT                   16055817..16055895,16056006..16056155,16069151..16069277,
FT                   16070423..16070487,16078817..16078935,16101149..16101314,
FT                   16154064..16154375,16156409..16156738))
FT                   /gene="Nek11"
FT                   /locus_tag="mCG_56220"
FT                   /product="NIMA (never in mitosis gene a)-related expressed
FT                   kinase 11, transcript variant mCT56403"
FT                   /note="gene_id=mCG56220.3 transcript_id=mCT56403.2 created
FT                   on 05-AUG-2002"
FT   CDS             complement(join(16000740..16000936,16043502..16043616,
FT                   16049532..16049625,16051247..16051366,16054016..16054101,
FT                   16055817..16055895,16056006..16056155,16069151..16069277,
FT                   16070423..16070487,16078817..16078935,16101149..16101314,
FT                   16154064..16154236))
FT                   /codon_start=1
FT                   /gene="Nek11"
FT                   /locus_tag="mCG_56220"
FT                   /product="NIMA (never in mitosis gene a)-related expressed
FT                   kinase 11, isoform CRA_b"
FT                   /note="gene_id=mCG56220.3 transcript_id=mCT56403.2
FT                   protein_id=mCP41308.2 isoform=CRA_b"
FT                   /protein_id="EDL21106.1"
FT                   /translation="MLKFQETAKYVGGRPTVIPMYPTALIARRYVLQQKLGSGSFGTVY
FT                   LVSDKKAKPGEELKVLKEISVGELNPNETVQANVEAQLLSRLHHPAIVRFHASFMEQET
FT                   FCIITEYCEGRDLDYRIQEYKEAGKVFAENQIVEWFIQLLLGVDYMHERRILHRDLKSK
FT                   NIFLKNNLLKIGDFGVSRLLMGSCELATTLTGTPHYMSPEALKHQGYDAKSDIWSLACI
FT                   LYEMCCLDHAFAGSSFLSVVLNIVEGNTPSLPDRYPRELNTIMERMLNKSPSLRPSAAD
FT                   ILKAPYMEEQLQLLMCKYPEMTLEDKNSVCQKEAAHTINAVQKKLHLQTLQALSDTQKT
FT                   TPRERMRLRKLQAADERARRLKKIAEENYKENDKRMQALRSQNVGSVHAHVLHELDERT
FT                   LESLPEPQSLPCLDLDELEPSLEDTIVDLGHYEIPEDPLVAEQYYSDVFDSCSEDSEEQ
FT                   EEEMIFSEAGGDTKEEESPSVYRTNQQVQPLLLWPEDV"
FT   CDS             complement(join(16000740..16000936,16043502..16043616,
FT                   16049532..16049625,16051247..16051366,16054016..16054101,
FT                   16055817..16055895,16056006..16056155,16070423..>16070436))
FT                   /codon_start=1
FT                   /gene="Nek11"
FT                   /locus_tag="mCG_56220"
FT                   /product="NIMA (never in mitosis gene a)-related expressed
FT                   kinase 11, isoform CRA_a"
FT                   /note="gene_id=mCG56220.3 transcript_id=mCT191505.0
FT                   protein_id=mCP112511.0 isoform=CRA_a"
FT                   /protein_id="EDL21105.1"
FT                   /translation="STQNRSLACILYEMCCLDHAFAGSSFLSVVLNIVEGNTPSLPDRY
FT                   PRELNTIMERMLNKSPSLRPSAADILKAPYMEEQLQLLMCKYPEMTLEDKNSVCQKEAA
FT                   HTINAVQKKLHLQTLQALSDTQKTTPRERMRLRKLQAADERARRLKKIAEENYKENDKR
FT                   MQALRSQNVGSVHAHVLHELDERTLESLPEPQSLPCLDLDELEPSLEDTIVDLGHYEIP
FT                   EDPLVAEQYYSDVFDSCSEDSEEQEEEMIFSEAGGDTKEEESPSVYRTNQQVQPLLLWP
FT                   EDV"
FT   gene            16156623..16166628
FT                   /gene="Aste1"
FT                   /locus_tag="mCG_4452"
FT                   /note="gene_id=mCG4452.2"
FT   mRNA            join(16156623..16156878,16157762..16159075,
FT                   16162692..16162902,16164563..16164758,16166166..16166628)
FT                   /gene="Aste1"
FT                   /locus_tag="mCG_4452"
FT                   /product="asteroid homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG4452.2 transcript_id=mCT3725.1 created on
FT                   11-JUL-2002"
FT   CDS             join(16157780..16159075,16162692..16162902,
FT                   16164563..16164758,16166166..16166481)
FT                   /codon_start=1
FT                   /gene="Aste1"
FT                   /locus_tag="mCG_4452"
FT                   /product="asteroid homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG4452.2 transcript_id=mCT3725.1
FT                   protein_id=mCP21237.1"
FT                   /protein_id="EDL21107.1"
FT                   /translation="MGIRGLMSFVEDYSNEFFVDLKLRNTKLIIDGYSLFHRLCFNSDL
FT                   ELRYGGDYDLFADVVQKFFESLFACHICPYVVLDGGCDISDKKLTTLKDRAKEKIQAAR
FT                   SLSLGGGGNVCPLLIREVFIQVLIRLEVCFVQSFSEADRDIMTLANHWNCPVLSSDSDF
FT                   CIFDLRSGFCSLNSFQWRNLNTIKDTQDYYIPARSFSLDAFCHYFNNMNKALLPLFAVL
FT                   CGNDHVNLPIMDTFISKVRLPLSSKGRRYHRVLGLLNWLSHFDDPTEALDNVLKSLPKK
FT                   SRENVKELLCCSMEEYQQSPVKLQDFFQYGSYVCTDASDLGLPEWVLGALAKGQLPPFI
FT                   SDALVLRRTFLHTQVENMQRPNAHRISQPIRQIIYGLLLNGPSHAEDIAQNTLPSQLLA
FT                   FNEVERIDTNIKTSTVYAKQLLKDQCDLSKLAELPLARRQMLLLEALKVKQVVLESIPT
FT                   FLKLPIAVTCYWLQSTEAKAKLHHLQALLLGMLREPLHAIVNSPGTEDPQRGGAKMLYE
FT                   ELCQVKAPMRPGPRVDLDTAHVFCQWQSCLQMGLYLNQLLSTPLPEPNLTWLYNGSLVH
FT                   RLCQQLPASSSVESLLSLCPEAKQLYEHLFNATKSYAPAELFLPKTKSKSKKKRQKKKV
FT                   ASLGTTAGAKHWYDRSNRFGPLMPESLEEHVENSELE"
FT   gene            complement(16170876..16279337)
FT                   /gene="Atp2c1"
FT                   /locus_tag="mCG_4445"
FT                   /note="gene_id=mCG4445.2"
FT   mRNA            complement(join(16170876..16172704,16174133..16174274,
FT                   16177477..16177572,16177972..16178119,16179610..16179726,
FT                   16180999..16181067,16182362..16182528,16183589..16183639,
FT                   16190965..16191062,16192106..16192276,16194509..16194665,
FT                   16198758..16198862,16201386..16201475,16201566..16201661,
FT                   16203843..16203940,16204705..16204829,16207477..16207543,
FT                   16210764..16210839,16211712..16211780,16212471..16212623,
FT                   16218205..16218313,16219614..16219675,16223205..16223240,
FT                   16225161..16225250,16226248..16226364,16228586..16228696,
FT                   16279120..16279337))
FT                   /gene="Atp2c1"
FT                   /locus_tag="mCG_4445"
FT                   /product="ATPase, Ca++-sequestering"
FT                   /note="gene_id=mCG4445.2 transcript_id=mCT3737.2 created on
FT                   05-AUG-2002"
FT   CDS             complement(join(16172574..16172704,16174133..16174274,
FT                   16177477..16177572,16177972..16178119,16179610..16179726,
FT                   16180999..16181067,16182362..16182528,16183589..16183639,
FT                   16190965..16191062,16192106..16192276,16194509..16194665,
FT                   16198758..16198862,16201386..16201475,16201566..16201661,
FT                   16203843..16203940,16204705..16204829,16207477..16207543,
FT                   16210764..16210839,16211712..16211780,16212471..16212623,
FT                   16218205..16218313,16219614..16219675,16223205..16223240,
FT                   16225161..16225250,16226248..16226364,16228586..16228696,
FT                   16279120..16279227))
FT                   /codon_start=1
FT                   /gene="Atp2c1"
FT                   /locus_tag="mCG_4445"
FT                   /product="ATPase, Ca++-sequestering"
FT                   /note="gene_id=mCG4445.2 transcript_id=mCT3737.2
FT                   protein_id=mCP21264.2"
FT                   /db_xref="GOA:Q3UZR5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006413"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="MGI:MGI:1889008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UZR5"
FT                   /protein_id="EDL21108.1"
FT                   /translation="MENLLPPSGFSYLKKYPLHSIRKYLSTLRSQRAEEQVARFQKIPN
FT                   VENETMIPVLTSKRASELAVSEVAGLLQADLQNGLNKSEVSHRRAFHGWNEFDISEDEP
FT                   LWKKYISQFKNPLIMLLLASAVISILMRQFDDAVSITVAIVIVVTVAFVQEYRSEKSLE
FT                   ELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSVDESSL
FT                   TGETAPCSKVTAPQPAANGDLASRSNIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMM
FT                   QAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIP
FT                   EGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIL
FT                   TSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNNTLMGKP
FT                   TEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDRPEICFMKGAYE
FT                   QVIKYCTTYNSKGQTLALTQQQRDLYQQEKARMGSAGLRVLALASGPELGQLTFLGLVG
FT                   IIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAIAIASRLGLYSKTSQSVSGEEVDTM
FT                   EVQHLSQIVPKVAVFYRASPRHKMKIIKSLQKNGAVVAMTGDGVNDAVALKAADIGVAM
FT                   GQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLA
FT                   TLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKI
FT                   LVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGL
FT                   CSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVSEIIKK
FT                   VERSREKVQKNAGSASSSFLEV"
FT   gene            complement(16304517..16304983)
FT                   /pseudo
FT                   /locus_tag="mCG_4450"
FT                   /note="gene_id=mCG4450.1"
FT   mRNA            complement(16304517..16304983)
FT                   /pseudo
FT                   /locus_tag="mCG_4450"
FT                   /note="gene_id=mCG4450.1 transcript_id=mCT3735.1 created on
FT                   11-JUL-2002"
FT   gene            complement(16318818..16319569)
FT                   /pseudo
FT                   /locus_tag="mCG_4451"
FT                   /note="gene_id=mCG4451.2"
FT   mRNA            complement(16318818..16319569)
FT                   /pseudo
FT                   /locus_tag="mCG_4451"
FT                   /note="gene_id=mCG4451.2 transcript_id=mCT3727.2 created on
FT                   07-AUG-2002"
FT   gene            16401776..16448486
FT                   /locus_tag="mCG_4618"
FT                   /note="gene_id=mCG4618.2"
FT   mRNA            join(16401776..16402547,16406067..16406200,
FT                   16407719..16408301,16411556..16411690,16413096..16413317,
FT                   16416714..16416887,16419877..16420022,16421581..16421784,
FT                   16426261..16426462,16427530..16427717,16428290..16428500,
FT                   16431209..16431374,16435592..16435756,16439158..16439369,
FT                   16443247..16443378,16446206..16446225,16446968..16447056,
FT                   16447185..16447293,16447954..16448486)
FT                   /locus_tag="mCG_4618"
FT                   /product="mCG4618"
FT                   /note="gene_id=mCG4618.2 transcript_id=mCT3741.2 created on
FT                   16-SEP-2002"
FT   CDS             join(16401815..16402547,16406067..16406200,
FT                   16407719..16408301,16411556..16411690,16413096..16413317,
FT                   16416714..16416887,16419877..16420022,16421581..16421784,
FT                   16426261..16426462,16427530..16427717,16428290..16428500,
FT                   16431209..16431374,16435592..16435756,16439158..16439369,
FT                   16443247..16443378,16446206..16446225,16446968..16447056,
FT                   16447185..16447293,16447954..16448124)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4618"
FT                   /product="mCG4618"
FT                   /note="gene_id=mCG4618.2 transcript_id=mCT3741.2
FT                   protein_id=mCP21255.2"
FT                   /protein_id="EDL21109.1"
FT                   /translation="MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKH
FT                   REGLVVVKVFAIQDPTLPLTSYKQELEELKIRLHSAQNCLPFQKAAEKASEKAAMLFRQ
FT                   YVRDNLYDRISTRPFLNNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVL
FT                   LTDFASFKPTYLPEDNPADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPL
FT                   VDLNSNQRARGELKRAMDIFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKI
FT                   EDRSIRDLVTQMINREPEKRLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSAD
FT                   ERILVIRKDLGNIIHNLCGHDLPEKAEGESRASGLVVLVSVITSCLQTLKSCDSKLAAL
FT                   ELILHLAPRLSVEILLDRITPYLLHFSNDSVPRVRAEALRTLTKVLALVQEVPRNDVNI
FT                   YPEYILPGIAHLAQDDATIVRLAYAENIALLAETALRFLELVQLKTLNMENEPDSEEVD
FT                   EATRPNGDYDTELQALHEMVQQKVVTLLSDPENIVKQTLMESGITRLCVFFGRQKANDV
FT                   LLSHMITFLNDKNDWHLRGAFFDSIVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKA
FT                   LNALTCMCQLGLLQKPHVYEFASDIAPFLCHPNLWIRYGAVGFITVVAHQISTADVYCK
FT                   LMPYLDPYITQPVIQIERKLVLLSVLKEPVSRSIFDYALRSKDIASLFRHLHMRQKKRN
FT                   GSLLDCPPPEDPTIAQLLKKLLSQGMTEEEEDKLLALKDFMMKSNRAKANAVDQSHLHD
FT                   SSQKGVIDLAALGITGRQVDLVKTKQEPDEKRARKHVKQDSNVNEEWKSMFGSLEPPNI
FT                   PQALPKTSDHEVVQPGKPPRSESSAGICVPLSTSPQVSEAAHIPSKKPVIPVVSSTVLP
FT                   STYQIRITTCKTELQQLIQQKREQCNAERIAKQMMENAEWESKPPPPGWRPKGLLVAHL
FT                   HEHKSAVNRIRVSDEHLLFATCSNDGTVKIWNSQKMEGKTTTTRSILTYSRIGGRVKTL
FT                   TFCQGSHYLAIASDNGAVQLLGIEASKLPKSPKIHPLQSRILDQKEDGCVVDMHHFNSG
FT                   AQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLKSGLITSFAVDIHQCWLCIGTSSGAMA
FT                   CWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWVIAAVQGNNEPSPHSVHGIYCSPADG
FT                   NPILLTAGSDMKIRFWDLVSPERSYVVAGSTGSPSVSYYKKIIEGTEVVQEIQNKQKVG
FT                   PSDDTPRRGPESLPVGHHDIITDIATFQTTQGFIVTASRDGIVKVWK"
FT   gene            complement(16449213..16462562)
FT                   /locus_tag="mCG_140811"
FT                   /note="gene_id=mCG140811.0"
FT   mRNA            complement(join(16449213..16450551,16458928..16459021,
FT                   16461891..16462562))
FT                   /locus_tag="mCG_140811"
FT                   /product="mCG140811"
FT                   /note="gene_id=mCG140811.0 transcript_id=mCT171631.0
FT                   created on 05-AUG-2002"
FT   CDS             complement(join(16450347..16450551,16458928..16459021,
FT                   16461891..16462443))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140811"
FT                   /product="mCG140811"
FT                   /note="gene_id=mCG140811.0 transcript_id=mCT171631.0
FT                   protein_id=mCP94550.0"
FT                   /protein_id="EDL21110.1"
FT                   /translation="MRDFLEALLDHFEITSEPETSVTGDRVALLSHAPLDFLPNTQRSP
FT                   VRTEFNLTSYSSKRLMKRHVDQAVQQLHGDAFLGHALGWALDNVFLNTPNLRRNKVIFV
FT                   ISAGETSHLDAETLKKESLRAKCHGYALFVFSLGPDWDDKELEDLASHPVDQHLIQLGR
FT                   IHKPDHGYSVKFVKSFINSIRHGINKYPPVNLKAKCNRLSSRDLKPPPRQFRSFVPGPQ
FT                   KANLKDHAAEAAKLFQDKKRLSSMLKGGRATISSLSRSTRYAFKQGKEAMKATSKLGKR
FT                   SA"
FT   gene            complement(16517257..16574033)
FT                   /gene="E330026B02Rik"
FT                   /locus_tag="mCG_140812"
FT                   /note="gene_id=mCG140812.0"
FT   mRNA            complement(join(16517257..16517608,16518867..16518920,
FT                   16519012..16519056,16521511..16521537,16521640..16521711,
FT                   16523351..16523404,16526075..16526229,16530303..16530381,
FT                   16530479..16530822,16538538..16539098,16541776..16542351,
FT                   16544837..16545394,16546128..16546688,16547854..16548474,
FT                   16549899..16550495,16553264..16553361,16573818..16574033))
FT                   /gene="E330026B02Rik"
FT                   /locus_tag="mCG_140812"
FT                   /product="RIKEN cDNA E330026B02"
FT                   /note="gene_id=mCG140812.0 transcript_id=mCT171632.0
FT                   created on 05-AUG-2002"
FT   CDS             complement(join(16517525..16517608,16518867..16518920,
FT                   16519012..16519056,16521511..16521537,16521640..16521711,
FT                   16523351..16523404,16526075..16526229,16530303..16530381,
FT                   16530479..16530822,16538538..16539098,16541776..16542351,
FT                   16544837..16545394,16546128..16546688,16547854..16548474,
FT                   16549899..16550495,16553264..16553324))
FT                   /codon_start=1
FT                   /gene="E330026B02Rik"
FT                   /locus_tag="mCG_140812"
FT                   /product="RIKEN cDNA E330026B02"
FT                   /note="gene_id=mCG140812.0 transcript_id=mCT171632.0
FT                   protein_id=mCP94551.0"
FT                   /protein_id="EDL21111.1"
FT                   /translation="MLLVLCLTMICFHMCVNQDSGPEYADVVFLVDSSDHLGLKSFPLV
FT                   KTFIHKMISSLPIEANKYRVALAQYSDALHNEFQLGTFKNRNPMLNHLKKNFGFIGGSL
FT                   KIGNALQEAHRTYFSAPTNGRDKKQFPPILVVLASAESEDDVEEAAKALREDGVKIISV
FT                   GVQKASEENLKAMATSQFHFNLRTARDLSVFAPNMTEIIKDVTQYREGMADDIIVEACQ
FT                   GPSVADVVFLLDMAINGSQEDLDHLKAFLGESISALDIKENCMRVGLVTYSNETRVISS
FT                   LSTGNNKTEVLQRIQDLSPQVGQAYTGAALRKTRKEIFSAQRGSRKNQGVPQIAVLVTH
FT                   RASEDNVTKAAVNLRREGVTIFTMGIEGANPDELEKIASHPAEQFTSKLGNFSELATHN
FT                   QTFLKKLRNQITHTVSVFSERTETLKSACVDTEEADIYLLIDGSGSTQPTDFHEMKTFL
FT                   SEVVGMFNIAPHKVRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAA
FT                   LNFTLKLLQRAKKERGSKVPCHLVVLTNGMSRDSVLGPAHKLREENIRVHAIGVKEANQ
FT                   MQLREIAGEEKRVYYVHDFDALRNIRNQVVQEICAEEACRDMKADIMFLVDSSGSIGPE
FT                   NFSKMKMFMKNLVSKSQIGADRVQIGVVQFSHENKEEFQLNTFMSQSDIANAIDRMTHI
FT                   GETTLTGSALTFVSQYFSPDKGARPNVRKFLILITDGEAQDIVRDPALALRKEGVIIYS
FT                   VGVFGSNVTQLEEISGKPEMVFYVENFDILQHIEDDLVLGICSPREECKRIEVLDVVFV
FT                   IDSSGSIDYQEYNIMKDFMIGLVKKADVGKNQVRFGALKYADDPEVLFYLDELGTKLEV
FT                   ISVLQNDHPMGGNTYTAEALAFSNHMFTEARGSRLHKGVPQVLIVITDGESHDAEKLNA
FT                   TAKALRDKGILVLAVGIAGANSWELLAMAGSGDKYYFVETFGGLKGIFSDVSASVCNSS
FT                   KVDCEIEKVDLVFLMDGSNSIHPDDFQKMKGFLVSVVQDFDVSLNRVRIGVAQFSDSYR
FT                   SEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKVKYYFQPDTGSRINAGTPQVLLV
FT                   LTDGRSQDEVAQAAEELRHKGVDIYSVGIGDVDDQELVQITGTAEKKLTVHNFDELKKV
FT                   KKRIVRNICTSGDCFVDVVVGFDISSLQRGQTLLEGQPWMGSYLQDLLRAISSLNGVSC
FT                   EVGTETQVSIAFQVTNAMERYPSKFEIYSENILSSLQGVTVNGPSRLNTNLLSSLWDTF
FT                   QNKSAARGKVVLLFSDGLDDGIEKLEQKSDELRKEGLNALITIAVDGAADSSDLADLLY
FT                   IEFGKGFEYRTQFTIGMRNLGSQLSRQLGPPGFKGSDGYLGEEGIAGERGASGPMGEQG
FT                   TKGCFGAKGPKGTRGLSGEEGEVGEDGLDGLDGEQGDHGIPGRRGEKGDEGSQGSPGRR
FT                   GAAGDRGAKGLRGDPVSAWAL"
FT   gene            complement(16624428..>16625763)
FT                   /locus_tag="mCG_1032911"
FT                   /note="gene_id=mCG1032911.0"
FT   mRNA            complement(join(16624428..16624700,16625564..>16625763))
FT                   /locus_tag="mCG_1032911"
FT                   /product="mCG1032911"
FT                   /note="gene_id=mCG1032911.0 transcript_id=mCT150615.0
FT                   created on 04-APR-2003"
FT   CDS             complement(join(16624635..16624700,16625564..>16625755))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032911"
FT                   /product="mCG1032911"
FT                   /note="gene_id=mCG1032911.0 transcript_id=mCT150615.0
FT                   protein_id=mCP68703.0"
FT                   /protein_id="EDL21112.1"
FT                   /translation="VLLPKKSCQHVNLETELFSNSVSKQTLKRKKNKTITTTPSLTQKL
FT                   ITVHFLLTVVSLSPGKHIKGFICLLPYVEFQDWGIKRMRK"
FT   gene            complement(16626006..>16659213)
FT                   /locus_tag="mCG_4444"
FT                   /note="gene_id=mCG4444.2"
FT   mRNA            complement(join(16626006..16626401,16632900..16633132,
FT                   16633819..16633915,16635216..16635905,16646885..16647093,
FT                   16649594..16649690,16652504..16653160,16653675..16653768,
FT                   16658726..>16659213))
FT                   /locus_tag="mCG_4444"
FT                   /product="mCG4444"
FT                   /note="gene_id=mCG4444.2 transcript_id=mCT3742.2 created on
FT                   11-JUL-2002"
FT   CDS             complement(join(16626382..16626401,16632900..16633132,
FT                   16633819..16633915,16635216..16635905,16646885..16647093,
FT                   16649594..16649690,16652504..16653160,16653675..16653768,
FT                   16658726..>16659211))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4444"
FT                   /product="mCG4444"
FT                   /note="gene_id=mCG4444.2 transcript_id=mCT3742.2
FT                   protein_id=mCP21267.2"
FT                   /protein_id="EDL21113.1"
FT                   /translation="KCPVYPTELVFALDQSSGITERRFNETRDTITSIVSDLNVRENNC
FT                   PVGARVAVVSYDSDTSYLIRGSDYHSKKHLLQLLSQIKYQVPRKARDIGNAMRFVARNV
FT                   FKRTSAGTNTRRVAVFFSNGQAASRASILTATMELSALDISLAVFAYNERVFLDEAFGF
FT                   DDTGTFQVIPVPPVGGYEPLEKLRRCTLCYDKCFPNTCAEEPFFPENSYMDVAFLLDNS
FT                   KNIASDDFQAVKALVSSVIDSFHITSNPSASESGDRVALLSYSPSESSRRKGRVKTEFA
FT                   FTTYDNQSIMKNYIYTSLQQLNGDATIGLALQWAMEGLFLGTPNPRKHKVIIVISAGEN
FT                   HEEKEFVKTVALRAKCQGYVVFVISLGSTQRDEMEELASYPLDHHLIQLGRMYKPDLNY
FT                   IVKFLKPFIYSVRRGFNQYPPPMLKDDCRLQTVELERGDTLPHGLRLTAKLREVPESTI
FT                   SLADQELNAGKDSSFVLEDHRGDHLVYVPSQMLEPHKLVSHYGNDRESVAMASLTSEHE
FT                   SHGREELGLAHEPGDASLQEYYMDVAFLIDASQRVGGRNEFKEVRTLITSVLDYFHIAP
FT                   APLTSVLGDRVAVLTYSPPGYLPNTEECPVYLEFDLVTYNTVHQMKHHLQESLQQLNGD
FT                   VFIGHALQWTVDNVFVGTPNLRKNKVIFIVTAGETNPLDKEVLRNASLRAKCQGYSIFV
FT                   FSFGPIHNDMELEELASHPLDHHLVRLGRVHRPDLDYVIKFIKPFVHSIRRAINKYPGR
FT                   DLQAKCDNLTFPGPENAGTEDSALLIPEVYRIEAGENELSGDSGSQEQHFFLLGNSHGN
FT                   HSESTADLMRQLYLLLSSGELMVNDKEEPCSAETPAPVNSKQDGEDAR"
FT   gene            complement(<16663876..>16728774)
FT                   /locus_tag="mCG_140659"
FT                   /note="gene_id=mCG140659.0"
FT   mRNA            complement(join(<16663876..16664170,16670384..16670402,
FT                   16673934..16673984,16674204..16674228,16676595..16677092,
FT                   16678816..16678878,16679829..16679891,16681383..16681445,
FT                   16690330..16690383,16690475..16690675,16690979..16691050,
FT                   16693521..16693564,16696285..16696377,16698322..16698464,
FT                   16700688..16700769,16700869..16701209,16703163..16703738,
FT                   16705880..16706455,16708925..16709479,16719855..16720415,
FT                   16722702..16723334,16728330..>16728774))
FT                   /locus_tag="mCG_140659"
FT                   /product="mCG140659"
FT                   /note="gene_id=mCG140659.0 transcript_id=mCT170568.0
FT                   created on 11-JUL-2002"
FT   CDS             complement(join(<16663876..16664170,16670384..16670402,
FT                   16673934..16673984,16674204..16674228,16676595..16677092,
FT                   16678816..16678878,16679829..16679891,16681383..16681445,
FT                   16690330..16690383,16690475..16690675,16690979..16691050,
FT                   16693521..16693564,16696285..16696377,16698322..16698464,
FT                   16700688..16700769,16700869..16701209,16703163..16703738,
FT                   16705880..16706455,16708925..16709479,16719855..16720415,
FT                   16722702..16723334,16728330..>16728333))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140659"
FT                   /product="mCG140659"
FT                   /note="gene_id=mCG140659.0 transcript_id=mCT170568.0
FT                   protein_id=mCP93487.0"
FT                   /protein_id="EDL21114.1"
FT                   /translation="FIPFPTSCQKDSLADLIFLVDESVGTTQNLRDLQNFLENVTSSVD
FT                   VKDNCMRLGLMSFSDRAQTISSLRSSANQSEFQQQIQKLSLQTGASNVGAAIEQMRKEG
FT                   FSESSGSRKAQGVPQIAVLVTHRASDDVVREAALDLRLEGVTMFAMGIEGANNTQLEDI
FT                   VSYPSRQSISTHSSYSHLESYSGNFLKKIHNEIWTQVSTRAEQMELDKTGCVDTKEADI
FT                   YFLIDGSSSIRKKEFEQIQVFMSSVIDMFPIGPNKVRVGVVQYSHKNEVEFPVSRYTDG
FT                   IDLKKAVFNIKQLKGLTFTGKALDFILPLIKKGKTERTDRAPCYLIVLTDGKSNDSVLE
FT                   PANRLRAEQITIHAIGIGEANKTQLRQIAGKDERVNFGQNFDSLKSIKNEIVHRICSEK
FT                   GCEDMKADIMFLVDSSGSIGPTNFETMKTFMKNLVGKIQIGADRSQVGVVQFSDYNREE
FT                   FQLNKYSTHEEIYAAIDRMSPINRNTLTGGALTFVNEYFDLSKGGRPQVRKFLILLTDG
FT                   KAQDEVGGPAMALRSKSVTIFSVGVYGANRAQLEEISGDGSLVFHVENFDHLKAIESKL
FT                   IFRVCALHDCKRIELLDIVFVLDHSGSIGPREQESMMNLTIHLVKKADIGRDRVQIGAL
FT                   TYSNHPEILFYLNTYSSGSAIAEHLRRPRDTGGETYTAKALQHSNILFTEEHGSRLTQN
FT                   VRQLMIVITDGVSHDRDKLDEAARELRDKGITIFAVGVGNANQDELETMAGKKENTVHV
FT                   DNFDKLRDIYLPLQETLCNNSQETCNLPEADVIFLCDGSDMVSDSEFVTMTTFLSDLID
FT                   NFDIESQRMKIGMAQYGSRYQEIIELESSLNKTQWKSQVHSVAQSKGLPHLDFALKHVS
FT                   DMFDPSVGGRRNAGVPQTLVVITSSSPRYDVTDSVKVLKDLGICVLALGIGDVYKEQLL
FT                   PITGNSEKIITFRDFNKLKNVDVKKRMVREICQSCGKANCFVDVVVGFDISTHRQGQPL
FT                   FQGHPRLESYLPGILEDITSIRGVSCGAGAEAQVSLAFKVNSDQEFPAKFQIYQKAAFD
FT                   SLLHVTVRGPTHLDAPFLQSLWDMFEERSASRGQVLLIFSDGLQGESITLLERQSDRLR
FT                   EAGLDALLVVSLNTFGHDEFSSFEFGKGFDYRTQLTIGMLDLGKTLSQYLGNIAERACC
FT                   CTFCKCPGIPGPHGTRGLQASKVQKVAEDTGERTETLEDEEKLGFKETEESWDALGLEV
FT                   KRESKDFQELRYCNSFSGKFDLLLRIHFLASSSQRPPGCFRTATSCTDFLSSLRGNTER
FT                   TGWMDWMEKKDFTDFVGERDKKVTLAIRGKQETQDLKVHKDLKDYKAHRDQVEIVEGKE
FT                   TKEVKVIRDLRVLLGQQDPEGILEDLDLGGERRTLCPLKEDLVSPQGGPCVPSRRTLCP
FT                   LKEDLVPPQGGPCAPSRRTLCPLKEDLVPPQGGPCAPSRRTLCPLKEDLVSPQGGPCAP
FT                   SRRTLCPLKEDLVPPQGGPCVPSRRTLCPLKEDLVSLARQTEQPRVALTLAELFYPLSR
FT                   GNLEFLEAQDQWGSLDSEESRGCRVELAKGDYGIPGYGQTGRKGVKLSQGLKDKCPVYP
FT                   TELVFALDQSSGITERRFNETRDTITSIVSDLNIRENNCPVGARVAVVSYDSDTSYLIR
FT                   GSDYHNKKHLLQLLSQIKYQVPRKARDIGNAM"
FT   gene            16744973..16750598
FT                   /locus_tag="mCG_4448"
FT                   /note="gene_id=mCG4448.2"
FT   mRNA            join(16744973..16745342,16749168..16750598)
FT                   /locus_tag="mCG_4448"
FT                   /product="mCG4448"
FT                   /note="gene_id=mCG4448.2 transcript_id=mCT3734.2 created on
FT                   11-JUL-2002"
FT   CDS             16749169..16749492
FT                   /codon_start=1
FT                   /locus_tag="mCG_4448"
FT                   /product="mCG4448"
FT                   /note="gene_id=mCG4448.2 transcript_id=mCT3734.2
FT                   protein_id=mCP21223.2"
FT                   /protein_id="EDL21115.1"
FT                   /translation="MKTTHFGYQKDSPEKSRLTKGILMSLVLVMSRASIIKREQRWGIM
FT                   STFPLPMTVMYNAQVFSCLFTTNWELGLALIQTALVLSGQVQMTDTINTLSASVTTVID
FT                   ELS"
FT   gene            complement(16778218..16886661)
FT                   /locus_tag="mCG_140660"
FT                   /note="gene_id=mCG140660.0"
FT   mRNA            complement(join(16778218..16778734,16783768..16783979,
FT                   16784977..16785073,16788056..16788739,16791012..16791102,
FT                   16801141..16801634,16804325..16804361,16805682..16805717,
FT                   16807230..16807292,16808369..16808431,16808533..16808568,
FT                   16810638..16810688,16813300..16813358,16814406..16814472,
FT                   16816149..16816211,16817926..16817988,16821826..16821861,
FT                   16821998..16822051,16828589..16828654,16829114..16829176,
FT                   16832263..16832316,16835763..16835807,16839696..16839767,
FT                   16850340..16850470,16851782..16851860,16853072..16853406,
FT                   16855517..16856071,16856714..16857259,16860762..16861406,
FT                   16864618..16865226,16866776..16867363,16869874..16870476,
FT                   16872838..16872926,16886581..16886661))
FT                   /locus_tag="mCG_140660"
FT                   /product="mCG140660"
FT                   /note="gene_id=mCG140660.0 transcript_id=mCT170569.0
FT                   created on 11-JUL-2002"
FT   CDS             complement(join(16778679..16778734,16783768..16783979,
FT                   16784977..16785073,16788056..16788739,16791012..16791102,
FT                   16801141..16801634,16804325..16804361,16805682..16805717,
FT                   16807230..16807292,16808369..16808431,16808533..16808568,
FT                   16810638..16810688,16813300..16813358,16814406..16814472,
FT                   16816149..16816211,16817926..16817988,16821826..16821861,
FT                   16821998..16822051,16828589..16828654,16829114..16829176,
FT                   16832263..16832316,16835763..16835807,16839696..16839767,
FT                   16850340..16850470,16851782..16851860,16853072..16853406,
FT                   16855517..16856071,16856714..16857259,16860762..16861406,
FT                   16864618..16865226,16866776..16867363,16869874..16870476,
FT                   16872838..16872913))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140660"
FT                   /product="mCG140660"
FT                   /note="gene_id=mCG140660.0 transcript_id=mCT170569.0
FT                   protein_id=mCP93486.0"
FT                   /protein_id="EDL21116.1"
FT                   /translation="MGTWKTFWLIISLAAGLGFVKSQRIVCREASVGDIVFLVHNSINP
FT                   QHAHSVRNFLYILANSLQVGRDNIRVGLAQYGDTPTSEFLLSVYHRKGDVLKHIRGLQF
FT                   KPGGNRMGQALQFILEHHFREGAGSRASQGVPQVAVVVSSGLTEDHIREPAEALRRAGI
FT                   LVYAIGVKDASQAELREISSSPKDNFTFFVPNFPGLPGLAQKLRPELCSTLGKAAQYTE
FT                   RESPACSEASPADIVFLVDSSTSIGLQNFQKVKHFLHSVVLGLDVRSDQVQVGLVQYSD
FT                   NIYPAFPLKQSSLKSAVLDRIRNLPYSMGGTSTGSALEFIRANSLTEMSGSRAKDGVPQ
FT                   IVVLVTDGESSDEVQDVADQLKRDGVFVFVVGINIQDVQELQKIASEPFEEFLFTTENF
FT                   SILQALSGTLLQALCSTVERQMKKSNKTYADVVFLIDTSQGTSQASFQWMQNFISRIIG
FT                   ILEVGQDKYQIGLAQYSDQGHTEFLFNTHKTRNEMVAHIHELLVFQGGSRKTGQGLRFL
FT                   HRTFFQEAAGSRLLQGVPQYVVVITSGKSEDEVGEVAQILRKRGVDIVSVGLQDFDRAE
FT                   LEGIGPVVLVSDLQGEDRIRQLMLDVNMFIQGSPKPPRVMTDVAKDAVEECLVPVPADL
FT                   VFLVEDFSSAGQPNFQRVVHFLTTTVHSLNIHPDTTRVSLVFYSEKPRLEFSLDMYQSA
FT                   AQVLSHLDRLTFQARRGRTKAGAALDFLRKEVFLPEKGSRPHRGVQQIAVVIMESPSLD
FT                   NVSTPASYLRRAGVTIYAAGIQPASESKDLEKIVTYPPWKHAIRLESFLQLSVVGNKLK
FT                   KKLCPEMLSRMPPLMSFIPESTRQSTQEGCESVEKADIYFLIDGSGSIKPNDFIEMKDF
FT                   MKEVIKMFHIGPDRVRFGVVQYSDKIISQFFLTQYASMAGLSAAIDNIQQEGGGTTTGK
FT                   ALSKMVPVFQNTARVDVARYLIVITDGQSTDPVAEAAQGLRDIGVNIYAIGVRDANTTE
FT                   LEEIASKKMFFIYEFDSLKSIHQEVIRDICSSENCKSQKADIIFLIDGSESIAPKDFEK
FT                   MKDFMERMVNQSNIGADEIQIGLLQFSSNPREEFRLNRYSSKVDMCRAILSVQQMSDGT
FT                   HTGKALNFTLPFFDSSRGGRPRVHQYLIVITDGVSQDNVAPPAKALRDRNIIIFAIGVG
FT                   NVQRAQLLEITNDQDKVFQEENFESLQSLEKEILSEVCSSQGCNIDLSVGVDTSTSSER
FT                   AQQELRRLLPELMQQLAFLSNISCEAPGQMEPRFRYVVPGSSDQPVFDSGFEKYSNEII
FT                   QKFLVHQGSVNNRMDVDFLQSLGETAIHLSLAKVKVLLVFTDGLDEDLERLRRTSEFLR
FT                   SREGKTTCDTGSVFQDTIVERTCCNMYAKCYGDDGIRGEPGSRGEQGQRGPRGLPGLRG
FT                   EEGCPGVRGPKGNPGEEGVGGLDGEQGDRGAAGPSGEKGSSGSRGLTGLPGPAGPRGEP
FT                   GLRGDPGDPGIDNLIQGPKGEKGRRGHQGSPGFHGPLGEAGSVGPRGSLGRHGLPGLKG
FT                   VLGETGELGSRGEPGHPGPQGPRGRQGPPGFFGQKGDPGTQGNPGPPGPSGSKGPDGPR
FT                   GLKAKVGPAGERGPRGQQGPRGQPGLFGPDGHGYPGRKGRKGEPGFPGYPGVQGEDGNP
FT                   GHGGEKGAKGIRGKRGNSGFPGLAGTPGDQGPPGKMGTKGSKGLADRTPCEIVDFVRGN
FT                   CRISRCPAFPMEVVFALDMSNDVSPSDFERMRNILLSLLMKLEMSESNCPTGARVAIVS
FT                   YNTRTDYLVRLSDHRGKAALLQAVRKIPLERSSGSRNLGATMRFVARHVFKRVRSGLLV
FT                   RKVAVFFQAGRNYDTASVSTATLELHAADIATAVVTFTEEHNLPEAGLVDGPNEFHLFT
FT                   WETEGQQDVERLASCTLCYDKCRPALGCQLRAPGPQDLDMDLVFLVDSSQGVSRDIYLG
FT                   ALRLVDSVLKDLEVAAQPGTSWHGARAALLTHTTPGFWPGVDQAPVLEYFHLTSHGHRT
FT                   EMQRQIREAASGLLQGGPALGHALEWTLENVLLTAVLPRRSRVLYAIVASETSIWDREK
FT                   LRTLSQEAKCKGIALFVLAVGPGVGAQELAELAKVASAPWEQHLLRLEGVSEAEVAYAS
FT                   RFTEAFLNLLNSGINQYPPPELVKECGGPNRGDTLLHFFTSAKRLSRSQSGTSAAFAND
FT                   SEALKSQGIFLGERKSRVASVALQEALGSHGKDRADTEDIDQETPAKGRHLGPTHGPCP
FT                   MGPEEGECLNYVLK"
FT   gene            complement(16909351..16909858)
FT                   /pseudo
FT                   /locus_tag="mCG_1032805"
FT                   /note="gene_id=mCG1032805.1"
FT   mRNA            complement(16909351..16909858)
FT                   /pseudo
FT                   /locus_tag="mCG_1032805"
FT                   /note="gene_id=mCG1032805.1 transcript_id=mCT150509.1
FT                   created on 05-AUG-2002"
FT   gene            16936448..16947440
FT                   /locus_tag="mCG_1051017"
FT                   /note="gene_id=mCG1051017.0"
FT   mRNA            join(16936448..16936507,16939064..16939129,
FT                   16940298..16940457,16940598..16940669,16940701..16940757,
FT                   16944023..16944247,16944724..16944965,16945616..16947440)
FT                   /locus_tag="mCG_1051017"
FT                   /product="mCG1051017"
FT                   /note="gene_id=mCG1051017.0 transcript_id=mCT194806.0
FT                   created on 27-JAN-2005"
FT   gene            complement(16940562..16945861)
FT                   /gene="6230410P16Rik"
FT                   /locus_tag="mCG_19518"
FT                   /note="gene_id=mCG19518.2"
FT   mRNA            complement(join(16940562..16943837,16944139..16944314,
FT                   16944876..16945027,16945223..16945638,16945775..16945861))
FT                   /gene="6230410P16Rik"
FT                   /locus_tag="mCG_19518"
FT                   /product="RIKEN cDNA 6230410P16"
FT                   /note="gene_id=mCG19518.2 transcript_id=mCT20211.2 created
FT                   on 05-AUG-2002"
FT   CDS             complement(join(16942971..16943837,16944139..16944314,
FT                   16944876..16945027,16945223..16945599))
FT                   /codon_start=1
FT                   /gene="6230410P16Rik"
FT                   /locus_tag="mCG_19518"
FT                   /product="RIKEN cDNA 6230410P16"
FT                   /note="gene_id=mCG19518.2 transcript_id=mCT20211.2
FT                   protein_id=mCP21292.1"
FT                   /protein_id="EDL21118.1"
FT                   /translation="MAAALQVLPCLLRAPSRPLLWGPPVARMTSGMALAEQARQLFDSA
FT                   VGAVQPGPMLQRTLSLDPSGRQLKVRDRTFQLRENLYLVGFGKAVLGMAAAAEELLAQH
FT                   LVQGVISVPKGIRAAMEHAGKKEMLLKPHSRVQVFEGAEDNLPDRDALRAALTIQQLAE
FT                   GLTADDLLLVLISGGGSALLPAPIPPVTLEEKQMLTKLLAARGATIQELNTIRKALSQL
FT                   KGGGLAQAAYPAQVISLILSDVIGDPLEVIASGPTVASAHSVQDCLHILNHYGLRAALP
FT                   RSVKTVLSRADSDPHGPHTCGHVLNVIIGSNSLALAEAQRQAEVLGYHAMVLSTAMQGD
FT                   VKRVARFYGLLARVAAAHLTPSLAERPLEEEAELHQLAAELQLPDLQLEEALEAVAKAK
FT                   GPVCLLAGGEPTVQLQGSGKGGRNQELALHVGVELGRQPLGPIDVLFLSGGTDGQDGPT
FT                   KVAGAWVMSDLISQASAESLDIATSLTNNDSYTFFCRFRGGTHLLHTGLTGTNVMDVHL
FT                   LILHPQ"
FT   CDS             join(16944812..16944965,16945616..16945662)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051017"
FT                   /product="mCG1051017"
FT                   /note="gene_id=mCG1051017.0 transcript_id=mCT194806.0
FT                   protein_id=mCP115835.0"
FT                   /protein_id="EDL21117.1"
FT                   /translation="MVLTSPCDHMVLGAPLSAGPTPEMSTSSRSSAVSPSASCWMVSAA
FT                   RSASRSAQPRVHSCLEREEKE"
FT   gene            16950023..16951089
FT                   /pseudo
FT                   /locus_tag="mCG_50456"
FT                   /note="gene_id=mCG50456.2"
FT   mRNA            16950023..16951089
FT                   /pseudo
FT                   /locus_tag="mCG_50456"
FT                   /note="gene_id=mCG50456.2 transcript_id=mCT50639.2 created
FT                   on 05-AUG-2002"
FT   gene            16959672..16980601
FT                   /locus_tag="mCG_19514"
FT                   /note="gene_id=mCG19514.2"
FT   mRNA            join(16959672..16960099,16965456..16965553,
FT                   16969406..16969472,16973329..16973428,16973893..16974009,
FT                   16974396..16974551,16974963..16975032,16975869..16976011,
FT                   16978078..16980601)
FT                   /locus_tag="mCG_19514"
FT                   /product="mCG19514, transcript variant mCT20207"
FT                   /note="gene_id=mCG19514.2 transcript_id=mCT20207.2 created
FT                   on 05-AUG-2002"
FT   mRNA            join(16959672..16960099,16965456..16965553,
FT                   16970305..16970371,16973329..16973428,16973893..16974009,
FT                   16974396..16974551,16974963..16975032,16975869..16976011,
FT                   16978078..16980601)
FT                   /locus_tag="mCG_19514"
FT                   /product="mCG19514, transcript variant mCT171617"
FT                   /note="gene_id=mCG19514.2 transcript_id=mCT171617.0 created
FT                   on 05-AUG-2002"
FT   CDS             join(16959939..16960099,16965456..16965553,
FT                   16969406..16969472,16973329..16973428,16973893..16974009,
FT                   16974396..16974551,16974963..16975032,16975869..16976011,
FT                   16978078..16978107)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19514"
FT                   /product="mCG19514, isoform CRA_b"
FT                   /note="gene_id=mCG19514.2 transcript_id=mCT20207.2
FT                   protein_id=mCP21278.2 isoform=CRA_b"
FT                   /db_xref="GOA:B2RXQ8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:1924555"
FT                   /db_xref="UniProtKB/TrEMBL:B2RXQ8"
FT                   /protein_id="EDL21120.1"
FT                   /translation="MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSI
FT                   VLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFP
FT                   GHSKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFA
FT                   AGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLID
FT                   AFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKH
FT                   TGPITCLQFNPKFMTFASACSNMAFWLPTIDD"
FT   CDS             join(16959939..16960099,16965456..16965553,
FT                   16970305..16970371,16973329..16973428,16973893..16974009,
FT                   16974396..16974551,16974963..16975032,16975869..16976011,
FT                   16978078..16978107)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19514"
FT                   /product="mCG19514, isoform CRA_a"
FT                   /note="gene_id=mCG19514.2 transcript_id=mCT171617.0
FT                   protein_id=mCP94536.0 isoform=CRA_a"
FT                   /db_xref="GOA:B2RXQ8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:1924555"
FT                   /db_xref="UniProtKB/TrEMBL:B2RXQ8"
FT                   /protein_id="EDL21119.1"
FT                   /translation="MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSI
FT                   VLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFP
FT                   GHSKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFA
FT                   AGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLID
FT                   AFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKH
FT                   TGPITCLQFNPKFMTFASACSNMAFWLPTIDD"
FT   gene            complement(16983598..>16987659)
FT                   /gene="Ppm1m"
FT                   /locus_tag="mCG_19525"
FT                   /note="gene_id=mCG19525.2"
FT   mRNA            complement(join(16983598..16984451,16984824..16984896,
FT                   16985223..16985374,16985486..16985593,16985804..16985867,
FT                   16986028..16986146,16986239..16986323,16986662..16986774,
FT                   16987177..16987431,16987536..>16987659))
FT                   /gene="Ppm1m"
FT                   /locus_tag="mCG_19525"
FT                   /product="protein phosphatase 1M, transcript variant
FT                   mCT20218"
FT                   /note="gene_id=mCG19525.2 transcript_id=mCT20218.2 created
FT                   on 05-AUG-2002"
FT   mRNA            complement(join(16983598..16984896,16985223..16985374,
FT                   16985486..16985593,16985804..16985867,16986028..16986146,
FT                   16986239..16986323,16986662..16986774,16987177..16987431,
FT                   16987536..>16987659))
FT                   /gene="Ppm1m"
FT                   /locus_tag="mCG_19525"
FT                   /product="protein phosphatase 1M, transcript variant
FT                   mCT171620"
FT                   /note="gene_id=mCG19525.2 transcript_id=mCT171620.0 created
FT                   on 05-AUG-2002"
FT   CDS             complement(join(16984440..16984451,16984824..16984896,
FT                   16985223..16985374,16985486..16985593,16985804..16985867,
FT                   16986028..16986146,16986239..16986323,16986662..16986774,
FT                   16987177..16987431,16987536..>16987658))
FT                   /codon_start=1
FT                   /gene="Ppm1m"
FT                   /locus_tag="mCG_19525"
FT                   /product="protein phosphatase 1M, isoform CRA_b"
FT                   /note="gene_id=mCG19525.2 transcript_id=mCT20218.2
FT                   protein_id=mCP21393.2 isoform=CRA_b"
FT                   /protein_id="EDL21122.1"
FT                   /translation="VINAEKSEFNEDQAACGKLCIRRCEFGIEEDQEWLTVCPEEFLTG
FT                   HYWALFDGHGGPAAAILAANTLHSCLRRQLEAVVEGMMAPQPPMHLSGRCVCPSDPQFV
FT                   EEKGIQAEDLVIGALENAFQECDDVIGRELEASGQVGGCTALVAVFLQGKLYVANAGDS
FT                   RAILVRRHEIRQLSSEFTPETERQRIQQLAFTYPELLAGEFTRLEFPRRLKGDDLGQKV
FT                   LFRDHHMRGWSYKRVEKSDLKYPLIHGQGRQARLLGTLAVSRGLGDHQLRVLDTDIQLK
FT                   PFLLSIPQVTVLDVHQLAVQEEDVVVMATDGLWDVLSNEQVALLVRSFLTGNQKDDPHR
FT                   FSELAKMLIHNTQGKDNGATGEGQAPS"
FT   CDS             complement(join(16984752..16984896,16985223..16985374,
FT                   16985486..16985593,16985804..16985867,16986028..16986146,
FT                   16986239..16986323,16986662..16986774,16987177..16987431,
FT                   16987536..>16987658))
FT                   /codon_start=1
FT                   /gene="Ppm1m"
FT                   /locus_tag="mCG_19525"
FT                   /product="protein phosphatase 1M, isoform CRA_a"
FT                   /note="gene_id=mCG19525.2 transcript_id=mCT171620.0
FT                   protein_id=mCP94539.0 isoform=CRA_a"
FT                   /protein_id="EDL21121.1"
FT                   /translation="VINAEKSEFNEDQAACGKLCIRRCEFGIEEDQEWLTVCPEEFLTG
FT                   HYWALFDGHGGPAAAILAANTLHSCLRRQLEAVVEGMMAPQPPMHLSGRCVCPSDPQFV
FT                   EEKGIQAEDLVIGALENAFQECDDVIGRELEASGQVGGCTALVAVFLQGKLYVANAGDS
FT                   RAILVRRHEIRQLSSEFTPETERQRIQQLAFTYPELLAGEFTRLEFPRRLKGDDLGQKV
FT                   LFRDHHMRGWSYKRVEKSDLKYPLIHGQGRQARLLGTLAVSRGLGDHQLRVLDTDIQLK
FT                   PFLLSIPQVTVLDVHQLAVQEEDVVVMATDGLWDVLSNEQVALLVRSFLTGNQKDDPHR
FT                   FSELAKMLIHNTQGKDNGATGEGQVSYDDVSVFVIPLHSQAQEGSGH"
FT   gene            16992403..17004891
FT                   /gene="Ptk9l"
FT                   /locus_tag="mCG_19506"
FT                   /note="gene_id=mCG19506.2"
FT   mRNA            join(16992403..16992579,16996208..16996285,
FT                   17001208..17001386,17001745..17001840,17002237..17002341,
FT                   17002443..17002568,17003603..17003753,17003858..17003979,
FT                   17004330..17004891)
FT                   /gene="Ptk9l"
FT                   /locus_tag="mCG_19506"
FT                   /product="protein tyrosine kinase 9-like (A6-related
FT                   protein), transcript variant mCT20032"
FT                   /note="gene_id=mCG19506.2 transcript_id=mCT20032.2 created
FT                   on 12-JUL-2002"
FT   mRNA            join(16992432..16992579,16993205..16993542,
FT                   16996208..16996285,17001208..17001386,17001745..17001840,
FT                   17002237..17002341,17002443..17002568,17003603..17003753,
FT                   17003858..17003979,17004330..17004891)
FT                   /gene="Ptk9l"
FT                   /locus_tag="mCG_19506"
FT                   /product="protein tyrosine kinase 9-like (A6-related
FT                   protein), transcript variant mCT124541"
FT                   /note="gene_id=mCG19506.2 transcript_id=mCT124541.1 created
FT                   on 12-JUL-2002"
FT   CDS             join(16992555..16992579,16996208..16996285,
FT                   17001208..17001386,17001745..17001840,17002237..17002341,
FT                   17002443..17002568,17003603..17003753,17003858..17003979,
FT                   17004330..17004497)
FT                   /codon_start=1
FT                   /gene="Ptk9l"
FT                   /locus_tag="mCG_19506"
FT                   /product="protein tyrosine kinase 9-like (A6-related
FT                   protein), isoform CRA_b"
FT                   /note="gene_id=mCG19506.2 transcript_id=mCT20032.2
FT                   protein_id=mCP21395.2 isoform=CRA_b"
FT                   /protein_id="EDL21124.1"
FT                   /translation="MAHQTGIHATEELKEFFAKARAGSIRLIKVIIEDEQLVLGASQEP
FT                   VGRWDQDYDRAVLPLLDAQEPCYLLFRLDSQNAQGFEWLFLAWSPDNSPVRLKMLYAAT
FT                   RATVKKEFGGGHIKDELFGTVKDDLSLAGYQKHLSSCAAPAPLTSAERELQQIRINEVK
FT                   TEISVESKHQTLQGLAFPLQPEAQRALQQLKQKTVNYIQLKLDLERETIELVHTEPTNV
FT                   AQLPSRIPRDAARYHFFLYKHTHEGDALESVVFIYSMPGYKCSIKERMLYSSCKSRLLD
FT                   SVEQDFQLEIAKKIEIGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIR
FT                   GPGENGEDS"
FT   CDS             join(17001757..17001840,17002237..17002341,
FT                   17002443..17002568,17003603..17003753,17003858..17003979,
FT                   17004330..17004497)
FT                   /codon_start=1
FT                   /gene="Ptk9l"
FT                   /locus_tag="mCG_19506"
FT                   /product="protein tyrosine kinase 9-like (A6-related
FT                   protein), isoform CRA_a"
FT                   /note="gene_id=mCG19506.2 transcript_id=mCT124541.1
FT                   protein_id=mCP68551.1 isoform=CRA_a"
FT                   /protein_id="EDL21123.1"
FT                   /translation="MLYAATRATVKKEFGGGHIKDELFGTVKDDLSLAGYQKHLSSCAA
FT                   PAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAFPLQPEAQRALQQLKQKTVNYIQ
FT                   LKLDLERETIELVHTEPTNVAQLPSRIPRDAARYHFFLYKHTHEGDALESVVFIYSMPG
FT                   YKCSIKERMLYSSCKSRLLDSVEQDFQLEIAKKIEIGDGAELTAEFLYDEVHPKQHAFK
FT                   QAFAKPKGPGGKRGHKRLIRGPGENGEDS"
FT   gene            17012608..17016885
FT                   /gene="Tlr9"
FT                   /locus_tag="mCG_60242"
FT                   /note="gene_id=mCG60242.1"
FT   mRNA            join(17012608..17012716,17013524..17016885)
FT                   /gene="Tlr9"
FT                   /locus_tag="mCG_60242"
FT                   /product="toll-like receptor 9"
FT                   /note="gene_id=mCG60242.1 transcript_id=mCT60425.1 created
FT                   on 12-JUL-2002"
FT   CDS             join(17012714..17012716,17013524..17016619)
FT                   /codon_start=1
FT                   /gene="Tlr9"
FT                   /locus_tag="mCG_60242"
FT                   /product="toll-like receptor 9"
FT                   /note="gene_id=mCG60242.1 transcript_id=mCT60425.1
FT                   protein_id=mCP41298.2"
FT                   /protein_id="EDL21125.1"
FT                   /translation="MVLRRRTLHPLSLLVQAAVLAETLALGTLPAFLPCELKPHGLVDC
FT                   NWLFLKSVPRFSAAASCSNITRLSLISNRIHHLHNSDFVHLSNLRQLNLKWNCPPTGLS
FT                   PLHFSCHMTIEPRTFLAMRTLEELNLSYNGITTVPRLPSSLVNLSLSHTNILVLDANSL
FT                   AGLYSLRVLFMDGNCYYKNPCTGAVKVTPGALLGLSNLTHLSLKYNNLTKVPRQLPPSL
FT                   EYLLVSYNLIVKLGPEDLANLTSLRVLDVGGNCRRCDHAPNPCIECGQKSLHLHPETFH
FT                   HLSHLEGLVLKDSSLHTLNSSWFQGLVNLSVLDLSENFLYESINHTNAFQNLTRLRKLN
FT                   LSFNYRKKVSFARLHLASSFKNLVSLQELNMNGIFFRSLNKYTLRWLADLPKLHTLHLQ
FT                   MNFINQAQLSIFGTFRALRFVDLSDNRISGPSTLSEATPEEADDAEQEELLSADPHPAP
FT                   LSTPASKNFMDRCKNFKFTMDLSRNNLVTIKPEMFVNLSRLQCLSLSHNSIAQAVNGSQ
FT                   FLPLTNLQVLDLSHNKLDLYHWKSFSELPQLQALDLSYNSQPFSMKGIGHNFSFVAHLS
FT                   MLHSLSLAHNDIHTRVSSHLNSNSVRFLDFSGNGMGRMWDEGGLYLHFFQGLSGLLKLD
FT                   LSQNNLHILRPQNLDNLPKSLKLLSLRDNYLSFFNWTSLSFLPNLEVLDLAGNQLKALT
FT                   NGTLPNGTLLQKLDVSSNSIVSVVPAFFALAVELKEVNLSHNILKTVDRSWFGPIVMNL
FT                   TVLDVRSNPLHCACGAAFVDLLLEVQTKVPGLANGVKCGSPGQLQGRSIFAQDLRLCLD
FT                   EVLSWDCFGLSLLAVAVGMVVPILHHLCGWDVWYCFHLCLAWLPLLARSRRSAQALPYD
FT                   AFVVFDKAQSAVADWVYNELRVRLEERRGRRALRLCLEDRDWLPGQTLFENLWASIYGS
FT                   RKTLFVLAHTDRVSGLLRTSFLLAQQRLLEDRKDVVVLVILRPDAHRSRYVRLRQRLCR
FT                   QSVLFWPQQPNGQGGFWAQLSTALTRDNRHFYNQNFCRGPTAE"
FT   gene            complement(17025820..17038612)
FT                   /gene="Alas1"
FT                   /locus_tag="mCG_19529"
FT                   /note="gene_id=mCG19529.2"
FT   mRNA            complement(join(17025820..17025982,17026859..17027127,
FT                   17028495..17028659,17029063..17029242,17032409..17032631,
FT                   17032929..17033078,17034491..17034724,17037491..17037710,
FT                   17038516..17038612))
FT                   /gene="Alas1"
FT                   /locus_tag="mCG_19529"
FT                   /product="aminolevulinic acid synthase 1"
FT                   /note="gene_id=mCG19529.2 transcript_id=mCT20222.2 created
FT                   on 05-AUG-2002"
FT   CDS             complement(join(17029236..17029242,17032409..17032631,
FT                   17032929..17033078,17034491..17034724,17037491..17037689))
FT                   /codon_start=1
FT                   /gene="Alas1"
FT                   /locus_tag="mCG_19529"
FT                   /product="aminolevulinic acid synthase 1"
FT                   /note="gene_id=mCG19529.2 transcript_id=mCT20222.2
FT                   protein_id=mCP21310.2"
FT                   /protein_id="EDL21126.1"
FT                   /translation="METVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAP
FT                   RTLSTSAVHCQQVKETPPANEKEKTAKAAVQQAPDESQMAQTPDGTQLPSGHPSPATSQ
FT                   GSGSKCPFLAAQLSQTGSSVFRKASLELQEDVQEMHAVRKEAAQSPVPPSLVNVKTDGE
FT                   DPSRLLKNFQDIMRKQRPERVSHLLQDNLPKSVSTFQYDHFFEKKIDEKKNDHTYRVFK
FT                   TVNRRAQIFPMADDYTDSLITKKQVSVWCSNDYLGMSRHPRVCGAVML"
FT   gene            17038692..17039850
FT                   /locus_tag="mCG_140808"
FT                   /note="gene_id=mCG140808.0"
FT   mRNA            join(17038692..17038806,17039037..17039307,
FT                   17039518..17039850)
FT                   /locus_tag="mCG_140808"
FT                   /product="mCG140808"
FT                   /note="gene_id=mCG140808.0 transcript_id=mCT171621.0
FT                   created on 05-AUG-2002"
FT   CDS             join(17038757..17038806,17039037..17039172)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140808"
FT                   /product="mCG140808"
FT                   /note="gene_id=mCG140808.0 transcript_id=mCT171621.0
FT                   protein_id=mCP94540.0"
FT                   /protein_id="EDL21127.1"
FT                   /translation="MSQAYAAGAKSAGRWTGPSLLHGWMAQEYNGPGEDALRGCGHWFE
FT                   EAATEGSPVEARSCRN"
FT   gene            17072398..17140886
FT                   /gene="Wdr51a"
FT                   /locus_tag="mCG_19513"
FT                   /note="gene_id=mCG19513.2"
FT   mRNA            join(17072398..17072743,17074122..17074206,
FT                   17076154..17076325,17076666..17076845,17078093..17078200,
FT                   17079209..17079324,17086374..17086507,17096475..17096543,
FT                   17099138..17099230,17120937..17121080,17140687..17140886)
FT                   /gene="Wdr51a"
FT                   /locus_tag="mCG_19513"
FT                   /product="WD repeat domain 51A, transcript variant
FT                   mCT20206"
FT                   /note="gene_id=mCG19513.2 transcript_id=mCT20206.2 created
FT                   on 05-AUG-2002"
FT   mRNA            join(<17072667..17072743,17074125..17074206,
FT                   17076154..17076325,17076666..17076845,17078093..17078200,
FT                   17079209..17079324,17086374..17086507,17096475..17096543,
FT                   17099138..17099230,17140687..17140881)
FT                   /gene="Wdr51a"
FT                   /locus_tag="mCG_19513"
FT                   /product="WD repeat domain 51A, transcript variant
FT                   mCT191507"
FT                   /note="gene_id=mCG19513.2 transcript_id=mCT191507.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<17072669..17072743,17074125..17074206,
FT                   17076154..17076325,17076666..17076845,17078093..17078200,
FT                   17079209..17079324,17086374..17086507,17096475..17096543,
FT                   17099138..17099230,17140687..17140785)
FT                   /codon_start=1
FT                   /gene="Wdr51a"
FT                   /locus_tag="mCG_19513"
FT                   /product="WD repeat domain 51A, isoform CRA_a"
FT                   /note="gene_id=mCG19513.2 transcript_id=mCT191507.0
FT                   protein_id=mCP112509.0 isoform=CRA_a"
FT                   /protein_id="EDL21128.1"
FT                   /translation="PSYLWHLGHSWSYQPASPTMAAPSQDPSLERHFKGHRDAVTCVDF
FT                   SLNTKHLASGSMDSTLMIWHMKSQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVR
FT                   IWVPNVKGESTVFRAHTATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHI
FT                   NWVRCAKFSPDGRLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAA
FT                   AGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRL
FT                   LYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKSNFDIVDYGDMKARRPPPLTSSS
FT                   GTLTVSILEQRLTLTEDRLKQCLENQQLIMQRTPP"
FT   CDS             join(17072726..17072743,17074122..17074206,
FT                   17076154..17076325,17076666..17076845,17078093..17078200,
FT                   17079209..17079324,17086374..17086507,17096475..17096543,
FT                   17099138..17099230,17120937..17121080,17140687..17140785)
FT                   /codon_start=1
FT                   /gene="Wdr51a"
FT                   /locus_tag="mCG_19513"
FT                   /product="WD repeat domain 51A, isoform CRA_b"
FT                   /note="gene_id=mCG19513.2 transcript_id=mCT20206.2
FT                   protein_id=mCP21266.2 isoform=CRA_b"
FT                   /protein_id="EDL21129.1"
FT                   /translation="MAAPSQEDPSLERHFKGHRDAVTCVDFSLNTKHLASGSMDSTLMI
FT                   WHMKSQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTA
FT                   TVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSA
FT                   SDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDARTHRLL
FT                   QHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSR
FT                   TGEYFASGGSDEQVMVWKSNFDIVDYGDMKARRPPPLTSSSGTLPKMDLPVPPGRDRSL
FT                   ESVQGEPQESISMPQTLTSTLEHIVGQLDILTQTVSILEQRLTLTEDRLKQCLENQQLI
FT                   MQRTPP"
FT   gene            17156714..17159434
FT                   /locus_tag="mCG_123319"
FT                   /note="gene_id=mCG123319.1"
FT   mRNA            join(17156714..17156785,17157018..17157130,
FT                   17157224..17157281,17157476..17157650,17157783..17157964,
FT                   17158350..17159434)
FT                   /locus_tag="mCG_123319"
FT                   /product="mCG123319, transcript variant mCT124551"
FT                   /note="gene_id=mCG123319.1 transcript_id=mCT124551.1
FT                   created on 05-AUG-2002"
FT   mRNA            join(17156715..17156847,17158350..17159434)
FT                   /locus_tag="mCG_123319"
FT                   /product="mCG123319, transcript variant mCT171599"
FT                   /note="gene_id=mCG123319.1 transcript_id=mCT171599.0
FT                   created on 05-AUG-2002"
FT   CDS             17158764..17159057
FT                   /codon_start=1
FT                   /locus_tag="mCG_123319"
FT                   /product="mCG123319, isoform CRA_a"
FT                   /note="gene_id=mCG123319.1 transcript_id=mCT124551.1
FT                   protein_id=mCP68782.1 isoform=CRA_a"
FT                   /protein_id="EDL21130.1"
FT                   /translation="MYLLSPTRLRARTARWTRPRPLPAGWTRRGTRLLSPQPLSAAIDY
FT                   LPSSCPPTAKLDWCLEREVGEGKLIMERSLPPTRPNRKVTWRFTPGQSPPHL"
FT   CDS             17158764..17159057
FT                   /codon_start=1
FT                   /locus_tag="mCG_123319"
FT                   /product="mCG123319, isoform CRA_a"
FT                   /note="gene_id=mCG123319.1 transcript_id=mCT171599.0
FT                   protein_id=mCP94518.0 isoform=CRA_a"
FT                   /protein_id="EDL21131.1"
FT                   /translation="MYLLSPTRLRARTARWTRPRPLPAGWTRRGTRLLSPQPLSAAIDY
FT                   LPSSCPPTAKLDWCLEREVGEGKLIMERSLPPTRPNRKVTWRFTPGQSPPHL"
FT   gene            17159758..17166774
FT                   /gene="Dusp7"
FT                   /locus_tag="mCG_140802"
FT                   /note="gene_id=mCG140802.0"
FT   mRNA            join(17159758..17160342,17161713..17162147,
FT                   17164659..17166774)
FT                   /gene="Dusp7"
FT                   /locus_tag="mCG_140802"
FT                   /product="dual specificity phosphatase 7"
FT                   /note="gene_id=mCG140802.0 transcript_id=mCT171600.0
FT                   created on 05-AUG-2002"
FT   CDS             join(17159820..17160342,17161713..17162147,
FT                   17164659..17164966)
FT                   /codon_start=1
FT                   /gene="Dusp7"
FT                   /locus_tag="mCG_140802"
FT                   /product="dual specificity phosphatase 7"
FT                   /note="gene_id=mCG140802.0 transcript_id=mCT171600.0
FT                   protein_id=mCP94519.0 partial"
FT                   /protein_id="EDL21132.1"
FT                   /translation="MKNQLRGPPVRAHMSTSGAAAAAAGGTRAGSEPGAGSGSGAGIGA
FT                   GATTGAGAMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIETAINLAIPGLMLR
FT                   RLRKGNLPIRSIIPNHADKERFATRCKAATVLLYDEATAEWQPEPGAPASVLGLLLQKL
FT                   RDDGCQAYYLQGGFNKFQTEYSEHCETNVDSSSSPSGSPPTSVLGLGGLRISSDCSDGE
FT                   SDRELPSSATESDGSPVPSSQPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYILNVTP
FT                   NLPNAFEHGGEFTYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRS
FT                   VTVTVAYLMQKMNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLSSPCDNHAPS
FT                   EQLYFSTPTNHNLFPINTLEST"
FT   gene            17220600..17222692
FT                   /locus_tag="mCG_19505"
FT                   /note="gene_id=mCG19505.2"
FT   mRNA            join(17220600..17220692,17221088..17221132,
FT                   17221431..17221495,17222175..17222692)
FT                   /locus_tag="mCG_19505"
FT                   /product="mCG19505, transcript variant mCT20031"
FT                   /note="gene_id=mCG19505.2 transcript_id=mCT20031.2 created
FT                   on 12-JUL-2002"
FT   mRNA            join(17220655..17220755,17221088..17221132,
FT                   17221431..17221495,17222175..17222692)
FT                   /locus_tag="mCG_19505"
FT                   /product="mCG19505, transcript variant mCT170564"
FT                   /note="gene_id=mCG19505.2 transcript_id=mCT170564.0 created
FT                   on 12-JUL-2002"
FT   CDS             join(17221096..17221132,17221431..17221495,
FT                   17222175..17222555)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19505"
FT                   /product="mCG19505, isoform CRA_a"
FT                   /note="gene_id=mCG19505.2 transcript_id=mCT170564.0
FT                   protein_id=mCP93482.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5M8M8"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M8M8"
FT                   /protein_id="EDL21133.1"
FT                   /translation="MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRF
FT                   AKKHNKKGLKKMQANNAKAVSARAEAIKALVKPQAIKPKMPKGPKLKRLAFIAHPKLGK
FT                   RIRSYMAKGQRLCQPKPKVQTKAGAKAPAKAQASAPAQAPKGAQAPKGAQAPVKAP"
FT   CDS             join(17221096..17221132,17221431..17221495,
FT                   17222175..17222555)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19505"
FT                   /product="mCG19505, isoform CRA_a"
FT                   /note="gene_id=mCG19505.2 transcript_id=mCT20031.2
FT                   protein_id=mCP21385.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q5M8M8"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M8M8"
FT                   /protein_id="EDL21134.1"
FT                   /translation="MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRF
FT                   AKKHNKKGLKKMQANNAKAVSARAEAIKALVKPQAIKPKMPKGPKLKRLAFIAHPKLGK
FT                   RIRSYMAKGQRLCQPKPKVQTKAGAKAPAKAQASAPAQAPKGAQAPKGAQAPVKAP"
FT   gene            complement(17224104..17229324)
FT                   /gene="Acy1"
FT                   /locus_tag="mCG_19524"
FT                   /note="gene_id=mCG19524.1"
FT   mRNA            complement(join(17224104..17224353,17224445..17224505,
FT                   17224650..17224729,17225617..17225685,17225772..17225916,
FT                   17226047..17226096,17226178..17226251,17226550..17226606,
FT                   17226697..17226786,17226865..17226941,17227209..17227303,
FT                   17227973..17228040,17228716..17228824,17229220..17229324))
FT                   /gene="Acy1"
FT                   /locus_tag="mCG_19524"
FT                   /product="aminoacylase 1"
FT                   /note="gene_id=mCG19524.1 transcript_id=mCT20217.1 created
FT                   on 12-JUL-2002"
FT   CDS             complement(join(17224189..17224353,17224445..17224505,
FT                   17224650..17224729,17225617..17225685,17225772..17225916,
FT                   17226047..17226096,17226178..17226251,17226550..17226606,
FT                   17226697..17226786,17226865..17226941,17227209..17227303,
FT                   17227973..17228040,17228716..17228809))
FT                   /codon_start=1
FT                   /gene="Acy1"
FT                   /locus_tag="mCG_19524"
FT                   /product="aminoacylase 1"
FT                   /note="gene_id=mCG19524.1 transcript_id=mCT20217.1
FT                   protein_id=mCP21374.2"
FT                   /protein_id="EDL21135.1"
FT                   /translation="MTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQL
FT                   GLSCQKIEVEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRT
FT                   IHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWVR
FT                   VTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKL
FT                   EGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMT
FT                   PTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHD
FT                   HNERLHEDIFLRGVDIYTGLLSALASVPTLPGES"
FT   gene            complement(17231153..17238543)
FT                   /gene="Abhd14a"
FT                   /locus_tag="mCG_49493"
FT                   /note="gene_id=mCG49493.2"
FT   mRNA            complement(join(17231153..17231504,17231706..17231941,
FT                   17234868..17234983,17235131..17235344,17236554..17236740,
FT                   17238424..17238543))
FT                   /gene="Abhd14a"
FT                   /locus_tag="mCG_49493"
FT                   /product="abhydrolase domain containing 14A, transcript
FT                   variant mCT49676"
FT                   /note="gene_id=mCG49493.2 transcript_id=mCT49676.2 created
FT                   on 05-AUG-2002"
FT   mRNA            complement(join(17231153..17231504,17231706..17231941,
FT                   17234868..17234983,17235131..17235344,17236554..17236740,
FT                   17238418..17238457))
FT                   /gene="Abhd14a"
FT                   /locus_tag="mCG_49493"
FT                   /product="abhydrolase domain containing 14A, transcript
FT                   variant mCT171629"
FT                   /note="gene_id=mCG49493.2 transcript_id=mCT171629.0 created
FT                   on 05-AUG-2002"
FT   mRNA            complement(join(17231153..17231504,17231706..17231941,
FT                   17234868..17234983,17235131..17235344,17236554..17236740,
FT                   17238420..17238449))
FT                   /gene="Abhd14a"
FT                   /locus_tag="mCG_49493"
FT                   /product="abhydrolase domain containing 14A, transcript
FT                   variant mCT171627"
FT                   /note="gene_id=mCG49493.2 transcript_id=mCT171627.0 created
FT                   on 05-AUG-2002"
FT   mRNA            complement(join(17231153..17231504,17231706..17231941,
FT                   17234868..17234983,17235131..17235344,17236554..17236740,
FT                   17238282..17238336))
FT                   /gene="Abhd14a"
FT                   /locus_tag="mCG_49493"
FT                   /product="abhydrolase domain containing 14A, transcript
FT                   variant mCT171628"
FT                   /note="gene_id=mCG49493.2 transcript_id=mCT171628.0 created
FT                   on 05-AUG-2002"
FT   CDS             complement(join(17231322..17231504,17231706..17231941,
FT                   17234868..17234983,17235131..17235339))
FT                   /codon_start=1
FT                   /gene="Abhd14a"
FT                   /locus_tag="mCG_49493"
FT                   /product="abhydrolase domain containing 14A, isoform CRA_a"
FT                   /note="gene_id=mCG49493.2 transcript_id=mCT171627.0
FT                   protein_id=mCP94548.0 isoform=CRA_a"
FT                   /protein_id="EDL21136.1"
FT                   /translation="MVQKFMSRYQAALLGLGLLLVFLLYMGLPGPPEQTSRLWRGPNVT
FT                   VLTGLTRGNSRIFYREVLPIQQACRAEVVFLHGKAFNSHTWEQLGTLQLLSERGYRAVA
FT                   IDLPGFGNSAPSEEVSTEAGRVELLERVFQDLQVQNTVLVSPSLSGSYALPFLMQNHHQ
FT                   LRGFVPIAPTYTRNYAQEQFRAVKTPTLILYGELDHTLARESLQQLRHLPNHSMVKLRD
FT                   AGHACYLHKPEAFHLALLAFLDHLP"
FT   CDS             complement(join(17231322..17231504,17231706..17231941,
FT                   17234868..17234983,17235131..17235339))
FT                   /codon_start=1
FT                   /gene="Abhd14a"
FT                   /locus_tag="mCG_49493"
FT                   /product="abhydrolase domain containing 14A, isoform CRA_a"
FT                   /note="gene_id=mCG49493.2 transcript_id=mCT171628.0
FT                   protein_id=mCP94546.0 isoform=CRA_a"
FT                   /protein_id="EDL21137.1"
FT                   /translation="MVQKFMSRYQAALLGLGLLLVFLLYMGLPGPPEQTSRLWRGPNVT
FT                   VLTGLTRGNSRIFYREVLPIQQACRAEVVFLHGKAFNSHTWEQLGTLQLLSERGYRAVA
FT                   IDLPGFGNSAPSEEVSTEAGRVELLERVFQDLQVQNTVLVSPSLSGSYALPFLMQNHHQ
FT                   LRGFVPIAPTYTRNYAQEQFRAVKTPTLILYGELDHTLARESLQQLRHLPNHSMVKLRD
FT                   AGHACYLHKPEAFHLALLAFLDHLP"
FT   CDS             complement(join(17231322..17231504,17231706..17231941,
FT                   17234868..17234983,17235131..17235339))
FT                   /codon_start=1
FT                   /gene="Abhd14a"
FT                   /locus_tag="mCG_49493"
FT                   /product="abhydrolase domain containing 14A, isoform CRA_a"
FT                   /note="gene_id=mCG49493.2 transcript_id=mCT171629.0
FT                   protein_id=mCP94547.0 isoform=CRA_a"
FT                   /protein_id="EDL21138.1"
FT                   /translation="MVQKFMSRYQAALLGLGLLLVFLLYMGLPGPPEQTSRLWRGPNVT
FT                   VLTGLTRGNSRIFYREVLPIQQACRAEVVFLHGKAFNSHTWEQLGTLQLLSERGYRAVA
FT                   IDLPGFGNSAPSEEVSTEAGRVELLERVFQDLQVQNTVLVSPSLSGSYALPFLMQNHHQ
FT                   LRGFVPIAPTYTRNYAQEQFRAVKTPTLILYGELDHTLARESLQQLRHLPNHSMVKLRD
FT                   AGHACYLHKPEAFHLALLAFLDHLP"
FT   CDS             complement(join(17231322..17231504,17231706..17231941,
FT                   17234868..17234983,17235131..17235339))
FT                   /codon_start=1
FT                   /gene="Abhd14a"
FT                   /locus_tag="mCG_49493"
FT                   /product="abhydrolase domain containing 14A, isoform CRA_a"
FT                   /note="gene_id=mCG49493.2 transcript_id=mCT49676.2
FT                   protein_id=mCP41285.2 isoform=CRA_a"
FT                   /protein_id="EDL21139.1"
FT                   /translation="MVQKFMSRYQAALLGLGLLLVFLLYMGLPGPPEQTSRLWRGPNVT
FT                   VLTGLTRGNSRIFYREVLPIQQACRAEVVFLHGKAFNSHTWEQLGTLQLLSERGYRAVA
FT                   IDLPGFGNSAPSEEVSTEAGRVELLERVFQDLQVQNTVLVSPSLSGSYALPFLMQNHHQ
FT                   LRGFVPIAPTYTRNYAQEQFRAVKTPTLILYGELDHTLARESLQQLRHLPNHSMVKLRD
FT                   AGHACYLHKPEAFHLALLAFLDHLP"
FT   gene            17239097..17243799
FT                   /gene="Abhd14b"
FT                   /locus_tag="mCG_19509"
FT                   /note="gene_id=mCG19509.2"
FT   mRNA            join(17239097..17239222,17240865..17241092,
FT                   17242253..17242494,17242862..17243799)
FT                   /gene="Abhd14b"
FT                   /locus_tag="mCG_19509"
FT                   /product="abhydrolase domain containing 14b, transcript
FT                   variant mCT171615"
FT                   /note="gene_id=mCG19509.2 transcript_id=mCT171615.0 created
FT                   on 05-AUG-2002"
FT   mRNA            join(17239098..17239188,17240865..17241092,
FT                   17242253..17242494,17242862..17243799)
FT                   /gene="Abhd14b"
FT                   /locus_tag="mCG_19509"
FT                   /product="abhydrolase domain containing 14b, transcript
FT                   variant mCT171616"
FT                   /note="gene_id=mCG19509.2 transcript_id=mCT171616.0 created
FT                   on 05-AUG-2002"
FT   CDS             join(17239182..17239188,17240865..17241092,
FT                   17242253..17242494,17242862..17243041)
FT                   /codon_start=1
FT                   /gene="Abhd14b"
FT                   /locus_tag="mCG_19509"
FT                   /product="abhydrolase domain containing 14b, isoform CRA_b"
FT                   /note="gene_id=mCG19509.2 transcript_id=mCT171616.0
FT                   protein_id=mCP94534.0 isoform=CRA_b"
FT                   /protein_id="EDL21141.1"
FT                   /translation="MTGTSPLGMAGVDQHEGTIQVQGQNLFFRETRPGSGQPVRFSVLL
FT                   LHGIRFSSETWQNLGTLQRLAEAGYRAVAIDLPGLGRSKEAAAPAPIGEPAPGSFLAAV
FT                   VDTLELGPPVVISPSLSGMYSLPFLVAPGSQLRGFVPVAPICTDKINAVDYASVKTPAL
FT                   IVYGDQDPMGSSSFQHLKQLPNHRVLVMEGAGHPCYLDKPDEWHKGLLDFLQGLA"
FT   mRNA            join(17239532..17239580,17240865..17241092,
FT                   17242253..17242494,17242862..17243799)
FT                   /gene="Abhd14b"
FT                   /locus_tag="mCG_19509"
FT                   /product="abhydrolase domain containing 14b, transcript
FT                   variant mCT20035"
FT                   /note="gene_id=mCG19509.2 transcript_id=mCT20035.2 created
FT                   on 05-AUG-2002"
FT   CDS             join(17240882..17241092,17242253..17242494,
FT                   17242862..17243041)
FT                   /codon_start=1
FT                   /gene="Abhd14b"
FT                   /locus_tag="mCG_19509"
FT                   /product="abhydrolase domain containing 14b, isoform CRA_a"
FT                   /note="gene_id=mCG19509.2 transcript_id=mCT171615.0
FT                   protein_id=mCP94535.0 isoform=CRA_a"
FT                   /protein_id="EDL21140.1"
FT                   /translation="MAGVDQHEGTIQVQGQNLFFRETRPGSGQPVRFSVLLLHGIRFSS
FT                   ETWQNLGTLQRLAEAGYRAVAIDLPGLGRSKEAAAPAPIGEPAPGSFLAAVVDTLELGP
FT                   PVVISPSLSGMYSLPFLVAPGSQLRGFVPVAPICTDKINAVDYASVKTPALIVYGDQDP
FT                   MGSSSFQHLKQLPNHRVLVMEGAGHPCYLDKPDEWHKGLLDFLQGLA"
FT   CDS             join(17240882..17241092,17242253..17242494,
FT                   17242862..17243041)
FT                   /codon_start=1
FT                   /gene="Abhd14b"
FT                   /locus_tag="mCG_19509"
FT                   /product="abhydrolase domain containing 14b, isoform CRA_a"
FT                   /note="gene_id=mCG19509.2 transcript_id=mCT20035.2
FT                   protein_id=mCP21230.1 isoform=CRA_a"
FT                   /protein_id="EDL21142.1"
FT                   /translation="MAGVDQHEGTIQVQGQNLFFRETRPGSGQPVRFSVLLLHGIRFSS
FT                   ETWQNLGTLQRLAEAGYRAVAIDLPGLGRSKEAAAPAPIGEPAPGSFLAAVVDTLELGP
FT                   PVVISPSLSGMYSLPFLVAPGSQLRGFVPVAPICTDKINAVDYASVKTPALIVYGDQDP
FT                   MGSSSFQHLKQLPNHRVLVMEGAGHPCYLDKPDEWHKGLLDFLQGLA"
FT   gene            17244638..17254631
FT                   /gene="Pcbp4"
FT                   /locus_tag="mCG_19526"
FT                   /note="gene_id=mCG19526.2"
FT   mRNA            join(17244638..17244699,17246978..17247139,
FT                   17250695..17250839,17250966..17250989,17251087..17251119,
FT                   17251339..17251455,17251681..17251812,17251952..17252080,
FT                   17252511..17252568,17252715..17252759,17252835..17252898,
FT                   17253008..17253060,17253155..17253324,17253750..17254631)
FT                   /gene="Pcbp4"
FT                   /locus_tag="mCG_19526"
FT                   /product="poly(rC) binding protein 4, transcript variant
FT                   mCT170566"
FT                   /note="gene_id=mCG19526.2 transcript_id=mCT170566.0 created
FT                   on 16-AUG-2002"
FT   mRNA            join(17244638..17244699,17246982..17247139,
FT                   17250695..17250839,17250966..17250989,17251087..17251119,
FT                   17251339..17251455,17251681..17251812,17251952..17252080,
FT                   17252511..17252568,17252715..17252759,17252835..17252898,
FT                   17253008..17253060,17253155..17253324,17253750..17254631)
FT                   /gene="Pcbp4"
FT                   /locus_tag="mCG_19526"
FT                   /product="poly(rC) binding protein 4, transcript variant
FT                   mCT170565"
FT                   /note="gene_id=mCG19526.2 transcript_id=mCT170565.0 created
FT                   on 16-AUG-2002"
FT   mRNA            join(17244638..17244699,17250695..17250839,
FT                   17250966..17250989,17251087..17251119,17251339..17251455,
FT                   17251681..17251812,17251952..17252080,17252511..17252568,
FT                   17252715..17252759,17252835..17252898,17253008..17253060,
FT                   17253155..17253324,17253750..17254631)
FT                   /gene="Pcbp4"
FT                   /locus_tag="mCG_19526"
FT                   /product="poly(rC) binding protein 4, transcript variant
FT                   mCT20219"
FT                   /note="gene_id=mCG19526.2 transcript_id=mCT20219.2 created
FT                   on 16-AUG-2002"
FT   CDS             join(17250759..17250839,17250966..17250989,
FT                   17251087..17251119,17251339..17251455,17251681..17251812,
FT                   17251952..17252080,17252511..17252568,17252715..17252759,
FT                   17252835..17252898,17253008..17253059)
FT                   /codon_start=1
FT                   /gene="Pcbp4"
FT                   /locus_tag="mCG_19526"
FT                   /product="poly(rC) binding protein 4, isoform CRA_a"
FT                   /note="gene_id=mCG19526.2 transcript_id=mCT170566.0
FT                   protein_id=mCP93483.0 isoform=CRA_a"
FT                   /protein_id="EDL21143.1"
FT                   /translation="MSSSDAGLEEGPELSITLTLRMLMHGKEVGSIIGKKGETVKRIRE
FT                   QSSARITISEGSCPERITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGSVSRPPVTL
FT                   RLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIILCV
FT                   RQICAVILEHHPVSSEPLPRYCPPLGQPGFLCPGSVWSSDPCRGHQAPAALRPHRSLCI
FT                   TQCGARTGSQHTDQLTGVSGSQ"
FT   CDS             join(17250759..17250839,17250966..17250989,
FT                   17251087..17251119,17251339..17251455,17251681..17251812,
FT                   17251952..17252080,17252511..17252568,17252715..17252759,
FT                   17252835..17252898,17253008..17253059)
FT                   /codon_start=1
FT                   /gene="Pcbp4"
FT                   /locus_tag="mCG_19526"
FT                   /product="poly(rC) binding protein 4, isoform CRA_a"
FT                   /note="gene_id=mCG19526.2 transcript_id=mCT170565.0
FT                   protein_id=mCP93484.0 isoform=CRA_a"
FT                   /protein_id="EDL21144.1"
FT                   /translation="MSSSDAGLEEGPELSITLTLRMLMHGKEVGSIIGKKGETVKRIRE
FT                   QSSARITISEGSCPERITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGSVSRPPVTL
FT                   RLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIILCV
FT                   RQICAVILEHHPVSSEPLPRYCPPLGQPGFLCPGSVWSSDPCRGHQAPAALRPHRSLCI
FT                   TQCGARTGSQHTDQLTGVSGSQ"
FT   CDS             join(17250759..17250839,17250966..17250989,
FT                   17251087..17251119,17251339..17251455,17251681..17251812,
FT                   17251952..17252080,17252511..17252568,17252715..17252759,
FT                   17252835..17252898,17253008..17253059)
FT                   /codon_start=1
FT                   /gene="Pcbp4"
FT                   /locus_tag="mCG_19526"
FT                   /product="poly(rC) binding protein 4, isoform CRA_a"
FT                   /note="gene_id=mCG19526.2 transcript_id=mCT20219.2
FT                   protein_id=mCP21307.2 isoform=CRA_a"
FT                   /protein_id="EDL21145.1"
FT                   /translation="MSSSDAGLEEGPELSITLTLRMLMHGKEVGSIIGKKGETVKRIRE
FT                   QSSARITISEGSCPERITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGSVSRPPVTL
FT                   RLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIILCV
FT                   RQICAVILEHHPVSSEPLPRYCPPLGQPGFLCPGSVWSSDPCRGHQAPAALRPHRSLCI
FT                   TQCGARTGSQHTDQLTGVSGSQ"
FT   gene            complement(17254581..17256536)
FT                   /locus_tag="mCG_19521"
FT                   /note="gene_id=mCG19521.2"
FT   mRNA            complement(join(17254581..17255763,17255880..17256536))
FT                   /locus_tag="mCG_19521"
FT                   /product="mCG19521"
FT                   /note="gene_id=mCG19521.2 transcript_id=mCT20213.2 created
FT                   on 05-AUG-2002"
FT   CDS             complement(join(17255332..17255763,17255880..17256368))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19521"
FT                   /product="mCG19521"
FT                   /note="gene_id=mCG19521.2 transcript_id=mCT20213.2
FT                   protein_id=mCP21282.1"
FT                   /protein_id="EDL21146.1"
FT                   /translation="MANGSGLSVTELAGSVGFILAVLVEVGAVLGNGTLLVVVLRTPDL
FT                   QDAFYLAHLCVVDLLAAASIMPLGLLAAPPGLGTVPLDPSSCRAARFLSAALLPACTLG
FT                   VAALGLARYRLIVHPLRPGARPAPALVLTAGVVRGRAPGRALLARATACATSGPSSLLR
FT                   PGGAARRLPASARDPAPLRLSRQSPLLLAAPPATSAGGQGGPGPSPGRGPVCSLLAALW
FT                   LRVLGARGARRSGRGYCHLGSLLRLRGSPLSIWPAAAPGAPGAGPPYPPSAASGPESLH
FT                   IASLAPADTPSAPPGTPQGPCPRPF"
FT   gene            complement(17260936..17267264)
FT                   /gene="Parp3"
FT                   /locus_tag="mCG_19522"
FT                   /note="gene_id=mCG19522.2"
FT   mRNA            complement(join(17260936..17262022,17262380..17262535,
FT                   17263650..17263827,17264054..17264140,17264302..17264454,
FT                   17264679..17264905,17265019..17265142,17265302..17265490,
FT                   17265647..17265772,17266412..17266595,17267106..17267264))
FT                   /gene="Parp3"
FT                   /locus_tag="mCG_19522"
FT                   /product="poly (ADP-ribose) polymerase family, member 3,
FT                   transcript variant mCT20216"
FT                   /note="gene_id=mCG19522.2 transcript_id=mCT20216.2 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(17260936..17262022,17262380..17262535,
FT                   17263650..17263827,17264054..17264140,17264302..17264454,
FT                   17264679..17264905,17265019..17265142,17265302..17265490,
FT                   17265647..17265772,17266412..17266595,17266695..17266793))
FT                   /gene="Parp3"
FT                   /locus_tag="mCG_19522"
FT                   /product="poly (ADP-ribose) polymerase family, member 3,
FT                   transcript variant mCT171619"
FT                   /note="gene_id=mCG19522.2 transcript_id=mCT171619.0 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(17261641..17262022,17262380..17262535,
FT                   17263650..17263827,17264054..17264140,17264302..17264454,
FT                   17264679..17264905,17265019..17265157,17265302..17265490,
FT                   17265647..17265772,17266412..17266595,17267106..>17267242))
FT                   /gene="Parp3"
FT                   /locus_tag="mCG_19522"
FT                   /product="poly (ADP-ribose) polymerase family, member 3,
FT                   transcript variant mCT191543"
FT                   /note="gene_id=mCG19522.2 transcript_id=mCT191543.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(17261853..17262022,17262380..17262535,
FT                   17263650..17263827,17264054..17264140,17264302..17264454,
FT                   17264679..17264905,17265019..17265157,17265302..17265490,
FT                   17265647..17265772,17266412..17266595,17267106..>17267242))
FT                   /codon_start=1
FT                   /gene="Parp3"
FT                   /locus_tag="mCG_19522"
FT                   /product="poly (ADP-ribose) polymerase family, member 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19522.2 transcript_id=mCT191543.0
FT                   protein_id=mCP112510.0 isoform=CRA_b"
FT                   /protein_id="EDL21148.1"
FT                   /translation="QKLAEGSRRVARWDPRLGTCFLGGTFSIPDTGLDNSHLFQGPVSF
FT                   GRTMAPKRKASVQTEGSKKQRQGTEEEDSFRSTAEALRAAPADNRVIRVDPSCPFSRNP
FT                   GIQVHEDYDCTLNQTNIGNNNNKFYIIQLLEEGSRFFCWNRWGRVGEVGQSKMNHFTCL
FT                   EDAKKDFKKKFWEKTKNKWEERDRFVAQPNKYTLIEVQGEAESQEAVVKALSPQVYSGP
FT                   VRTVVKPCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIARGFEALE
FT                   ALEEAMKNPTGDGQSLEELSSCFYTVIPHNFGRSRPPPINSPDVLQAKKDMLLVLADIE
FT                   LAQTLQAAPGEEEEKVEEVPHPLDRDYQLLRCQLQLLDSGESEYKAIQTYLKQTGNSYR
FT                   CPNLRHVWKVNREGEGDRFQAHSKLGNRRLLWHGTNVAVVAAILTSGLRIMPHSGGRVG
FT                   KGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVALGKEHHITIDDPSLKSPPPGFDSV
FT                   IARGQTEPDPAQDIELELDGQPVVVPQGPPVQCPSFKSSSFSQSEYLIYKESQCRLRYL
FT                   LEIHL"
FT   CDS             complement(join(17261853..17262022,17262380..17262535,
FT                   17263650..17263827,17264054..17264140,17264302..17264454,
FT                   17264679..17264905,17265019..17265142,17265302..17265490,
FT                   17265647..17265772,17266412..17266588))
FT                   /codon_start=1
FT                   /gene="Parp3"
FT                   /locus_tag="mCG_19522"
FT                   /product="poly (ADP-ribose) polymerase family, member 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19522.2 transcript_id=mCT171619.0
FT                   protein_id=mCP94538.0 isoform=CRA_a"
FT                   /protein_id="EDL21147.1"
FT                   /translation="MAPKRKASVQTEGSKKQRQGTEEEDSFRSTAEALRAAPADNRVIR
FT                   VDPSCPFSRNPGIQVHEDYDCTLNQTNIGNNNNKFYIIQLLEEGSRFFCWNRWGRVGEV
FT                   GQSKMNHFTCLEDAKKDFKKKFWEKTKNKWEERDRFVAQPNKYTLIEVQGEAESQEAVV
FT                   KVYSGPVRTVVKPCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIAR
FT                   GFEALEALEEAMKNPTGDGQSLEELSSCFYTVIPHNFGRSRPPPINSPDVLQAKKDMLL
FT                   VLADIELAQTLQAAPGEEEEKVEEVPHPLDRDYQLLRCQLQLLDSGESEYKAIQTYLKQ
FT                   TGNSYRCPNLRHVWKVNREGEGDRFQAHSKLGNRRLLWHGTNVAVVAAILTSGLRIMPH
FT                   SGGRVGKGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVALGKEHHITIDDPSLKSPP
FT                   PGFDSVIARGQTEPDPAQDIELELDGQPVVVPQGPPVQCPSFKSSSFSQSEYLIYKESQ
FT                   CRLRYLLEIHL"
FT   CDS             complement(join(17261853..17262022,17262380..17262535,
FT                   17263650..17263827,17264054..17264140,17264302..17264454,
FT                   17264679..17264905,17265019..17265142,17265302..17265490,
FT                   17265647..17265772,17266412..17266588))
FT                   /codon_start=1
FT                   /gene="Parp3"
FT                   /locus_tag="mCG_19522"
FT                   /product="poly (ADP-ribose) polymerase family, member 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19522.2 transcript_id=mCT20216.2
FT                   protein_id=mCP21297.2 isoform=CRA_a"
FT                   /protein_id="EDL21149.1"
FT                   /translation="MAPKRKASVQTEGSKKQRQGTEEEDSFRSTAEALRAAPADNRVIR
FT                   VDPSCPFSRNPGIQVHEDYDCTLNQTNIGNNNNKFYIIQLLEEGSRFFCWNRWGRVGEV
FT                   GQSKMNHFTCLEDAKKDFKKKFWEKTKNKWEERDRFVAQPNKYTLIEVQGEAESQEAVV
FT                   KVYSGPVRTVVKPCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIAR
FT                   GFEALEALEEAMKNPTGDGQSLEELSSCFYTVIPHNFGRSRPPPINSPDVLQAKKDMLL
FT                   VLADIELAQTLQAAPGEEEEKVEEVPHPLDRDYQLLRCQLQLLDSGESEYKAIQTYLKQ
FT                   TGNSYRCPNLRHVWKVNREGEGDRFQAHSKLGNRRLLWHGTNVAVVAAILTSGLRIMPH
FT                   SGGRVGKGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVALGKEHHITIDDPSLKSPP
FT                   PGFDSVIARGQTEPDPAQDIELELDGQPVVVPQGPPVQCPSFKSSSFSQSEYLIYKESQ
FT                   CRLRYLLEIHL"
FT   gene            17266574..17276086
FT                   /gene="Rnu3ip2"
FT                   /locus_tag="mCG_19519"
FT                   /note="gene_id=mCG19519.2"
FT   mRNA            join(17266574..17266607,17268281..17268363,
FT                   17271352..17271461,17271812..17271879,17271969..17272010,
FT                   17272423..17272549,17273574..17273698,17273781..17273873,
FT                   17274219..17274319,17274409..17274543,17274628..17274690,
FT                   17274873..17275018,17275102..17275181,17275739..17275812,
FT                   17275914..17276086)
FT                   /gene="Rnu3ip2"
FT                   /locus_tag="mCG_19519"
FT                   /product="RNA, U3 small nucleolar interacting protein 2,
FT                   transcript variant mCT171618"
FT                   /note="gene_id=mCG19519.2 transcript_id=mCT171618.0 created
FT                   on 06-AUG-2002"
FT   CDS             join(17266587..17266607,17268281..17268363,
FT                   17271352..17271461,17271812..17271879,17271969..17272010,
FT                   17272423..17272549,17273574..17273698,17273781..17273873,
FT                   17274219..17274319,17274409..17274543,17274628..17274690,
FT                   17274873..17275018,17275102..17275181,17275739..17275812,
FT                   17275914..17276007)
FT                   /codon_start=1
FT                   /gene="Rnu3ip2"
FT                   /locus_tag="mCG_19519"
FT                   /product="RNA, U3 small nucleolar interacting protein 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19519.2 transcript_id=mCT171618.0
FT                   protein_id=mCP94537.0 isoform=CRA_a"
FT                   /protein_id="EDL21150.1"
FT                   /translation="MVLLGQEVDSAADRGKSKGGGKMNEEISSDSESESLAPRKTEEEE
FT                   EEELEETAQEKKLRLAKLYLEQLRQQEEEKAEARAFEEDQVAGRLKEDVLEQRGRLQKS
FT                   VAKEIQAPAPTDIRVLRGHQLSITCLVITPDDLAIFSAAKDCTIIKWSVETGRKLHVIP
FT                   RAKKGAQGQPAGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQHLYTFTGHRDAV
FT                   SGLAFRKGTHQLYSTSHDRSVKVWNAAENSYVETLFGHQDAVAALDALSRECCVTAGGR
FT                   DGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALWGLSKKRPLALQR
FT                   EAHGLHGEPGLEQPFWVSSVAALLNTDLVATGSHNARVRLWQCGEGFRQLDPLCDIPLV
FT                   GFINSLKFSSAGDFLVAGVGQEHRLGRWWRIKEARNSVCIIPLRRLPVSPVAGS"
FT   mRNA            join(17267916..17268047,17268281..17268363,
FT                   17271352..17271461,17271812..17271879,17271969..17272010,
FT                   17272423..17272549,17273574..17273698,17273781..17273873,
FT                   17274219..17274319,17274409..17274543,17274628..17274690,
FT                   17274873..17275018,17275102..17275181,17275739..17275812,
FT                   17275914..17276086)
FT                   /gene="Rnu3ip2"
FT                   /locus_tag="mCG_19519"
FT                   /product="RNA, U3 small nucleolar interacting protein 2,
FT                   transcript variant mCT20210"
FT                   /note="gene_id=mCG19519.2 transcript_id=mCT20210.2 created
FT                   on 06-AUG-2002"
FT   CDS             join(17267961..17268047,17268281..17268363,
FT                   17271352..17271461,17271812..17271879,17271969..17272010,
FT                   17272423..17272549,17273574..17273698,17273781..17273873,
FT                   17274219..17274319,17274409..17274543,17274628..17274690,
FT                   17274873..17275018,17275102..17275181,17275739..17275812,
FT                   17275914..17276007)
FT                   /codon_start=1
FT                   /gene="Rnu3ip2"
FT                   /locus_tag="mCG_19519"
FT                   /product="RNA, U3 small nucleolar interacting protein 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19519.2 transcript_id=mCT20210.2
FT                   protein_id=mCP21308.1 isoform=CRA_b"
FT                   /protein_id="EDL21151.1"
FT                   /translation="MSTAVATRKRAKPAPGPGAAPVAGKRRRKVDSAADRGKSKGGGKM
FT                   NEEISSDSESESLAPRKTEEEEEEELEETAQEKKLRLAKLYLEQLRQQEEEKAEARAFE
FT                   EDQVAGRLKEDVLEQRGRLQKSVAKEIQAPAPTDIRVLRGHQLSITCLVITPDDLAIFS
FT                   AAKDCTIIKWSVETGRKLHVIPRAKKGAQGQPAGHSSHVLCMAISSDGKYLASGDRSKL
FT                   ILIWEAQSCQHLYTFTGHRDAVSGLAFRKGTHQLYSTSHDRSVKVWNAAENSYVETLFG
FT                   HQDAVAALDALSRECCVTAGGRDGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVS
FT                   GADDGSVALWGLSKKRPLALQREAHGLHGEPGLEQPFWVSSVAALLNTDLVATGSHNAR
FT                   VRLWQCGEGFRQLDPLCDIPLVGFINSLKFSSAGDFLVAGVGQEHRLGRWWRIKEARNS
FT                   VCIIPLRRLPVSPVAGS"
FT   gene            17282017..17284278
FT                   /locus_tag="mCG_19517"
FT                   /note="gene_id=mCG19517.2"
FT   mRNA            join(17282017..17282066,17282523..17282627,
FT                   17283826..17284278)
FT                   /locus_tag="mCG_19517"
FT                   /product="mCG19517"
FT                   /note="gene_id=mCG19517.2 transcript_id=mCT20209.2 created
FT                   on 06-AUG-2002"
FT   CDS             join(17282064..17282066,17282523..17282627,
FT                   17283826..17284266)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19517"
FT                   /product="mCG19517"
FT                   /note="gene_id=mCG19517.2 transcript_id=mCT20209.2
FT                   protein_id=mCP21279.1"
FT                   /protein_id="EDL21152.1"
FT                   /translation="MGEEQQKPEELNAPTDDAPQEKQQPADLSSETEKAKSKKKQELSE
FT                   KDQVVKIQAWWRGTLVRRSLLHAALSAWIIQCWWRLILPKIMEKRRQSMLDTFQQEQWA
FT                   VVRLQSWIRMWRIRRRYCRLLKAVRTIQSHWRGHTCSSRGVIKGQYRISTSQMHLELEV
FT                   LLGSGPCIVTECIPLPIKQ"
FT   gene            complement(17285230..17345071)
FT                   /gene="Iqcf3"
FT                   /locus_tag="mCG_19520"
FT                   /note="gene_id=mCG19520.2"
FT   mRNA            complement(join(17285230..17285436,17286393..17287152,
FT                   17309864..17309926,17327661..17327708,17327880..17327951))
FT                   /gene="Iqcf3"
FT                   /locus_tag="mCG_19520"
FT                   /product="IQ motif containing F3, transcript variant
FT                   mCT51279"
FT                   /note="gene_id=mCG19520.2 transcript_id=mCT51279.2 created
FT                   on 13-AUG-2002"
FT   CDS             complement(join(17287120..17287152,17309864..17309926,
FT                   17327661..17327708,17327880..17327897))
FT                   /codon_start=1
FT                   /gene="Iqcf3"
FT                   /locus_tag="mCG_19520"
FT                   /product="IQ motif containing F3, isoform CRA_b"
FT                   /note="gene_id=mCG19520.2 transcript_id=mCT51279.2
FT                   protein_id=mCP41292.2 isoform=CRA_b"
FT                   /protein_id="EDL21154.1"
FT                   /translation="MGALFVKPKPKVHQQAKTTQPKSKTSLVSEDEDEIIQRKYTLKVT
FT                   GQPLQVNC"
FT   gene            17297048..17298481
FT                   /locus_tag="mCG_147717"
FT                   /note="gene_id=mCG147717.0"
FT   mRNA            join(17297048..17297138,17298028..17298481)
FT                   /locus_tag="mCG_147717"
FT                   /product="mCG147717"
FT                   /note="gene_id=mCG147717.0 transcript_id=mCT187980.0
FT                   created on 13-JAN-2004"
FT   CDS             join(17297135..17297138,17298028..17298470)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147717"
FT                   /product="mCG147717"
FT                   /note="gene_id=mCG147717.0 transcript_id=mCT187980.0
FT                   protein_id=mCP108543.0"
FT                   /protein_id="EDL21156.1"
FT                   /translation="MGPEKSTAMTETSAAVRIQAWWRGTLLRRTLLHAALSAWIIQCWW
FT                   RKIMIMLQGKKRRMALELYARKTWAIVKLQSWFRMWHIRHRYCRLLNAVRIIQVYWRWH
FT                   SCHTRGFIQGNYEIKENRLNIQLEISLGSQACKVEQCITLPIKE"
FT   mRNA            complement(join(<17308060..17308446,17309864..17309926,
FT                   17327661..17327708,17327880..17327951))
FT                   /gene="Iqcf3"
FT                   /locus_tag="mCG_19520"
FT                   /product="IQ motif containing F3, transcript variant
FT                   mCT172358"
FT                   /note="gene_id=mCG19520.2 transcript_id=mCT172358.0 created
FT                   on 13-AUG-2002"
FT   CDS             complement(join(17308060..17308446,17309864..17309926,
FT                   17327661..17327708,17327880..17327897))
FT                   /codon_start=1
FT                   /gene="Iqcf3"
FT                   /locus_tag="mCG_19520"
FT                   /product="IQ motif containing F3, isoform CRA_a"
FT                   /note="gene_id=mCG19520.2 transcript_id=mCT172358.0
FT                   protein_id=mCP95277.0 isoform=CRA_a"
FT                   /protein_id="EDL21153.1"
FT                   /translation="MGALFVKPKPKVHQQAKTTQPKSKTSLVSEDEDEIIQRKYTLKKK
FT                   IVKNKKKAAIQVQAWWRGTLVRRVLLHAALRAWVIQCWWRLTLRRILEKKRRKALIDFS
FT                   NMERAVVTLQSLVRMWRIHWRYCQVLSAIYTIQGHWKYHNCQACSLLRGHCLITTTHLQ
FT                   FHIEIIDH"
FT   mRNA            complement(join(17326650..17327120,17327661..17327708,
FT                   17336232..17336413,17337043..17337129,17337584..17337688,
FT                   17340921..17341025,17344394..17344462,17345013..17345071))
FT                   /gene="Iqcf3"
FT                   /locus_tag="mCG_19520"
FT                   /product="IQ motif containing F3, transcript variant
FT                   mCT20212"
FT                   /note="gene_id=mCG19520.2 transcript_id=mCT20212.0 created
FT                   on 13-AUG-2002"
FT   CDS             complement(join(17327108..17327120,17327661..17327708,
FT                   17336232..17336413,17337043..17337129,17337584..17337688,
FT                   17340921..17341025,17344394..17344462,17345013..17345015))
FT                   /codon_start=1
FT                   /gene="Iqcf3"
FT                   /locus_tag="mCG_19520"
FT                   /product="IQ motif containing F3, isoform CRA_c"
FT                   /note="gene_id=mCG19520.2 transcript_id=mCT20212.0
FT                   protein_id=mCP21362.1 isoform=CRA_c"
FT                   /protein_id="EDL21155.1"
FT                   /translation="MELDQDKKKETPEETENVNEVQLEKQNQDEETEAEAEEADKAILE
FT                   RSDSVKTECPPQAEKQNQDEETEAEAEEADKAILERSDSVKTECPPQAEKQIQEEKCET
FT                   QEADRSEGTELGKLPSQLDQLPDNVMLAGVKIQAWWRGTLVRRTLLLAALNAWTIQCWW
FT                   REAKARLQGRKLHEVMRYRLRNLNLKSISKRKQPNQSSFL"
FT   gene            complement(17351832..>17354520)
FT                   /gene="Iqcf4"
FT                   /locus_tag="mCG_145337"
FT                   /note="gene_id=mCG145337.0"
FT   mRNA            complement(join(17351832..17352283,17354047..17354136,
FT                   17354174..17354238,17354399..>17354520))
FT                   /gene="Iqcf4"
FT                   /locus_tag="mCG_145337"
FT                   /product="IQ motif containing F4"
FT                   /note="gene_id=mCG145337.0 transcript_id=mCT184761.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(17351843..17352283,17354047..17354136,
FT                   17354174..>17354197))
FT                   /codon_start=1
FT                   /gene="Iqcf4"
FT                   /locus_tag="mCG_145337"
FT                   /product="IQ motif containing F4"
FT                   /note="gene_id=mCG145337.0 transcript_id=mCT184761.0
FT                   protein_id=mCP105886.0"
FT                   /protein_id="EDL21157.1"
FT                   /translation="HKGNKETTEKEKEKEEEEKKLRPSSTPKVEHTWPSKLELSLQHLS
FT                   QKTQNARKIQAWWRGTLVRRSLLRAALSAWIIQCWWRKILAKRQEKNRLIILHLMAQET
FT                   RACVLIQSWVRMLKIRQNYCRLCYATRVIQASWRWYNCRTRGFFQGSYELVGNKLRLRL
FT                   DIFLGSQVCRISDCISLPIKN"
FT   gene            <17411207..>17412237
FT                   /locus_tag="mCG_51523"
FT                   /note="gene_id=mCG51523.0"
FT   mRNA            join(<17411207..17411311,17411869..>17412237)
FT                   /locus_tag="mCG_51523"
FT                   /product="mCG51523"
FT                   /note="gene_id=mCG51523.0 transcript_id=mCT51706.1 created
FT                   on 20-JUN-2003"
FT   CDS             join(17411207..17411311,17411869..17412237)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51523"
FT                   /product="mCG51523"
FT                   /note="gene_id=mCG51523.0 transcript_id=mCT51706.1
FT                   protein_id=mCP41366.1"
FT                   /db_xref="GOA:G3UWF2"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="MGI:MGI:3781315"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWF2"
FT                   /protein_id="EDL21158.1"
FT                   /translation="MTDEWTLKTKAMDIKTVNTDLSKETCPVDNEQSVKLEKTAIKIQS
FT                   WWRGNMVRRTLLDAALGAWAIQCWWRSVQTKIVEQKRRLALKLYTCQEWAVVKVQAYVR
FT                   MWQARRRFLQARQAACIIQTHWRWHASQSQGMIHSRYEVKASRLELDIEILVT"
FT   gene            17425673..17428310
FT                   /locus_tag="mCG_1032915"
FT                   /note="gene_id=mCG1032915.0"
FT   mRNA            join(17425673..17425956,17427201..17428310)
FT                   /locus_tag="mCG_1032915"
FT                   /product="mCG1032915"
FT                   /note="gene_id=mCG1032915.0 transcript_id=mCT150619.0
FT                   created on 06-AUG-2002"
FT   gene            complement(17427841..17440826)
FT                   /locus_tag="mCG_19511"
FT                   /note="gene_id=mCG19511.3"
FT   mRNA            complement(join(17427841..17429837,17430043..17430223,
FT                   17431897..17432972,17435138..17435975,17438578..17439163,
FT                   17440765..17440826))
FT                   /locus_tag="mCG_19511"
FT                   /product="mCG19511"
FT                   /note="gene_id=mCG19511.3 transcript_id=mCT20038.3 created
FT                   on 18-APR-2003"
FT   CDS             17427907..17428098
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032915"
FT                   /product="mCG1032915"
FT                   /note="gene_id=mCG1032915.0 transcript_id=mCT150619.0
FT                   protein_id=mCP68718.1"
FT                   /protein_id="EDL21159.1"
FT                   /translation="MPISSLEKKKKSMSLAGFLAQDFVPACYRSPACSSHMLPAHCTAP
FT                   SRPWEAAESPALGSRSGG"
FT   CDS             complement(join(17429764..17429837,17430043..17430223,
FT                   17431897..17432972,17435138..17435975,17438578..17439027))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19511"
FT                   /product="mCG19511"
FT                   /note="gene_id=mCG19511.3 transcript_id=mCT20038.3
FT                   protein_id=mCP21298.1"
FT                   /protein_id="EDL21160.1"
FT                   /translation="MESLLRFLALLLLRGAVAEGPAKKVLTLEGDLVLGGLFPVHQKGG
FT                   PAEECGPVNEHRGIQRLEAMLFALDRINRDPHLLPGVRLGAHILDSCSKDTHALEQALD
FT                   FVRASLSRGADGSRHICPDGSYATLSDAPTAITGVIGGSYSDVSIQVANLLRLFQIPQI
FT                   SYASTSAKLSDKSRYDYFARTVPPDFFQAKAMAEILRFFNWTYVSTVASEGDYGETGIE
FT                   AFELEARARNICVATSEKVGRAMSRAAFEGVVRALLQKPSARVAVLFTRSEDARELLAA
FT                   TQRLNASFTWVASDGWGALESVVAGSERAAEGAITIELASYPISDFASYFQNLDPWNNS
FT                   RNPWFREFWEERFRCSFRQRDCAAHSLRAVPFEQESKIMFVVNAVYAMAHALHNMHRAL
FT                   CPNTTRLCDAMRPVNGRRLYKDFVLNVKFDAPFRPADTDDEVRFDRFGDGIGRYNIFTY
FT                   LRAGNGRYRYQKVGYWAEGLTLDTSIIPWASPSAGPLPASRCSEPCLQNEVKSVQPGEV
FT                   CCWLCIPCQPYEYRLDEFTCADCGLGYWPNASLTGCFELPQEYIRWGDAWAVGPVTIAC
FT                   LGALATLFVLGVFVRHNATPVVKASGRELCYILLGGVFLCYCMTFIFIAKPSTAVCTLR
FT                   RLGLGTAFSVCYSALLTKTNRIARIFGGAREGAQRPRFISPASQVAICLALISGQLLIV
FT                   AAWLVVEAPGIGKETAPERREVVTLRCNHRDASMLGSLAYNVLLIALCTLYAFKTRKCP
FT                   ENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCVSVSLSGSVVLGCLFAP
FT                   KLHIILFQPQKNVVSHRAPTSRFGSAAPRASANLGQGSGSQLVPTVCNGREVVDSTTSS
FT                   L"
FT   gene            complement(17443487..17470491)
FT                   /gene="Tex264"
FT                   /locus_tag="mCG_19534"
FT                   /note="gene_id=mCG19534.2"
FT   mRNA            complement(join(17443487..17444047,17447110..17447278,
FT                   17458280..17458501,17466632..17466927,17469479..17469545,
FT                   17470378..17470491))
FT                   /gene="Tex264"
FT                   /locus_tag="mCG_19534"
FT                   /product="testis expressed gene 264, transcript variant
FT                   mCT171622"
FT                   /note="gene_id=mCG19534.2 transcript_id=mCT171622.0 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(17443487..17444047,17447110..17447278,
FT                   17458280..17458501,17466632..17466927,17469479..17469545,
FT                   17470178..17470461))
FT                   /gene="Tex264"
FT                   /locus_tag="mCG_19534"
FT                   /product="testis expressed gene 264, transcript variant
FT                   mCT171623"
FT                   /note="gene_id=mCG19534.2 transcript_id=mCT171623.0 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(17443487..17444047,17447110..17447278,
FT                   17458280..17458501,17466632..17466927,17469479..17469545,
FT                   17469787..17470240))
FT                   /gene="Tex264"
FT                   /locus_tag="mCG_19534"
FT                   /product="testis expressed gene 264, transcript variant
FT                   mCT20226"
FT                   /note="gene_id=mCG19534.2 transcript_id=mCT20226.2 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(17443767..17444047,17447110..17447278,
FT                   17458280..17458501,17466632..17466889))
FT                   /codon_start=1
FT                   /gene="Tex264"
FT                   /locus_tag="mCG_19534"
FT                   /product="testis expressed gene 264, isoform CRA_a"
FT                   /note="gene_id=mCG19534.2 transcript_id=mCT171622.0
FT                   protein_id=mCP94542.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99LS5"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="MGI:MGI:1096570"
FT                   /db_xref="UniProtKB/TrEMBL:Q99LS5"
FT                   /protein_id="EDL21161.1"
FT                   /translation="MPDLLLLGLIGALTLLLLLTLLAFAGYSGLLTGVTVSAGSPPIRN
FT                   ITVAYKFHVGSYGDTGHLFTESCSISPKLRSIAVYYDNPHTVPPEKCRCAVGSILSEGE
FT                   ESPSPELIHLYQKFGFKIFSFPAPSHVVIATFPYTTPISIWLAARRVHPALDTYIKERK
FT                   LCAHPRLEIYQQDKIHFMCPLARQGDFYVPEVKETERKCRELAEATDTQTDGTGADTSD
FT                   ASSVSLDVRPGSRETSATTLSPGAGNRGWDDGDNRSEHSYSESGASGSSFEELDLEGEG
FT                   PLGEPRLNPEAKLLGPPRELSTPERGEE"
FT   CDS             complement(join(17443767..17444047,17447110..17447278,
FT                   17458280..17458501,17466632..17466889))
FT                   /codon_start=1
FT                   /gene="Tex264"
FT                   /locus_tag="mCG_19534"
FT                   /product="testis expressed gene 264, isoform CRA_a"
FT                   /note="gene_id=mCG19534.2 transcript_id=mCT171623.0
FT                   protein_id=mCP94541.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99LS5"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="MGI:MGI:1096570"
FT                   /db_xref="UniProtKB/TrEMBL:Q99LS5"
FT                   /protein_id="EDL21162.1"
FT                   /translation="MPDLLLLGLIGALTLLLLLTLLAFAGYSGLLTGVTVSAGSPPIRN
FT                   ITVAYKFHVGSYGDTGHLFTESCSISPKLRSIAVYYDNPHTVPPEKCRCAVGSILSEGE
FT                   ESPSPELIHLYQKFGFKIFSFPAPSHVVIATFPYTTPISIWLAARRVHPALDTYIKERK
FT                   LCAHPRLEIYQQDKIHFMCPLARQGDFYVPEVKETERKCRELAEATDTQTDGTGADTSD
FT                   ASSVSLDVRPGSRETSATTLSPGAGNRGWDDGDNRSEHSYSESGASGSSFEELDLEGEG
FT                   PLGEPRLNPEAKLLGPPRELSTPERGEE"
FT   CDS             complement(join(17443767..17444047,17447110..17447278,
FT                   17458280..17458501,17466632..17466889))
FT                   /codon_start=1
FT                   /gene="Tex264"
FT                   /locus_tag="mCG_19534"
FT                   /product="testis expressed gene 264, isoform CRA_a"
FT                   /note="gene_id=mCG19534.2 transcript_id=mCT20226.2
FT                   protein_id=mCP21290.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q99LS5"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="MGI:MGI:1096570"
FT                   /db_xref="UniProtKB/TrEMBL:Q99LS5"
FT                   /protein_id="EDL21163.1"
FT                   /translation="MPDLLLLGLIGALTLLLLLTLLAFAGYSGLLTGVTVSAGSPPIRN
FT                   ITVAYKFHVGSYGDTGHLFTESCSISPKLRSIAVYYDNPHTVPPEKCRCAVGSILSEGE
FT                   ESPSPELIHLYQKFGFKIFSFPAPSHVVIATFPYTTPISIWLAARRVHPALDTYIKERK
FT                   LCAHPRLEIYQQDKIHFMCPLARQGDFYVPEVKETERKCRELAEATDTQTDGTGADTSD
FT                   ASSVSLDVRPGSRETSATTLSPGAGNRGWDDGDNRSEHSYSESGASGSSFEELDLEGEG
FT                   PLGEPRLNPEAKLLGPPRELSTPERGEE"
FT   gene            complement(17475190..17574322)
FT                   /gene="Rad54l2"
FT                   /locus_tag="mCG_19516"
FT                   /note="gene_id=mCG19516.2"
FT   mRNA            complement(join(17475190..17478255,17480277..17480369,
FT                   17482526..17482615,17484835..17485034,17486945..17487141,
FT                   17487792..17487964,17488365..17488570,17490068..17490167,
FT                   17492718..17492836,17494724..17494842,17495058..17495309,
FT                   17496710..17496887,17497622..17497964,17500479..17500675,
FT                   17501604..17501737,17502171..17502353,17503335..17503561,
FT                   17504119..17504235,17504836..17504975,17507894..17508092,
FT                   17539229..17539419,17574217..17574322))
FT                   /gene="Rad54l2"
FT                   /locus_tag="mCG_19516"
FT                   /product="Rad54 like 2 (S. cerevisiae)"
FT                   /note="gene_id=mCG19516.2 transcript_id=mCT20208.2 created
FT                   on 12-JUL-2002"
FT   CDS             complement(join(17477261..17478255,17480277..17480369,
FT                   17482526..17482615,17484835..17485034,17486945..17487141,
FT                   17487792..17487964,17488365..17488570,17490068..17490167,
FT                   17492718..17492836,17494724..17494842,17495058..17495309,
FT                   17496710..17496887,17497622..17497964,17500479..17500675,
FT                   17501604..17501737,17502171..17502353,17503335..17503561,
FT                   17504119..17504235,17504836..17504975,17507894..17508092,
FT                   17539229..17539367))
FT                   /codon_start=1
FT                   /gene="Rad54l2"
FT                   /locus_tag="mCG_19516"
FT                   /product="Rad54 like 2 (S. cerevisiae)"
FT                   /note="gene_id=mCG19516.2 transcript_id=mCT20208.2
FT                   protein_id=mCP21246.2"
FT                   /protein_id="EDL21164.1"
FT                   /translation="MSDESASGSDPDLDPDVELEDEEEEEEEEEVAVEEHDRDDEEGLL
FT                   DDTSLEGMCGTEHAQLGEDGQRPPRCTSTTSSQSEPSEQLRHQGKILASEDPKKKRAQK
FT                   PSHMRRNIRKLLREDQLEPVTKAAQQEELERRKRLEQQRKEYAAPIPTVPLEFLPEEIV
FT                   LRASDGPQLPPRVLAQEVICLDSSSGSEDEKSSRDEVIELSSGEEDTLHIVDSSESVSE
FT                   EDEEEEKGGTHVNDALNQHDALGRVLVNLNHPPEEENVFLAPQLARAVKPHQIGGIRFL
FT                   YDNLVESLERFKTSSGFGCILAHSMGLGKTLQVISFIDVLFRHTPAKTVLAIVPVNTLQ
FT                   NWLAEFNMWLPAPEALPADSKPEEVQPRFFKVHILNDEHKTVASRAKVTADWVSEGGVL
FT                   LMGYEMYRLLTLKKSLATSRPKKTKKRSHPVIIDLDEEDRQQEFRREFEKALCRPGPDV
FT                   VICDEGHRIKNCQASTSQALKNIRSRRRVVLTGYPLQNNLIEYWCMVDFVRPDFLGTRQ
FT                   EFSNMFERPILNGQCIDSTPQDVRLMRYRSHVLHSLLEGFVQRRGHTVLKIHLPAKEEN
FT                   VILVRLSQIQRDLYTQFMDRFRDCGTSGWLGLNPLKAFCVCCKIWNHPDVLYEALQKEN
FT                   LANEQDLDVEELGSAGTSARCPPHGTKVKGEDSALPSSMGEATNSKFLQGVGFNPFQER
FT                   GNNIVTYEWAKELLTNYQTGVLENSPKMVLLFHLIEESVKLGDKILVFSQSLSTLALIE
FT                   EFLGKRDMPCLPGAEGQGTQKWVRNVSYFRLDGSTPAFERERLINQFNDPSNLTTWLFL
FT                   LSTRAGCLGVNLIGANRVVVFDASWNPCHDAQAVCRVYRYGQKKPCHIYRLVADYTLEK
FT                   KIYDRQISKQGMSDRVVDDLNPMLNFTRKEVENLLHFVEKEPAPQTSLDIKGIKESVLQ
FT                   LACLKYPHLITKEPFEHESLLLNRKDHKLTKAEKKAAKKSYEEDKRTSVPYTRPSYAQY
FT                   YPASDQSLTSIPAFSQRNWQPTLKGDEKPVASVRPVQSTPIPMMPRHVPLSGGVSSASS
FT                   TNTSMNFPINYLQRAGVLVQKVVTTTDIVIPGLNSSTDVQARINAGESIHIIRGTKGTY
FT                   IRTSDGRIFAVRATGKPKAPEDGRMAASGSQGPSLASTSNGRHSASSPKAPDPEGLARP
FT                   VSPDSPEIISELQQYADVAAARESRQSSPSVSAALPGPPGQLMDNSTIPGTALGTEPCL
FT                   GGHCLNSSLLVTGQPSGGRHPVLDLRGHKRKLATPSVTQESVRRRSRKGHLPAPVQPYE
FT                   HGYPVSGGFAMPPVSLNHNLTTPFTSQAGENSLFMGSNPSYYQLSNLLADARLVFPVTT
FT                   DPLVPAGPVSSSSTATSVTASNPSFMLNPSVPGMLPSYSLPFSQPLLSEPRMFAPFPSP
FT                   GLPSNLSRGVSVYPGYMSPHAGYPAGGLLRSQVPPFDSHEVAEVGFSSNDDEDKDDDVI
FT                   EVTGK"
FT   gene            complement(17523801..17525570)
FT                   /locus_tag="mCG_19512"
FT                   /note="gene_id=mCG19512.1"
FT   mRNA            complement(17523801..17525570)
FT                   /locus_tag="mCG_19512"
FT                   /product="mCG19512"
FT                   /note="gene_id=mCG19512.1 transcript_id=mCT20205.1 created
FT                   on 12-JUL-2002"
FT   CDS             complement(17524866..17525198)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19512"
FT                   /product="mCG19512"
FT                   /note="gene_id=mCG19512.1 transcript_id=mCT20205.1
FT                   protein_id=mCP21245.2"
FT                   /protein_id="EDL21165.1"
FT                   /translation="MEGVLGFLVTLQLGEFQHTGISVGGQSHYLSYSFLFVCFAVRSLA
FT                   GQWWCMPLIPALGRQRQEDFRVRGKPGLQSEFQDRQATQRNPVLKQQQPKGSLCSPGWS
FT                   GAIYED"
FT   gene            17610157..17669505
FT                   /gene="B930007L02Rik"
FT                   /locus_tag="mCG_123324"
FT                   /note="gene_id=mCG123324.1"
FT   mRNA            join(17610157..17610373,17617322..17617439,
FT                   17619104..17619180,17622409..17622482,17623776..17623889,
FT                   17624821..17624958,17626461..17626970,17627296..17627397,
FT                   17632391..17632549,17634915..17635094,17636037..17636246,
FT                   17639629..17639798,17641869..17641993,17645564..17646827,
FT                   17647321..17647519,17648119..17648201,17648721..17648805,
FT                   17650976..17651209,17651609..17651702,17652475..17652579,
FT                   17652972..17653063,17653557..17653658,17661884..17662136,
FT                   17667767..17669505)
FT                   /gene="B930007L02Rik"
FT                   /locus_tag="mCG_123324"
FT                   /product="RIKEN cDNA B930007L02"
FT                   /note="gene_id=mCG123324.1 transcript_id=mCT124556.1
FT                   created on 30-JUL-2002"
FT   CDS             join(17617330..17617439,17619104..17619180,
FT                   17622409..17622482,17623776..17623889,17624821..17624958,
FT                   17626461..17626970,17627296..17627397,17632391..17632549,
FT                   17634915..17635094,17636037..17636246,17639629..17639798,
FT                   17641869..17641993,17645564..17646827,17647321..17647519,
FT                   17648119..17648201,17648721..17648805,17650976..17651209,
FT                   17651609..17651702,17652475..17652579,17652972..17653063,
FT                   17653557..17653658,17661884..17662136,17667767..17667825)
FT                   /codon_start=1
FT                   /gene="B930007L02Rik"
FT                   /locus_tag="mCG_123324"
FT                   /product="RIKEN cDNA B930007L02"
FT                   /note="gene_id=mCG123324.1 transcript_id=mCT124556.1
FT                   protein_id=mCP68621.1"
FT                   /protein_id="EDL21166.1"
FT                   /translation="MTTVVVHVDSKAELTTLLEQWEKDHGSGQDMVPILTRMSELIEKE
FT                   TEEYRKGDPDPFDDRHPGRADPECMLGHLLRILFKNDDFMNALVNAYVMTSREPPLNTA
FT                   ACRLLLDIMPGLETAVVFQEKEGIVENLFKWAREADQPLRTYSTGLLGGAMENQDIAAN
FT                   YRDENSQLVAIVLRRLRELQLQEVALRQDSKRPSPRKLSSEPLLPLDEEAVDMDYGDMA
FT                   VDVVDGEQESSRDMEISFRLDSSHKTSSRVNSATKPEEGGLKKNKSAKHGDRENFRKAK
FT                   QKLGFSSSDPDRVFVELSNSSWSEMSPWVIGTNYTLYPMTPAIEQRLILQYLTPLGEYQ
FT                   ELLPIFMQLGSRELMMFYIDLKQTNDVLLTFEALKHLASLLLHNKFATEFVAHGGVQKL
FT                   LEIPRPSMAATGVSMCLYYLSYNQDAMERVCMHPHNVLSDVVNYTLWLMECSHASGCCH
FT                   ATMFFSICFSFRAVLELFDRYDGLRRLVNLISTLEILNLEDQGALLSDDEIFASRQTGK
FT                   HTCMALRKYFEAHLAIKLEQVKQSLQRTEGGILVHPQPPYKACSYTHEQIVEMMEFLIE
FT                   YGPAQLYWEPAEVFLKLSCVQLLLQLISIACNWKTYYARNDTVRFALDVLAILTVVPKI
FT                   QLQLAESVDVLDEAGSAVSTVGISIILGVAEGEFFIHDAEIQKSALQIIINCVCGPDNR
FT                   ISSIGKFISGTPRRKLSQTPKSSEHTLAKMWNVVQSNNGIKVLLSLLSIKMPITDADQI
FT                   RALACKALVGLSRSSTVRQIISKLPLFSSCQIQQLMKEPVLQDKRSDHVKFCKYAAELI
FT                   ERVSGKPLLIGTDVSLARLQKADVVAQSRISFPEKELLLLIRNHLISKGLGETATVLTR
FT                   EADLPMTAASHSSAFTPVTAAASPVSLPRTPRIANGIASRLGSHATVGASAPSAPPAHP
FT                   PPRPPQGSLPLPGPSYAGNSPLIGRISFIRERPSPCNGRKIRVLRQKSDHGAYSQSPAI
FT                   KKQLDRHLPSPPTLDSIITEYLREQHARCKNPVATCPPFSLFTPHQCPEPKQRRQAPIN
FT                   FTSRLNRRASFPKYGGVDGGCFDRHLIFSRFRPISVFREANEDESGFTCCAFSARERFL
FT                   MLGTCTGQLKLYNVFSGQEEASYNCHNSAITHLEPSRDGSLLLTSATWSQPLSALWGMK
FT                   SVFDMKHSFTEDHYVEFSKHSQDRVIGTKGDIAHIYDIQTGNKLLTLFNPDLANNYKRN
FT                   CATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNMNISGVFHPNGLEVIINTEIWDLRTF
FT                   HLLHTVPALDQCRVVFNHTGTVMYGAMLQADDEDDLLEERMKSPFGSSFRTFNATDYKP
FT                   IVMFYFSATIDVKRNIFDLCTDTKDCYLAVIENQGSMDALNMDTVCRLYEVGRQRLAED
FT                   EDEEEDQEEEEQEEEDDDEDDDDTDDLDELDTDQLLEAELEEDDNNENAGEDGDNDFSP
FT                   SDEELANLLEEGEEGEDEDSDADEEVELILGDTDSSDNSDLEDDIILSLNE"
FT   gene            complement(17626574..17679798)
FT                   /gene="Armet"
FT                   /locus_tag="mCG_19507"
FT                   /note="gene_id=mCG19507.2"
FT   mRNA            complement(join(17626574..17626719,17658186..17658255,
FT                   17678023..17678164,17678933..17679060,17679674..17679798))
FT                   /gene="Armet"
FT                   /locus_tag="mCG_19507"
FT                   /product="arginine-rich, mutated in early stage tumors,
FT                   transcript variant mCT171387"
FT                   /note="gene_id=mCG19507.2 transcript_id=mCT171387.0 created
FT                   on 30-JUL-2002"
FT   mRNA            complement(join(17657159..17657321,17658186..17658255,
FT                   17678023..17678164,17678933..17679060,17679674..17679798))
FT                   /gene="Armet"
FT                   /locus_tag="mCG_19507"
FT                   /product="arginine-rich, mutated in early stage tumors,
FT                   transcript variant mCT171386"
FT                   /note="gene_id=mCG19507.2 transcript_id=mCT171386.0 created
FT                   on 30-JUL-2002"
FT   CDS             complement(join(17658221..17658255,17678023..17678164,
FT                   17678933..17679060,17679674..17679758))
FT                   /codon_start=1
FT                   /gene="Armet"
FT                   /locus_tag="mCG_19507"
FT                   /product="arginine-rich, mutated in early stage tumors,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19507.2 transcript_id=mCT171386.0
FT                   protein_id=mCP94307.0 isoform=CRA_a"
FT                   /protein_id="EDL21167.1"
FT                   /translation="MWATRGLAVALALSVLPDSRALRPGDCEVCISYLGRFYQDLKDRD
FT                   VTFSPATIEEELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICE
FT                   KLKKKDSQICELKYGLEPFLETIKT"
FT   CDS             complement(join(17658221..17658255,17678023..17678164,
FT                   17678933..17679060,17679674..17679758))
FT                   /codon_start=1
FT                   /gene="Armet"
FT                   /locus_tag="mCG_19507"
FT                   /product="arginine-rich, mutated in early stage tumors,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19507.2 transcript_id=mCT171387.0
FT                   protein_id=mCP94306.0 isoform=CRA_a"
FT                   /protein_id="EDL21168.1"
FT                   /translation="MWATRGLAVALALSVLPDSRALRPGDCEVCISYLGRFYQDLKDRD
FT                   VTFSPATIEEELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICE
FT                   KLKKKDSQICELKYGLEPFLETIKT"
FT   gene            complement(17671866..>17674439)
FT                   /locus_tag="mCG_19533"
FT                   /note="gene_id=mCG19533.2"
FT   mRNA            complement(17671866..>17674439)
FT                   /locus_tag="mCG_19533"
FT                   /product="mCG19533"
FT                   /note="gene_id=mCG19533.2 transcript_id=mCT20225.2 created
FT                   on 30-JUL-2002"
FT   CDS             complement(17672081..>17674438)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19533"
FT                   /product="mCG19533"
FT                   /note="gene_id=mCG19533.2 transcript_id=mCT20225.2
FT                   protein_id=mCP21271.2"
FT                   /protein_id="EDL21171.1"
FT                   /translation="AGGASPRASPLPPPPPPPGAEPAGPGSTAAPEYKTLLISSLSPAL
FT                   PAEHLEDRLFHQFKRFGEISLRLSHTPELGRVAYVNFRHPQDAREARQHALARQLLLYD
FT                   RPLKVEPVYLRGGGSSRRSSSSSAAASTPPPGPPAPADPLGYLPLHGGYQYKQRSLSPV
FT                   AAPPLREPRARHAAAAFALDAAAAAAVGLSRERALDYYGLYDDRGRPYGYQAVCEEDLM
FT                   PEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNL
FT                   DMAHRAKVAMSGRVIGRNPIKIGYGKANPTTRLWVGGLGPNTSLAALAREFDRFGSIRT
FT                   IDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKAEETRYPQQYQPSP
FT                   LPVHYELLTDGYTRHRNLDADLRVRDRTPPHLLYSDRDRTFLEGDWTSLSKSSDRRNSL
FT                   EGYSRSVRSRSGERWGGDGDRSIAKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGGGQ
FT                   QSERGSDRTPERSRKENHSSEGTKESGSNSLSNSRHGAEERSHHHHHHEAPDSSHGKKT
FT                   RESERNHRTTEAEPKTLEEPKHETKKLKTLSEYAQTLQLGWNGLLVLKNSCFPTSMHIL
FT                   EGDQGVISGLLKDHPSGSKLTQLKIAQRLRLDQPKLDEVTRRIKQGSPNGYAVLLAIQS
FT                   TPSGPGAEGMPVVEPGLQRRLLRNLVSYLKQKQAAGVISLPVGGSKGRDNTGMLYAFPP
FT                   CDFSQQYLQSALRTLGKLEEEHMVIVIVRDTA"
FT   mRNA            complement(join(17676615..17677087,17678023..17678164,
FT                   17678933..17679060,17679674..17679798))
FT                   /gene="Armet"
FT                   /locus_tag="mCG_19507"
FT                   /product="arginine-rich, mutated in early stage tumors,
FT                   transcript variant mCT20033"
FT                   /note="gene_id=mCG19507.2 transcript_id=mCT20033.2 created
FT                   on 30-JUL-2002"
FT   CDS             complement(join(17676903..17677087,17678023..17678164,
FT                   17678933..17679060,17679674..17679758))
FT                   /codon_start=1
FT                   /gene="Armet"
FT                   /locus_tag="mCG_19507"
FT                   /product="arginine-rich, mutated in early stage tumors,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19507.2 transcript_id=mCT20033.2
FT                   protein_id=mCP21226.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TMX5"
FT                   /db_xref="InterPro:IPR011001"
FT                   /db_xref="InterPro:IPR019345"
FT                   /db_xref="MGI:MGI:1922090"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TMX5"
FT                   /protein_id="EDL21169.1"
FT                   /translation="MWATRGLAVALALSVLPDSRALRPGDCEVCISYLGRFYQDLKDRD
FT                   VTFSPATIEEELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICE
FT                   KLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGEMCKGCAEKSDYIRKINE
FT                   LMPKYAPKAASARTDL"
FT   mRNA            complement(join(17677893..17678164,17678933..17679060,
FT                   17679674..17679798))
FT                   /gene="Armet"
FT                   /locus_tag="mCG_19507"
FT                   /product="arginine-rich, mutated in early stage tumors,
FT                   transcript variant mCT171388"
FT                   /note="gene_id=mCG19507.2 transcript_id=mCT171388.0 created
FT                   on 30-JUL-2002"
FT   CDS             complement(join(17677964..17678164,17678933..17679060,
FT                   17679674..17679758))
FT                   /codon_start=1
FT                   /gene="Armet"
FT                   /locus_tag="mCG_19507"
FT                   /product="arginine-rich, mutated in early stage tumors,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19507.2 transcript_id=mCT171388.0
FT                   protein_id=mCP94305.0 isoform=CRA_c"
FT                   /db_xref="GOA:E0CXA8"
FT                   /db_xref="InterPro:IPR011001"
FT                   /db_xref="InterPro:IPR019345"
FT                   /db_xref="MGI:MGI:1922090"
FT                   /db_xref="UniProtKB/TrEMBL:E0CXA8"
FT                   /protein_id="EDL21170.1"
FT                   /translation="MWATRGLAVALALSVLPDSRALRPGDCEVCISYLGRFYQDLKDRD
FT                   VTFSPATIEEELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICE
FT                   KLKKKDSQICELKYGECDSDPVPSTISAYPFWT"
FT   gene            complement(17680697..18001534)
FT                   /locus_tag="mCG_123323"
FT                   /note="gene_id=mCG123323.1"
FT   mRNA            complement(join(17680697..17683769,17684602..17684684,
FT                   17688575..17688662,17689639..17689757,17696255..17696402,
FT                   17696845..17696983,17698031..17698152,17711293..17711397,
FT                   17713193..17713279,17714247..17714395,17719097..17719190,
FT                   17719314..17719374,17722477..17722572,17722692..17722718,
FT                   17725103..17725188,17733445..17733593,17736441..17736499,
FT                   17736754..17736854,17737222..17737297,17739550..17739644,
FT                   17745850..17745948,17748220..17748366,17750896..17751023,
FT                   17754902..17755094,17759502..17759672,17768000..17768081,
FT                   17771412..17771512,17773085..17773168,17774945..17775042,
FT                   17775373..17775544,17776033..17776139,17776798..17776960,
FT                   17778909..17779033,17787342..17787467,17788802..17788890,
FT                   17806035..17806182,17807540..17807600,17814367..17814448,
FT                   17839179..17839333,17839852..17839893,17845710..17845794,
FT                   17862126..17862274,17888304..17888400,17909311..17909366,
FT                   17930493..17930533,17954410..17954493,18001149..18001534))
FT                   /locus_tag="mCG_123323"
FT                   /product="mCG123323"
FT                   /note="gene_id=mCG123323.1 transcript_id=mCT124555.1
FT                   created on 11-SEP-2002"
FT   CDS             complement(join(17683260..17683769,17684602..17684684,
FT                   17688575..17688662,17689639..17689757,17696255..17696402,
FT                   17696845..17696983,17698031..17698152,17711293..17711397,
FT                   17713193..17713279,17714247..17714395,17719097..17719190,
FT                   17719314..17719374,17722477..17722572,17722692..17722718,
FT                   17725103..17725188,17733445..17733593,17736441..17736499,
FT                   17736754..17736854,17737222..17737297,17739550..17739644,
FT                   17745850..17745948,17748220..17748366,17750896..17751023,
FT                   17754902..17755094,17759502..17759672,17768000..17768081,
FT                   17771412..17771512,17773085..17773168,17774945..17775042,
FT                   17775373..17775544,17776033..17776139,17776798..17776960,
FT                   17778909..17779033,17787342..17787467,17788802..17788890,
FT                   17806035..17806182,17807540..17807600,17814367..17814448,
FT                   17839179..17839333,17839852..17839893,17845710..17845794,
FT                   17862126..17862274,17888304..17888400,17909311..17909366,
FT                   17930493..17930533,17954410..17954493,18001149..18001185))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123323"
FT                   /product="mCG123323"
FT                   /note="gene_id=mCG123323.1 transcript_id=mCT124555.1
FT                   protein_id=mCP68587.1"
FT                   /protein_id="EDL21172.1"
FT                   /translation="MWTPTEEEKYGVVICSFRGSVPQGLVLEIGETVQILEKCEGWYRG
FT                   VSTKKPNVKGLFPANYIHLKKAIVSNRGQYETVVPLEDSIVTEVTTTLQEWASLWKQLY
FT                   VKHKVDLFYKLRHVMNELIDLRRQLLSGHLTQDQVREVKRHITVRLDWGNEHLGLDLVP
FT                   RKDFEVVDSDQISVSDLYKMHLSSRQSVQQSTSQVDTMRPRHGETCRMPVPHHFFFSLK
FT                   SFTYNTIGEDSDVFFSLYDMREGKQISERFLVRLNKNGGPRNPEKIERMCALFTDLSSK
FT                   DMKRDLYIVAHVIRIGRMLLNDSKKGPAHLHYRRPYGCAVLSILDVLQSLTELKEEKDF
FT                   VLKVYTCNNESEWTQIHENIIRKSSTKYSAPSASHGLIISLQLFRGDMEQIRRENPMIF
FT                   NRGLAITRKLGFPDVIMPGDIRNDLYLTLEKGDFERGGKSVQKNIEVTMYVLYADGEIL
FT                   KDCISLGSGEPNRSSYHSFVLYHSNSPRWGEIIKLPIPIDRFRGSHLRFEFRHCSTKDK
FT                   GEKKLFGFAFSPLMRDDGTTLSDDIHELYVYKCDENSTFNNHALYLGLPCCKEDYNGCP
FT                   NIPSSLIFQRSAKESFFISTQLSSTKLTQNVDLLALLKWKAFPDRIMDILGRLRHVSGE
FT                   EIVKFLQDILDTLFVILDDNTEKYGLLVFQSLVFIINLLRDIKYFHFRPVMDTYIQKHF
FT                   AGALAYKELIRCLKWYMDCSAELIRQDHIQEAMRALEYLFKFIVQSRILYSRATCGMEE
FT                   EQFRSSIQELFQSIRFVLSLDSRNSETLLFTQAALLNSFPTIFDELLQMFTVQEVAEFV
FT                   RGTLGSMPSTVHIGQSMDVVKLQSIARTVDSRLFSFSESRRILLPVVLHHIHLHLRQQK
FT                   ELLICSGILGSIFSIVKTSSLEADVMEEVEMMVESLLDVLLQTLLTIMSKSHAQEAVRG
FT                   QRCPQCTAEITGEYVSCLLSLLRQMCDTHFQHLLDNFQSKDELKEFLLKIFCVFRNLMK
FT                   MSVFPRDWMVMRLLTSNIIVTTVQYLSSALHKNFTETDFDFKVWNSYFSLAVLFINQPS
FT                   LQLEIITSAKRKKILDKYGDMRVMMAYELFSMWQNLGDHKIHFIPGMIGPFLGVTLVPQ
FT                   PEVRNIMIPIFHDMMDWEQRKNGNFKQVEAELIDKLDSMVSEGKGDESYRELFGLLTQL
FT                   FGPYPSLLEKVEQETWRETGISFVTSVTRLMERLLDYRDCMKGEETENKKVGCTVNLMN
FT                   FYKSEINKEEMYIRYIHKLCDMHLQAENYTEAAFTLLLYCELLQWEDRPLREFLHYPSQ
FT                   TEWQRKEGLCRKIIHYFNKGKSWEFGIPLCRELACQYESLYDYQSLSWIRKMEASYYDN
FT                   IIEQQRLEPEFFRVGFYGRKFPFFLREFPGLDKLSPACSGTSTPRGNVLASHSPMSPEN
FT                   IKMTHRHSPMNLMGTGRHSSSSLSSHASSEAGNMMMMGDNSMGEAPEDLYHHMQLAYHN
FT                   PRYQGSVTNVSVLSSSQASPSSSSLSSTHSAPSQMITSAPSSTRGSPSLPDKYRHAREM
FT                   MLLLPTHRDRPSSAMYPAAILENGQPPNFQRALFQQVVGACKPCSDPNLSMAEKGHYSL
FT                   HFDAFHHPLGDTPPALPARTLRKSPLHPIPASPTSPQSGLDGSNSTLSGSASSGVSSLS
FT                   ESNFGHSSEAPPRTDTMDSMPSQAWNGDEGLEPPYLPVHYSLSESAVLDAIKSQPCRSH
FT                   SAPGCVLPQDPMDPPALPPKPYHPRLPALEHDEGMLLREEAERPRGLHRKASLPPGSVK
FT                   EEQARLAWEHGRGEQ"
FT   gene            17706255..17706948
FT                   /pseudo
FT                   /locus_tag="mCG_1032917"
FT                   /note="gene_id=mCG1032917.0"
FT   mRNA            17706255..17706948
FT                   /pseudo
FT                   /locus_tag="mCG_1032917"
FT                   /note="gene_id=mCG1032917.0 transcript_id=mCT150621.1
FT                   created on 30-JUL-2002"
FT   gene            17968123..>17969373
FT                   /locus_tag="mCG_52491"
FT                   /note="gene_id=mCG52491.1"
FT   mRNA            17968123..>17969373
FT                   /locus_tag="mCG_52491"
FT                   /product="mCG52491"
FT                   /note="gene_id=mCG52491.1 transcript_id=mCT52674.2 created
FT                   on 30-JUL-2002"
FT   CDS             17968129..17969373
FT                   /codon_start=1
FT                   /locus_tag="mCG_52491"
FT                   /product="mCG52491"
FT                   /note="gene_id=mCG52491.1 transcript_id=mCT52674.2
FT                   protein_id=mCP41378.1"
FT                   /protein_id="EDL21173.1"
FT                   /translation="MPGMVCKNSDLEFDLLKPCFYLEEDDIYFGGHNSTPPGEDTRKKF
FT                   ELLLTPQLSPGCALAEHSLEPVNRTTEMLLPEVDLWSNPAEEEVLGLGGLRSCTSNTII
FT                   LQDCTREKPESVVSEKLPGSYESLALGTGTLAPRAADATATASCAVWALSETAGMGCGK
FT                   AAWLTEVSHLDSDYVDPAVVFFPANKHEPMPVPTIPTSTGEASNSGSVEEGGKEIYVDM
FT                   LEETQFSENVTRLPTAAHWENAAPSLGCTQSRELILKHCDLIQEQHNYAAPPLPYLDRE
FT                   DPRPQKKPRSLASLGPLKRVLWPKAQRLGSQNNSDLEDVEHHRNHNRTERQRRNHNRTE
FT                   RQRRDIMRSGFLNLRDLVPELAHDEKAAKVVILKKATEYIHTLQADEFKLLVERKKLYK
FT                   RQQQLLEKIRQSAVC"
FT   gene            18010980..18013787
FT                   /locus_tag="mCG_147719"
FT                   /note="gene_id=mCG147719.0"
FT   mRNA            join(18010980..18011008,18012696..18013787)
FT                   /locus_tag="mCG_147719"
FT                   /product="mCG147719"
FT                   /note="gene_id=mCG147719.0 transcript_id=mCT187982.0
FT                   created on 13-JAN-2004"
FT   CDS             18013254..18013514
FT                   /codon_start=1
FT                   /locus_tag="mCG_147719"
FT                   /product="mCG147719"
FT                   /note="gene_id=mCG147719.0 transcript_id=mCT187982.0
FT                   protein_id=mCP108545.0"
FT                   /protein_id="EDL21174.1"
FT                   /translation="MKRKQFHPSQWLQWLSVVPFPSPHSSTGRSTTPTPNSSNSSTLSS
FT                   QTIALFLLDSPASLLSSAFFLLSPKRLPGQPEELNVNNCIE"
FT   gene            complement(18024662..>18059722)
FT                   /gene="Mapkapk3"
FT                   /locus_tag="mCG_18866"
FT                   /note="gene_id=mCG18866.3"
FT   mRNA            complement(join(18024662..18026070,18026795..18026875,
FT                   18027148..18027233,18028058..18028182,18028542..18028617,
FT                   18029773..18029896,18031602..18031681,18032147..18032211,
FT                   18033349..18033488,18058965..18059241,18059370..>18059722))
FT                   /gene="Mapkapk3"
FT                   /locus_tag="mCG_18866"
FT                   /product="mitogen-activated protein kinase-activated
FT                   protein kinase 3, transcript variant mCT191526"
FT                   /note="gene_id=mCG18866.3 transcript_id=mCT191526.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(18024662..18026070,18026795..18026875,
FT                   18027148..18027233,18028058..18028182,18028542..18028617,
FT                   18029773..18029896,18031602..18031681,18032147..18032211,
FT                   18033349..18033488,18058965..>18059255))
FT                   /gene="Mapkapk3"
FT                   /locus_tag="mCG_18866"
FT                   /product="mitogen-activated protein kinase-activated
FT                   protein kinase 3, transcript variant mCT191527"
FT                   /note="gene_id=mCG18866.3 transcript_id=mCT191527.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(18024669..18026070,18026795..18026875,
FT                   18027148..18027233,18028058..18028182,18028542..18028617,
FT                   18029773..18029896,18031602..18031681,18032147..18032211,
FT                   18033349..18033488,18058965..18059241,18059374..18059722))
FT                   /gene="Mapkapk3"
FT                   /locus_tag="mCG_18866"
FT                   /product="mitogen-activated protein kinase-activated
FT                   protein kinase 3, transcript variant mCT16194"
FT                   /note="gene_id=mCG18866.3 transcript_id=mCT16194.2 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(18024669..18026070,18026795..18026875,
FT                   18028058..18028182,18028542..18028617,18029773..18029896,
FT                   18031602..18031681,18032147..18033488,18058965..18059241,
FT                   18059370..>18059593))
FT                   /gene="Mapkapk3"
FT                   /locus_tag="mCG_18866"
FT                   /product="mitogen-activated protein kinase-activated
FT                   protein kinase 3, transcript variant mCT191528"
FT                   /note="gene_id=mCG18866.3 transcript_id=mCT191528.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(18025918..18026070,18026795..18026875,
FT                   18027148..18027233,18028058..18028182,18028542..18028617,
FT                   18029773..18029896,18031602..18031681,18032147..18032211,
FT                   18033349..18033488,18058965..18059241,18059370..>18059392))
FT                   /codon_start=1
FT                   /gene="Mapkapk3"
FT                   /locus_tag="mCG_18866"
FT                   /product="mitogen-activated protein kinase-activated
FT                   protein kinase 3, isoform CRA_c"
FT                   /note="gene_id=mCG18866.3 transcript_id=mCT191526.0
FT                   protein_id=mCP112500.0 isoform=CRA_c"
FT                   /protein_id="EDL21177.1"
FT                   /translation="GITSPCCTCLWTRQAGATSERPVGAMDGETAGEKGSLVPPPGALG
FT                   GSALGGAPAPGVRREPKKYAVTDDYQLSKQVLGLGVNGKVLECYHRRSGQKCALKLLYD
FT                   SPKARQEVDHHWQASGGPHIVRILDVYENMHHGKRCLLIVMECMEGGELFSRIQERGDQ
FT                   AFTEREAAEIMRDIGTAIQFLHSRNIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETT
FT                   QNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGFPPFYSNTGQAISPGM
FT                   KRRIRLGQYSFPNPEWLDVSEDAKQLIRLLLKTDPTERLTIMQFMNHPWINQSMVVPQT
FT                   PLYTARVLQEDKDHWDDVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGS
FT                   SSASQGCNNQ"
FT   CDS             complement(join(18025918..18026070,18026795..18026875,
FT                   18027148..18027233,18028058..18028182,18028542..18028617,
FT                   18029773..18029896,18031602..18031681,18032147..18032211,
FT                   18033349..18033488,18058965..>18059255))
FT                   /codon_start=1
FT                   /gene="Mapkapk3"
FT                   /locus_tag="mCG_18866"
FT                   /product="mitogen-activated protein kinase-activated
FT                   protein kinase 3, isoform CRA_d"
FT                   /note="gene_id=mCG18866.3 transcript_id=mCT191527.0
FT                   protein_id=mCP112501.0 isoform=CRA_d"
FT                   /protein_id="EDL21178.1"
FT                   /translation="SLSFRCLWTRQAGATSERPVGAMDGETAGEKGSLVPPPGALGGSA
FT                   LGGAPAPGVRREPKKYAVTDDYQLSKQVLGLGVNGKVLECYHRRSGQKCALKLLYDSPK
FT                   ARQEVDHHWQASGGPHIVRILDVYENMHHGKRCLLIVMECMEGGELFSRIQERGDQAFT
FT                   EREAAEIMRDIGTAIQFLHSRNIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNA
FT                   LQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGFPPFYSNTGQAISPGMKRR
FT                   IRLGQYSFPNPEWLDVSEDAKQLIRLLLKTDPTERLTIMQFMNHPWINQSMVVPQTPLY
FT                   TARVLQEDKDHWDDVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSA
FT                   SQGCNNQ"
FT   CDS             complement(join(18025918..18026070,18026795..18026875,
FT                   18027148..18027233,18028058..18028182,18028542..18028617,
FT                   18029773..18029896,18031602..18031681,18032147..18032211,
FT                   18033349..18033488,18058965..18059189))
FT                   /codon_start=1
FT                   /gene="Mapkapk3"
FT                   /locus_tag="mCG_18866"
FT                   /product="mitogen-activated protein kinase-activated
FT                   protein kinase 3, isoform CRA_a"
FT                   /note="gene_id=mCG18866.3 transcript_id=mCT16194.2
FT                   protein_id=mCP21352.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UMW7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027442"
FT                   /db_xref="MGI:MGI:2143163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3UMW7"
FT                   /protein_id="EDL21175.1"
FT                   /translation="MDGETAGEKGSLVPPPGALGGSALGGAPAPGVRREPKKYAVTDDY
FT                   QLSKQVLGLGVNGKVLECYHRRSGQKCALKLLYDSPKARQEVDHHWQASGGPHIVRILD
FT                   VYENMHHGKRCLLIVMECMEGGELFSRIQERGDQAFTEREAAEIMRDIGTAIQFLHSRN
FT                   IAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYD
FT                   KSCDMWSLGVIMYILLCGFPPFYSNTGQAISPGMKRRIRLGQYSFPNPEWLDVSEDAKQ
FT                   LIRLLLKTDPTERLTIMQFMNHPWINQSMVVPQTPLYTARVLQEDKDHWDDVKEEMTSA
FT                   LATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ"
FT   CDS             complement(join(18026802..18026875,18028058..18028182,
FT                   18028542..18028617,18029773..18029896,18031602..18031681,
FT                   18032147..>18032255))
FT                   /codon_start=1
FT                   /gene="Mapkapk3"
FT                   /locus_tag="mCG_18866"
FT                   /product="mitogen-activated protein kinase-activated
FT                   protein kinase 3, isoform CRA_e"
FT                   /note="gene_id=mCG18866.3 transcript_id=mCT191528.0
FT                   protein_id=mCP112502.0 isoform=CRA_e"
FT                   /protein_id="EDL21179.1"
FT                   /translation="VVDTQPRPPFCLSCSMEGGELFSRIQERGDQAFTEREAAEIMRDI
FT                   GTAIQFLHSRNIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYYV
FT                   APEVLGPEKYDKSCDMWSLGVIMYILLCGFPPFYSNTGQAISPGMKRRIRLGQYSFPNP
FT                   EWLDVSEDAIHGGPTDPTLHSPSAPGRQRSLG"
FT   mRNA            complement(join(18054359..18054821,18058965..18059241,
FT                   18059374..18059722))
FT                   /gene="Mapkapk3"
FT                   /locus_tag="mCG_18866"
FT                   /product="mitogen-activated protein kinase-activated
FT                   protein kinase 3, transcript variant mCT171614"
FT                   /note="gene_id=mCG18866.3 transcript_id=mCT171614.0 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(18054753..18054821,18058965..18059189))
FT                   /codon_start=1
FT                   /gene="Mapkapk3"
FT                   /locus_tag="mCG_18866"
FT                   /product="mitogen-activated protein kinase-activated
FT                   protein kinase 3, isoform CRA_b"
FT                   /note="gene_id=mCG18866.3 transcript_id=mCT171614.0
FT                   protein_id=mCP94533.0 isoform=CRA_b"
FT                   /protein_id="EDL21176.1"
FT                   /translation="MDGETAGEKGSLVPPPGALGGSALGGAPAPGVRREPKKYAVTDDY
FT                   QLSKQVLGLGVNGKVLECYHRRSGQKCALKVRNPRVGQWPCTAESLERQGFH"
FT   gene            complement(18062274..18063154)
FT                   /pseudo
FT                   /locus_tag="mCG_18853"
FT                   /note="gene_id=mCG18853.1"
FT   mRNA            complement(18062274..18063154)
FT                   /pseudo
FT                   /locus_tag="mCG_18853"
FT                   /note="gene_id=mCG18853.1 transcript_id=mCT16180.1 created
FT                   on 06-AUG-2002"
FT   gene            18065953..18072685
FT                   /gene="Cish"
FT                   /locus_tag="mCG_18870"
FT                   /note="gene_id=mCG18870.2"
FT   mRNA            join(18065953..18066963,18069825..18070045,
FT                   18070269..18071865)
FT                   /gene="Cish"
FT                   /locus_tag="mCG_18870"
FT                   /product="cytokine inducible SH2-containing protein,
FT                   transcript variant mCT16197"
FT                   /note="gene_id=mCG18870.2 transcript_id=mCT16197.2 created
FT                   on 12-JUL-2002"
FT   mRNA            join(<18066808..18066963,18070269..18072685)
FT                   /gene="Cish"
FT                   /locus_tag="mCG_18870"
FT                   /product="cytokine inducible SH2-containing protein,
FT                   transcript variant mCT191549"
FT                   /note="gene_id=mCG18870.2 transcript_id=mCT191549.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<18066810..18066963,18070269..18070801)
FT                   /codon_start=1
FT                   /gene="Cish"
FT                   /locus_tag="mCG_18870"
FT                   /product="cytokine inducible SH2-containing protein,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG18870.2 transcript_id=mCT191549.0
FT                   protein_id=mCP112505.0 isoform=CRA_b"
FT                   /protein_id="EDL21181.1"
FT                   /translation="TTAFQSLLAARVPRDPDLRTPGTHWLLSPSIPPNSDSRAAVVSGT
FT                   WSFAYRGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEY
FT                   ADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAPTPALPMSKQDAP
FT                   SDSVLPIPVATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLR
FT                   QYPFQL"
FT   CDS             join(18066944..18066963,18069825..18070045,
FT                   18070269..18070801)
FT                   /codon_start=1
FT                   /gene="Cish"
FT                   /locus_tag="mCG_18870"
FT                   /product="cytokine inducible SH2-containing protein,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG18870.2 transcript_id=mCT16197.2
FT                   protein_id=mCP21229.2 isoform=CRA_a"
FT                   /protein_id="EDL21180.1"
FT                   /translation="MVLCVQGSCPLLAVEQIGRRPLWAQSLELPGPAMQPLPTGAFPEE
FT                   VTEETPVQAENEPKVLDPEGDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTF
FT                   LVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHY
FT                   VASCAADTRSDSPDPAPTPALPMSKQDAPSDSVLPIPVATAVHLKLVQPFVRRSSARSL
FT                   QHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL"
FT   gene            complement(18097343..>18107956)
FT                   /gene="Hemk1"
FT                   /locus_tag="mCG_18880"
FT                   /note="gene_id=mCG18880.3"
FT   mRNA            complement(join(18097343..18097723,18097827..18097940,
FT                   18098086..18098181,18098975..18099083,18100424..18100473,
FT                   18100743..18100807,18101097..18101231,18105816..18105909,
FT                   18106208..18107014,18107918..>18107956))
FT                   /gene="Hemk1"
FT                   /locus_tag="mCG_18880"
FT                   /product="HemK methyltransferase family member 1,
FT                   transcript variant mCT191521"
FT                   /note="gene_id=mCG18880.3 transcript_id=mCT191521.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(18097354..18097723,18097827..18097940,
FT                   18098086..18098181,18098975..18099083,18100424..18100473,
FT                   18100743..18100807,18101097..18101231,18105816..18105909,
FT                   18106208..18106299,18106637..18107014,18107918..18107949))
FT                   /gene="Hemk1"
FT                   /locus_tag="mCG_18880"
FT                   /product="HemK methyltransferase family member 1,
FT                   transcript variant mCT16207"
FT                   /note="gene_id=mCG18880.3 transcript_id=mCT16207.2 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(18097687..18097723,18097827..18097940,
FT                   18098086..18098181,18098975..18099083,18100424..18100473,
FT                   18100743..18100807,18101097..18101231,18105816..18105909,
FT                   18106208..18106299,18106637..18106867))
FT                   /codon_start=1
FT                   /gene="Hemk1"
FT                   /locus_tag="mCG_18880"
FT                   /product="HemK methyltransferase family member 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18880.3 transcript_id=mCT16207.2
FT                   protein_id=mCP21249.2 isoform=CRA_a"
FT                   /protein_id="EDL21182.1"
FT                   /translation="MKLWGQILWTLLSVPRGRRGVLQGWAFNSWKTYSSLTGPLSATGM
FT                   VNHWTQVFEERGIPEARESSEYIVAHVLGAKTFQSLKPALWTKPLTPQQLECIQELCGH
FT                   RLQRMPVQYILGEWDFQGLSLKMVPPVFIPRPETEELVEWVLEEVARRPHAVRAQDGPL
FT                   ILEVGCGSGAITLSLLSQLPKSRVVAVDKEEAAVSLTHENARRLQLQDRIRIICLDITS
FT                   EGCCTHLLPWSPLDLVVSNPPYIFRKDMEQLAPEICSYEDLVALDGGDEGMDIITHILT
FT                   LAPQLLNASGSIFLEVDPRHPELVSSWLQSHPDLHLSLVGVREDFCGRPRFLHVQKSAP
FT                   "
FT   CDS             complement(join(18097687..18097723,18097827..18097940,
FT                   18098086..18098181,18098975..18099083,18100424..18100473,
FT                   18100743..18100807,18101097..18101231,18105816..18105909,
FT                   18106208..>18106338))
FT                   /codon_start=1
FT                   /gene="Hemk1"
FT                   /locus_tag="mCG_18880"
FT                   /product="HemK methyltransferase family member 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18880.3 transcript_id=mCT191521.0
FT                   protein_id=mCP112507.0 isoform=CRA_b"
FT                   /protein_id="EDL21183.1"
FT                   /translation="TKGASHSHSPWEQFQSLKPALWTKPLTPQQLECIQELCGHRLQRM
FT                   PVQYILGEWDFQGLSLKMVPPVFIPRPETEELVEWVLEEVARRPHAVRAQDGPLILEVG
FT                   CGSGAITLSLLSQLPKSRVVAVDKEEAAVSLTHENARRLQLQDRIRIICLDITSEGCCT
FT                   HLLPWSPLDLVVSNPPYIFRKDMEQLAPEICSYEDLVALDGGDEGMDIITHILTLAPQL
FT                   LNASGSIFLEVDPRHPELVSSWLQSHPDLHLSLVGVREDFCGRPRFLHVQKSAP"
FT   gene            18110275..18122217
FT                   /gene="6430571L13Rik"
FT                   /locus_tag="mCG_18864"
FT                   /note="gene_id=mCG18864.2"
FT   mRNA            join(18110275..18110430,18110952..18111058,
FT                   18111708..18112090,18115733..18115758,18116619..18116766,
FT                   18117749..18118088,18121906..18122217)
FT                   /gene="6430571L13Rik"
FT                   /locus_tag="mCG_18864"
FT                   /product="RIKEN cDNA 6430571L13, transcript variant
FT                   mCT171613"
FT                   /note="gene_id=mCG18864.2 transcript_id=mCT171613.0 created
FT                   on 17-APR-2003"
FT   mRNA            join(18110275..18110430,18110952..18111058,
FT                   18111708..18112090,18115733..18115758,18116619..18116766,
FT                   18117749..18119487)
FT                   /gene="6430571L13Rik"
FT                   /locus_tag="mCG_18864"
FT                   /product="RIKEN cDNA 6430571L13, transcript variant
FT                   mCT16192"
FT                   /note="gene_id=mCG18864.2 transcript_id=mCT16192.3 created
FT                   on 17-APR-2003"
FT   CDS             join(18111851..18112090,18115733..18115758,
FT                   18116619..18116766,18117749..18117829)
FT                   /codon_start=1
FT                   /gene="6430571L13Rik"
FT                   /locus_tag="mCG_18864"
FT                   /product="RIKEN cDNA 6430571L13, isoform CRA_a"
FT                   /note="gene_id=mCG18864.2 transcript_id=mCT171613.0
FT                   protein_id=mCP94532.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q14AT3"
FT                   /db_xref="MGI:MGI:2445137"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AT3"
FT                   /protein_id="EDL21184.1"
FT                   /translation="MNSRVPATQSWFSSHLPTTEPDLEPATAAEGSTTETATLSPETTS
FT                   FNDTRIPDVAGGAAGVGTMLLSFGIITVIGLAVAMVLYIRKKKRLEKLRHQLMPMYNFD
FT                   PTEEQDELEQELLEHGRDAASMQAAASLQVTQGKSTLPSQGPLQRPSRLVFTDVANAIH
FT                   A"
FT   CDS             join(18111851..18112090,18115733..18115758,
FT                   18116619..18116766,18117749..18117829)
FT                   /codon_start=1
FT                   /gene="6430571L13Rik"
FT                   /locus_tag="mCG_18864"
FT                   /product="RIKEN cDNA 6430571L13, isoform CRA_a"
FT                   /note="gene_id=mCG18864.2 transcript_id=mCT16192.3
FT                   protein_id=mCP21309.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q14AT3"
FT                   /db_xref="MGI:MGI:2445137"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AT3"
FT                   /protein_id="EDL21185.1"
FT                   /translation="MNSRVPATQSWFSSHLPTTEPDLEPATAAEGSTTETATLSPETTS
FT                   FNDTRIPDVAGGAAGVGTMLLSFGIITVIGLAVAMVLYIRKKKRLEKLRHQLMPMYNFD
FT                   PTEEQDELEQELLEHGRDAASMQAAASLQVTQGKSTLPSQGPLQRPSRLVFTDVANAIH
FT                   A"
FT   gene            complement(18123092..18123793)
FT                   /locus_tag="mCG_1032919"
FT                   /note="gene_id=mCG1032919.0"
FT   mRNA            complement(join(18123092..18123397,18123538..18123793))
FT                   /locus_tag="mCG_1032919"
FT                   /product="mCG1032919"
FT                   /note="gene_id=mCG1032919.0 transcript_id=mCT150623.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(18123669..18123791)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032919"
FT                   /product="mCG1032919"
FT                   /note="gene_id=mCG1032919.0 transcript_id=mCT150623.0
FT                   protein_id=mCP68730.1"
FT                   /protein_id="EDL21186.1"
FT                   /translation="MGLVARENGRGSGCLAQGPSCLALGQAKPLMERSRLEIMW"
FT   gene            18171729..18301813
FT                   /gene="Cacna2d2"
FT                   /locus_tag="mCG_18860"
FT                   /note="gene_id=mCG18860.2"
FT   mRNA            join(18171729..18171996,18197789..18197870,
FT                   18237230..18237346,18269077..18269136,18277564..18277608,
FT                   18280811..18280952,18283624..18283755,18283926..18283983,
FT                   18284678..18284728,18284857..18284956,18285097..18285255,
FT                   18285459..18285566,18285669..18285747,18286256..18286305,
FT                   18286484..18286573,18286775..18286846,18287043..18287117,
FT                   18288719..18288793,18288875..18288946,18289034..18289105,
FT                   18289212..18289273,18290323..18290399,18291686..18291706,
FT                   18294622..18294682,18296594..18296691,18296897..18296987,
FT                   18297111..18297173,18297330..18297433,18297656..18297754,
FT                   18297843..18297931,18298112..18298159,18298400..18298471,
FT                   18298562..18298714,18298842..18298894,18298984..18299039,
FT                   18299187..18299313,18299436..18299545,18299641..18299723,
FT                   18299808..18301813)
FT                   /gene="Cacna2d2"
FT                   /locus_tag="mCG_18860"
FT                   /product="calcium channel, voltage-dependent, alpha 2/delta
FT                   subunit 2, transcript variant mCT16187"
FT                   /note="gene_id=mCG18860.2 transcript_id=mCT16187.3 created
FT                   on 20-FEB-2003"
FT   mRNA            join(<18171777..18171996,18197789..18197870,
FT                   18237230..18237346,18269077..18269136,18277564..18277608,
FT                   18280811..18280952,18283624..18283755,18283926..18283983,
FT                   18284678..18284728,18284857..18284956,18285097..18285255,
FT                   18285459..18285566,18285669..18285747,18286256..18286305,
FT                   18286484..18286573,18286775..18286846,18287043..18287117,
FT                   18288719..18288793,18288875..18288946,18289034..18289105,
FT                   18289212..18289273,18290323..18290399,18294622..18294682,
FT                   18296594..18296691,18296897..18296987,18297111..18297173,
FT                   18297330..18297433,18297656..18297754,18297843..18297931,
FT                   18298109..18298159,18298400..18298471,18298562..18298714,
FT                   18298842..18298894,18298984..18299039,18299187..18299313,
FT                   18299436..18299545,18299641..18299723,18299808..18300026)
FT                   /gene="Cacna2d2"
FT                   /locus_tag="mCG_18860"
FT                   /product="calcium channel, voltage-dependent, alpha 2/delta
FT                   subunit 2, transcript variant mCT191513"
FT                   /note="gene_id=mCG18860.2 transcript_id=mCT191513.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<18171779..18171996,18197789..18197870,
FT                   18237230..18237346,18269077..18269136,18277564..18277608,
FT                   18280811..18280952,18283624..18283755,18283926..18283983,
FT                   18284678..18284728,18284857..18284956,18285097..18285255,
FT                   18285459..18285566,18285669..18285747,18286256..18286305,
FT                   18286484..18286573,18286775..18286846,18287043..18287117,
FT                   18288719..18288793,18288875..18288946,18289034..18289105,
FT                   18289212..18289273,18290323..18290399,18294622..18294682,
FT                   18296594..18296691,18296897..18296987,18297111..18297173,
FT                   18297330..18297433,18297656..18297754,18297843..18297931,
FT                   18298109..18298159,18298400..18298471,18298562..18298714,
FT                   18298842..18298894,18298984..18299039,18299187..18299313,
FT                   18299436..18299545,18299641..18299723,18299808..18299951)
FT                   /codon_start=1
FT                   /gene="Cacna2d2"
FT                   /locus_tag="mCG_18860"
FT                   /product="calcium channel, voltage-dependent, alpha 2/delta
FT                   subunit 2, isoform CRA_b"
FT                   /note="gene_id=mCG18860.2 transcript_id=mCT191513.0
FT                   protein_id=mCP112493.0 isoform=CRA_b"
FT                   /protein_id="EDL21188.1"
FT                   /translation="NMAVPARTCGASWPGPVRTARPWPGRGPRPCPDPRGPASGPARPL
FT                   LLLLPPLLLLPLLTAPGASAYSFPQQHTMQHWARRLEQEIDGVMRIFGGVQQLREIYKD
FT                   NRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDI
FT                   MYYDAKADAELDDPESEDMERGSKTSALRLDFIEDPNFKNKVNYSYTAVQIPTDIYKGS
FT                   TVILNELNWTEALENVFIENRRQDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVR
FT                   RRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKA
FT                   QPVSCFTHLVQANVRNKKVFKEAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKM
FT                   IMMFTDGGEDRVQDVFEKYNWPNRTVRVFTFSVGQHNYDVTPLQWMACTNKGYYFEIPS
FT                   IGAIRINTQEYLDVLGRPMVLAGKDAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGP
FT                   GEKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFR
FT                   EPVTLDFLDAELEDENKEEIRRSMIDGDKGHKQIRTLVKSLDERYIDEVIRNYTWVPIR
FT                   STNYSLGLVLPPYSTYYLQANLSDQILQVKYFEFLLPSSFESEGHVFIAPREYCKDLNA
FT                   SDNNTEFLKNFIELMEKVTPDSKQCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLL
FT                   AVFAATDGGITRVFPNKAAEDWTENPEPFNASFYRRSLDNHGYIFKPPHQDSLLRPLEL
FT                   ENDTVGVLVSTAVELSLGRRTLRPAVVGVKLDLEAWAEKFKVLASNRTHQDQPQKQCGP
FT                   SSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYNNSFY
FT                   TRKESYDYQAACAPQPPGNLGAAPRGVFVPTIADFLNLAWWTSAAAWSLFQQLLYGLIY
FT                   HSWFQADPAEAEGSPETRESSCVMKQTQYYFGSVNASYNAIIDCGNCSRLFHAQRLTNT
FT                   NLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQCELVQRPRYRRGPHICFDYNATEDTSD
FT                   CGRGASFPPSLGVLVSLQLLLLLGLPPRPQPQVHSFAASRHL"
FT   CDS             join(18171782..18171996,18197789..18197870,
FT                   18237230..18237346,18269077..18269136,18277564..18277608,
FT                   18280811..18280952,18283624..18283755,18283926..18283983,
FT                   18284678..18284728,18284857..18284956,18285097..18285255,
FT                   18285459..18285566,18285669..18285747,18286256..18286305,
FT                   18286484..18286573,18286775..18286846,18287043..18287117,
FT                   18288719..18288793,18288875..18288946,18289034..18289105,
FT                   18289212..18289273,18290323..18290399,18291686..18291706,
FT                   18294622..18294682,18296594..18296691,18296897..18296987,
FT                   18297111..18297173,18297330..18297433,18297656..18297754,
FT                   18297843..18297931,18298112..18298159,18298400..18298471,
FT                   18298562..18298714,18298842..18298894,18298984..18299039,
FT                   18299187..18299313,18299436..18299545,18299641..18299723,
FT                   18299808..18299951)
FT                   /codon_start=1
FT                   /gene="Cacna2d2"
FT                   /locus_tag="mCG_18860"
FT                   /product="calcium channel, voltage-dependent, alpha 2/delta
FT                   subunit 2, isoform CRA_a"
FT                   /note="gene_id=mCG18860.2 transcript_id=mCT16187.3
FT                   protein_id=mCP21228.3 isoform=CRA_a"
FT                   /protein_id="EDL21187.1"
FT                   /translation="MAVPARTCGASWPGPVRTARPWPGRGPRPCPDPRGPASGPARPLL
FT                   LLLPPLLLLPLLTAPGASAYSFPQQHTMQHWARRLEQEIDGVMRIFGGVQQLREIYKDN
FT                   RNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIM
FT                   YYDAKADAELDDPESEDMERGSKTSALRLDFIEDPNFKNKVNYSYTAVQIPTDIYKGST
FT                   VILNELNWTEALENVFIENRRQDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRR
FT                   RPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQ
FT                   PVSCFTHLVQANVRNKKVFKEAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMI
FT                   MMFTDGGEDRVQDVFEKYNWPNRTVRVFTFSVGQHNYDVTPLQWMACTNKGYYFEIPSI
FT                   GAIRINTQEYLDVLGRPMVLAGKDAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPG
FT                   EKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFRE
FT                   PVTLDFLDAELEDENKEEIRRSMIDGDKGHKQIRTLVKSLDERYIDEVIRNYTWVPIRS
FT                   TNYSLGLVLPPYSTYYLQANLSDQILQVKLPISKLKDFEFLLPSSFESEGHVFIAPREY
FT                   CKDLNASDNNTEFLKNFIELMEKVTPDSKQCNNFLLHNLILDTGITQQLVERVWRDQDL
FT                   NTYSLLAVFAATDGGITRVFPNKAAEDWTENPEPFNASFYRRSLDNHGYIFKPPHQDSL
FT                   LRPLELENDTVGVLVSTAVELSLGRRTLRPAVVGVKLDLEAWAEKFKVLASNRTHQDQP
FT                   QKCGPSSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALY
FT                   NNSFYTRKESYDYQAACAPQPPGNLGAAPRGVFVPTIADFLNLAWWTSAAAWSLFQQLL
FT                   YGLIYHSWFQADPAEAEGSPETRESSCVMKQTQYYFGSVNASYNAIIDCGNCSRLFHAQ
FT                   RLTNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQCELVQRPRYRRGPHICFDYNAT
FT                   EDTSDCGRGASFPPSLGVLVSLQLLLLLGLPPRPQPQVHSFAASRHL"
FT   gene            complement(18195594..18202297)
FT                   /locus_tag="mCG_1051019"
FT                   /note="gene_id=mCG1051019.0"
FT   mRNA            complement(join(18195594..18198290,18199332..18199468,
FT                   18199866..18199938,18201271..18201343,18202132..18202297))
FT                   /locus_tag="mCG_1051019"
FT                   /product="mCG1051019"
FT                   /note="gene_id=mCG1051019.0 transcript_id=mCT194808.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(18197643..18197984)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051019"
FT                   /product="mCG1051019"
FT                   /note="gene_id=mCG1051019.0 transcript_id=mCT194808.0
FT                   protein_id=mCP115837.0"
FT                   /protein_id="EDL21189.1"
FT                   /translation="MRSGTSVMSPPPYARIMYPSLIPAGKKVSAGKQVHQAYLSELLHA
FT                   SKNPHHTVNLLLQAPGPVLHPAIQRRKMSGGPAGAAAATTNSWPPRGTRTATHSTQFSP
FT                   EREQTQEPE"
FT   gene            18306417..18311152
FT                   /gene="Tmem115"
FT                   /locus_tag="mCG_18863"
FT                   /note="gene_id=mCG18863.2"
FT   mRNA            join(18306417..18307801,18310347..18311152)
FT                   /gene="Tmem115"
FT                   /locus_tag="mCG_18863"
FT                   /product="transmembrane protein 115"
FT                   /note="gene_id=mCG18863.2 transcript_id=mCT16191.2 created
FT                   on 12-JUL-2002"
FT   CDS             join(18306951..18307801,18310347..18310548)
FT                   /codon_start=1
FT                   /gene="Tmem115"
FT                   /locus_tag="mCG_18863"
FT                   /product="transmembrane protein 115"
FT                   /note="gene_id=mCG18863.2 transcript_id=mCT16191.2
FT                   protein_id=mCP21227.1"
FT                   /db_xref="GOA:Q543Y8"
FT                   /db_xref="InterPro:IPR013861"
FT                   /db_xref="MGI:MGI:1930765"
FT                   /db_xref="UniProtKB/TrEMBL:Q543Y8"
FT                   /protein_id="EDL21190.1"
FT                   /translation="MQRALPGARQHLGAILASASVVVKALCAVVLFLYLLSFAVDTGCL
FT                   AVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLATVVVAGRLLEPLWGALELLIFFSV
FT                   VNVSVGLLGALAYLLTYMASFNLVYLFTIRIHGALGFLGGVLVALKQTMGDCVVLRVPQ
FT                   VRVSVVPMLLLALLLLLRLATLLQSPALASYGFGLLSSWVYLRFYQRHSRGRGDMADHF
FT                   AFATFFPEILQPVVGLLANLVHGLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAE
FT                   RRRQLALKALNERLKRVEDQSAWPSMDDDEEEAGAKTDSPLPLEEASTPPGKVTVPESS
FT                   LITLETAPLL"
FT   gene            complement(18312040..18314676)
FT                   /gene="Cyb561d2"
FT                   /locus_tag="mCG_18856"
FT                   /note="gene_id=mCG18856.2"
FT   mRNA            complement(join(18312040..18312867,18313485..18313522,
FT                   18313979..18314132,18314518..18314676))
FT                   /gene="Cyb561d2"
FT                   /locus_tag="mCG_18856"
FT                   /product="cytochrome b-561 domain containing 2, transcript
FT                   variant mCT16183"
FT                   /note="gene_id=mCG18856.2 transcript_id=mCT16183.1 created
FT                   on 16-JUL-2002"
FT   mRNA            complement(join(18312040..18312867,18313485..18313522,
FT                   18313979..18314349))
FT                   /gene="Cyb561d2"
FT                   /locus_tag="mCG_18856"
FT                   /product="cytochrome b-561 domain containing 2, transcript
FT                   variant mCT170771"
FT                   /note="gene_id=mCG18856.2 transcript_id=mCT170771.0 created
FT                   on 16-JUL-2002"
FT   CDS             complement(join(18312364..18312867,18313485..18313522,
FT                   18313979..18314105))
FT                   /codon_start=1
FT                   /gene="Cyb561d2"
FT                   /locus_tag="mCG_18856"
FT                   /product="cytochrome b-561 domain containing 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18856.2 transcript_id=mCT16183.1
FT                   protein_id=mCP21382.1 isoform=CRA_a"
FT                   /protein_id="EDL21191.1"
FT                   /translation="MALSVETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLF
FT                   SWHPVLMSLAFSFLMTEALLMFSPESSLLRSLSRKVRARCHWVLQLLALLCALLGLGLV
FT                   ILHKEQLGKAHLTTRHGQAGLLAVLWAGLQCSGGMGLLYPKLLPRWPLAKLKLYHATSG
FT                   LVGYLLGSASLLLGMFSLWFTATVTGGAWYLAVLCPILTSLVIMNQVSNAYLYRKRIQP
FT                   "
FT   CDS             complement(join(18312364..18312867,18313485..18313522,
FT                   18313979..18314105))
FT                   /codon_start=1
FT                   /gene="Cyb561d2"
FT                   /locus_tag="mCG_18856"
FT                   /product="cytochrome b-561 domain containing 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18856.2 transcript_id=mCT170771.0
FT                   protein_id=mCP93689.0 isoform=CRA_a"
FT                   /protein_id="EDL21192.1"
FT                   /translation="MALSVETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLF
FT                   SWHPVLMSLAFSFLMTEALLMFSPESSLLRSLSRKVRARCHWVLQLLALLCALLGLGLV
FT                   ILHKEQLGKAHLTTRHGQAGLLAVLWAGLQCSGGMGLLYPKLLPRWPLAKLKLYHATSG
FT                   LVGYLLGSASLLLGMFSLWFTATVTGGAWYLAVLCPILTSLVIMNQVSNAYLYRKRIQP
FT                   "
FT   gene            18314711..18318176
FT                   /gene="Tusc4"
FT                   /locus_tag="mCG_18851"
FT                   /note="gene_id=mCG18851.1"
FT   mRNA            join(18314711..18314936,18315465..18315556,
FT                   18315649..18315817,18315988..18316096,18316632..18316768,
FT                   18316861..18316958,18317079..18317115,18317228..18317321,
FT                   18317395..18317512,18317726..18317868,18317972..18318176)
FT                   /gene="Tusc4"
FT                   /locus_tag="mCG_18851"
FT                   /product="tumor suppressor candidate 4, transcript variant
FT                   mCT15941"
FT                   /note="gene_id=mCG18851.1 transcript_id=mCT15941.1 created
FT                   on 16-JUL-2002"
FT   mRNA            join(<18314726..18314936,18315465..18315556,
FT                   18315649..18315817,18315988..18316096,18316632..18316768,
FT                   18316861..18316958,18317079..18317321,18317395..18317868,
FT                   18317972..18318176)
FT                   /gene="Tusc4"
FT                   /locus_tag="mCG_18851"
FT                   /product="tumor suppressor candidate 4, transcript variant
FT                   mCT191548"
FT                   /note="gene_id=mCG18851.1 transcript_id=mCT191548.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<18314727..18314936,18315465..18315556,
FT                   18315649..18315817,18315988..18316096,18316632..18316768,
FT                   18316861..18316958,18317079..18317151)
FT                   /codon_start=1
FT                   /gene="Tusc4"
FT                   /locus_tag="mCG_18851"
FT                   /product="tumor suppressor candidate 4, isoform CRA_a"
FT                   /note="gene_id=mCG18851.1 transcript_id=mCT191548.0
FT                   protein_id=mCP112490.0 isoform=CRA_a"
FT                   /protein_id="EDL21193.1"
FT                   /translation="LVGFALTNLCDLPGPLSLFDRVFQGVEAIPTRKTGITDLDPDSAM
FT                   GSSCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPELQNKLITVTAM
FT                   EKKLIGCPVCIEHKKYSRNALLFNLGFVCDAQAKTCALEPIVKKLAGYLTTLELESSFV
FT                   SNEESKQKLVPIMTILLEELNASGRCTLPIDESNTIHLKVIEQRPDPPVAQEYDVPVFT
FT                   KDKEDFFSSQWDLTTQQILPYIDGFRHVQKISAEADVELNLVRIAIQNLLYYGVVTLVS
FT                   ILQVGESGMQLSKM"
FT   CDS             join(18314859..18314936,18315465..18315556,
FT                   18315649..18315817,18315988..18316096,18316632..18316768,
FT                   18316861..18316958,18317079..18317115,18317228..18317321,
FT                   18317395..18317512,18317726..18317868,18317972..18318039)
FT                   /codon_start=1
FT                   /gene="Tusc4"
FT                   /locus_tag="mCG_18851"
FT                   /product="tumor suppressor candidate 4, isoform CRA_b"
FT                   /note="gene_id=mCG18851.1 transcript_id=mCT15941.1
FT                   protein_id=mCP21372.2 isoform=CRA_b"
FT                   /protein_id="EDL21194.1"
FT                   /translation="MGSSCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYII
FT                   TKPELQNKLITVTAMEKKLIGCPVCIEHKKYSRNALLFNLGFVCDAQAKTCALEPIVKK
FT                   LAGYLTTLELESSFVSNEESKQKLVPIMTILLEELNASGRCTLPIDESNTIHLKVIEQR
FT                   PDPPVAQEYDVPVFTKDKEDFFSSQWDLTTQQILPYIDGFRHVQKISAEADVELNLVRI
FT                   AIQNLLYYGVVTLVSILQYSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDV
FT                   FQLYCSLSPGTTVRDLIGRHPQQLQHVDERKLIQFGLMKNLIRRLQKYPVRVSREERSH
FT                   PARLYTGCHSYDEICCKTGMSYHELDERLENDPNIIICWK"
FT   gene            18319785..18323800
FT                   /gene="Zmynd10"
FT                   /locus_tag="mCG_18859"
FT                   /note="gene_id=mCG18859.2"
FT   mRNA            join(18319785..18320029,18320281..18320389,
FT                   18321151..18321267,18321361..18321414,18321509..18321646,
FT                   18321761..18321849,18321947..18322047,18322356..18322528,
FT                   18322765..18322890,18322979..18323100,18323221..18323346,
FT                   18323442..18323800)
FT                   /gene="Zmynd10"
FT                   /locus_tag="mCG_18859"
FT                   /product="zinc finger, MYND domain containing 10,
FT                   transcript variant mCT16186"
FT                   /note="gene_id=mCG18859.2 transcript_id=mCT16186.2 created
FT                   on 19-JUL-2002"
FT   mRNA            join(<18319935..18320029,18321361..18321414,
FT                   18321509..18321646,18321761..18321849,18321947..18322047,
FT                   18322356..18322528,18322765..18322890,18322979..18323100,
FT                   18323221..18323346,18323442..18323800)
FT                   /gene="Zmynd10"
FT                   /locus_tag="mCG_18859"
FT                   /product="zinc finger, MYND domain containing 10,
FT                   transcript variant mCT191556"
FT                   /note="gene_id=mCG18859.2 transcript_id=mCT191556.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(18319938..18320029,18320281..18320389,
FT                   18321151..18321267,18321361..18321414,18321509..18321646,
FT                   18321761..18321849,18321947..18322047,18322356..18322528,
FT                   18322765..18322890,18322979..18323100,18323221..18323346,
FT                   18323442..18323517)
FT                   /codon_start=1
FT                   /gene="Zmynd10"
FT                   /locus_tag="mCG_18859"
FT                   /product="zinc finger, MYND domain containing 10, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18859.2 transcript_id=mCT16186.2
FT                   protein_id=mCP21394.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q99ML0"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR017333"
FT                   /db_xref="MGI:MGI:2387863"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99ML0"
FT                   /protein_id="EDL21195.1"
FT                   /translation="MGDLELLLPGEAEVLVRGLRSFQLREMGSEGWNKQHESLEKLNMQ
FT                   AILDATISQAEPIQELLINHGKIPTLVEELIAVEMWKQKVFPVLCRLEDFKPQNTFPIY
FT                   MVVHHEASIINLLETVFFHKEVCESADDKVLDLVDYCHRKLILLVARKGGGDLSEEEQF
FT                   QDSTPMQELQKQAEMMEFEISLKALSVLRYITDCVDSLSLSTLNRMLRTHNLPCLLVEL
FT                   LEHSPWSRRVGGKLQHFESGRWQTVAPSEQQKLNKLDGQVWIALYNLLLSPEARARYCL
FT                   TSFAKGQLLKLQAFLTDTLLDQLPNLADLKGFLAHLSLAETQPPKKDLVLEQIPEIWDR
FT                   LERENKGKWQAIAKHQLQHVFSLSEKDLRQQAQRWAETYRLDVLEAVAPERPRCGYCNA
FT                   EASKRCSRCQNVWYCCRECQVKHWEKHGKTCVLAAQGDRAK"
FT   CDS             join(<18320027..18320029,18321361..18321414,
FT                   18321509..18321646,18321761..18321849,18321947..18322047,
FT                   18322356..18322528,18322765..18322890,18322979..18323100,
FT                   18323221..18323346,18323442..18323517)
FT                   /codon_start=1
FT                   /gene="Zmynd10"
FT                   /locus_tag="mCG_18859"
FT                   /product="zinc finger, MYND domain containing 10, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18859.2 transcript_id=mCT191556.0
FT                   protein_id=mCP112492.0 isoform=CRA_b"
FT                   /protein_id="EDL21196.1"
FT                   /translation="RVHHEASIINLLETVFFHKEVCESADDKVLDLVDYCHRKLILLVA
FT                   RKGGGDLSEEEQFQDSTPMQELQKQAEMMEFEISLKALSVLRYITDCVDSLSLSTLNRM
FT                   LRTHNLPCLLVELLEHSPWSRRVGGKLQHFESGRWQTVAPSEQQKLNKLDGQVWIALYN
FT                   LLLSPEARARYCLTSFAKGQLLKLQAFLTDTLLDQLPNLADLKGFLAHLSLAETQPPKK
FT                   DLVLEQIPEIWDRLERENKGKWQAIAKHQLQHVFSLSEKDLRQQAQRWAETYRLDVLEA
FT                   VAPERPRCGYCNAEASKRCSRCQNVWYCCRECQVKHWEKHGKTCVLAAQGDRAK"
FT   gene            18324071..18334727
FT                   /gene="Rassf1"
FT                   /locus_tag="mCG_18873"
FT                   /note="gene_id=mCG18873.2"
FT   mRNA            join(18324071..18324327,18326618..18326724,
FT                   18329936..18330040,18330253..18330550,18330666..18330781,
FT                   18333859..18334727)
FT                   /gene="Rassf1"
FT                   /locus_tag="mCG_18873"
FT                   /product="Ras association (RalGDS/AF-6) domain family 1,
FT                   transcript variant mCT170779"
FT                   /note="gene_id=mCG18873.2 transcript_id=mCT170779.0 created
FT                   on 16-JUL-2002"
FT   CDS             join(18324078..18324327,18326618..18326724,
FT                   18329936..18330040,18330253..18330550,18330666..18330781,
FT                   18333859..18334005)
FT                   /codon_start=1
FT                   /gene="Rassf1"
FT                   /locus_tag="mCG_18873"
FT                   /product="Ras association (RalGDS/AF-6) domain family 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG18873.2 transcript_id=mCT170779.0
FT                   protein_id=mCP93697.0 isoform=CRA_b"
FT                   /db_xref="GOA:A9YZW8"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR011524"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1928386"
FT                   /db_xref="UniProtKB/TrEMBL:A9YZW8"
FT                   /protein_id="EDL21198.1"
FT                   /translation="MSAEPELIELRELAPSGRIGPGRTRLERANALRIAPGTTRNPSQQ
FT                   HVPGRGHRFQPAGPTTHTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGP
FT                   RDLGWDSALERDTNVDEAVERETPDLSQAETEQKIKDYNGQINSNLFMSLNKDGSYTGF
FT                   IKVQLKLVRPVSVPSSKKPPSLQDARRGTGRSTAVKRRTSFYLPKDAIKHLHVLSRTRA
FT                   REVIEALLRKFMVVDDPRKFALFERTERHGQVYLRKLSDDEQPLKLRLLAGPSEKALSF
FT                   VLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSRCRQKIQEALHACPLG
FT                   "
FT   mRNA            join(18327236..18327408,18329936..18330040,
FT                   18330253..18330550,18330666..18330781,18333859..18334727)
FT                   /gene="Rassf1"
FT                   /locus_tag="mCG_18873"
FT                   /product="Ras association (RalGDS/AF-6) domain family 1,
FT                   transcript variant mCT16200"
FT                   /note="gene_id=mCG18873.2 transcript_id=mCT16200.1 created
FT                   on 16-JUL-2002"
FT   CDS             join(18327262..18327408,18329936..18330040,
FT                   18330253..18330550,18330666..18330781,18333859..18334005)
FT                   /codon_start=1
FT                   /gene="Rassf1"
FT                   /locus_tag="mCG_18873"
FT                   /product="Ras association (RalGDS/AF-6) domain family 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG18873.2 transcript_id=mCT16200.1
FT                   protein_id=mCP21311.2 isoform=CRA_a"
FT                   /protein_id="EDL21197.1"
FT                   /translation="MGEAETPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLVRRP
FT                   RRDQDEAVERETPDLSQAETEQKIKDYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPV
FT                   SVPSSKKPPSLQDARRGTGRSTAVKRRTSFYLPKDAIKHLHVLSRTRAREVIEALLRKF
FT                   MVVDDPRKFALFERTERHGQVYLRKLSDDEQPLKLRLLAGPSEKALSFVLKENDSGEVN
FT                   WDAFSMPELHNFLRILQREEEEHLRQILQKYSRCRQKIQEALHACPLG"
FT   gene            complement(18335317..>18340885)
FT                   /locus_tag="mCG_146219"
FT                   /note="gene_id=mCG146219.0"
FT   mRNA            complement(join(18335317..18336380,18338991..18339335,
FT                   18340793..>18340885))
FT                   /locus_tag="mCG_146219"
FT                   /product="mCG146219"
FT                   /note="gene_id=mCG146219.0 transcript_id=mCT186322.0
FT                   created on 14-JUL-2003"
FT   gene            18335317..18338578
FT                   /gene="Tusc2"
FT                   /locus_tag="mCG_18883"
FT                   /note="gene_id=mCG18883.2"
FT   mRNA            join(18335317..18335999,18337043..18337163,
FT                   18337314..18338578)
FT                   /gene="Tusc2"
FT                   /locus_tag="mCG_18883"
FT                   /product="tumor suppressor candidate 2"
FT                   /note="gene_id=mCG18883.2 transcript_id=mCT16210.2 created
FT                   on 16-JUL-2002"
FT   CDS             complement(18335614..>18336054)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146219"
FT                   /product="mCG146219"
FT                   /note="gene_id=mCG146219.0 transcript_id=mCT186322.0
FT                   protein_id=mCP107617.0"
FT                   /protein_id="EDL21199.1"
FT                   /translation="GGVSHSRMSSQRQIPMPLPAAREYEGRHCSGSRPHQRLLGACRLW
FT                   AAAPRSGGKGPEAPSFGAAGAHVSAAGAWRTQRPLRSHSAAGATMPCPSFHSQVPPPPP
FT                   SAGSAVSTETSLPLPRVLHGASSEWLKVSSVCGVEPMATLRG"
FT   CDS             join(18335854..18335999,18337043..18337163,
FT                   18337314..18337379)
FT                   /codon_start=1
FT                   /gene="Tusc2"
FT                   /locus_tag="mCG_18883"
FT                   /product="tumor suppressor candidate 2"
FT                   /note="gene_id=mCG18883.2 transcript_id=mCT16210.2
FT                   protein_id=mCP21381.1"
FT                   /db_xref="GOA:Q542N4"
FT                   /db_xref="InterPro:IPR029393"
FT                   /db_xref="MGI:MGI:1931086"
FT                   /db_xref="UniProtKB/TrEMBL:Q542N4"
FT                   /protein_id="EDL21200.1"
FT                   /translation="MGASGSKARGLWPFASTPGGGGPEAAGSEQSLVRSRARAVPPFVF
FT                   TRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDPPRIHVDFP
FT                   VILYEV"
FT   gene            18340425..18345243
FT                   /gene="Hyal2"
FT                   /locus_tag="mCG_18882"
FT                   /note="gene_id=mCG18882.1"
FT   mRNA            join(18340425..18340443,18342571..18343537,
FT                   18343959..18344048,18344525..18345243)
FT                   /gene="Hyal2"
FT                   /locus_tag="mCG_18882"
FT                   /product="hyaluronoglucosaminidase 2, transcript variant
FT                   mCT170785"
FT                   /note="gene_id=mCG18882.1 transcript_id=mCT170785.0 created
FT                   on 16-JUL-2002"
FT   mRNA            join(18341593..18341700,18342571..18343537,
FT                   18343959..18344048,18344525..18345243)
FT                   /gene="Hyal2"
FT                   /locus_tag="mCG_18882"
FT                   /product="hyaluronoglucosaminidase 2, transcript variant
FT                   mCT16209"
FT                   /note="gene_id=mCG18882.1 transcript_id=mCT16209.1 created
FT                   on 16-JUL-2002"
FT   CDS             join(18342617..18343537,18343959..18344048,
FT                   18344525..18344935)
FT                   /codon_start=1
FT                   /gene="Hyal2"
FT                   /locus_tag="mCG_18882"
FT                   /product="hyaluronoglucosaminidase 2, isoform CRA_a"
FT                   /note="gene_id=mCG18882.1 transcript_id=mCT16209.1
FT                   protein_id=mCP21373.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UZE4"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018155"
FT                   /db_xref="MGI:MGI:1196334"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UZE4"
FT                   /protein_id="EDL21201.1"
FT                   /translation="MRAGLGPIITLALVLEVAWAGELKPTAPPIFTGRPFVVAWNVPTQ
FT                   ECAPRHKVPLDLRAFDVKATPNEGFFNQNITTFYYDRLGLYPRFDAAGTSVHGGVPQNG
FT                   SLCAHLPMLKESVERYIQTQEPGGLAVIDWEEWRPVWVRNWQEKDVYRQSSRQLVASRH
FT                   PDWPSDRVMKQAQYEFEFAARQFMLNTLRYVKAVRPQHLWGFYLFPDCYNHDYVQNWES
FT                   YTGRCPDVEVARNDQLAWLWAESTALFPSVYLDETLASSVHSRNFVSFRVREALRVAHT
FT                   HHANHALPVYVFTRPTYTRGLTGLSQVDLISTIGESAALGSAGVIFWGDSEDASSMETC
FT                   QYLKNYLTQLLVPYIVNVSWATQYCSWTQCHGHGRCVRRNPSANTFLHLNASSFRLVPG
FT                   HTPSEPQLRPEGQLSEADLNYLQKHFRCQCYLGWGGEQCQRNYKGAAGNASRAWAGSHL
FT                   TSLLGLVAVALTWTL"
FT   CDS             join(18342617..18343537,18343959..18344048,
FT                   18344525..18344935)
FT                   /codon_start=1
FT                   /gene="Hyal2"
FT                   /locus_tag="mCG_18882"
FT                   /product="hyaluronoglucosaminidase 2, isoform CRA_a"
FT                   /note="gene_id=mCG18882.1 transcript_id=mCT170785.0
FT                   protein_id=mCP93703.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UZE4"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018155"
FT                   /db_xref="MGI:MGI:1196334"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UZE4"
FT                   /protein_id="EDL21202.1"
FT                   /translation="MRAGLGPIITLALVLEVAWAGELKPTAPPIFTGRPFVVAWNVPTQ
FT                   ECAPRHKVPLDLRAFDVKATPNEGFFNQNITTFYYDRLGLYPRFDAAGTSVHGGVPQNG
FT                   SLCAHLPMLKESVERYIQTQEPGGLAVIDWEEWRPVWVRNWQEKDVYRQSSRQLVASRH
FT                   PDWPSDRVMKQAQYEFEFAARQFMLNTLRYVKAVRPQHLWGFYLFPDCYNHDYVQNWES
FT                   YTGRCPDVEVARNDQLAWLWAESTALFPSVYLDETLASSVHSRNFVSFRVREALRVAHT
FT                   HHANHALPVYVFTRPTYTRGLTGLSQVDLISTIGESAALGSAGVIFWGDSEDASSMETC
FT                   QYLKNYLTQLLVPYIVNVSWATQYCSWTQCHGHGRCVRRNPSANTFLHLNASSFRLVPG
FT                   HTPSEPQLRPEGQLSEADLNYLQKHFRCQCYLGWGGEQCQRNYKGAAGNASRAWAGSHL
FT                   TSLLGLVAVALTWTL"
FT   gene            18349464..18352582
FT                   /gene="Hyal1"
FT                   /locus_tag="mCG_18878"
FT                   /note="gene_id=mCG18878.1"
FT   mRNA            join(18349464..18349569,18350044..18350967,
FT                   18351368..18351457,18351587..18352582)
FT                   /gene="Hyal1"
FT                   /locus_tag="mCG_18878"
FT                   /product="hyaluronoglucosaminidase 1"
FT                   /note="gene_id=mCG18878.1 transcript_id=mCT16205.1 created
FT                   on 16-JUL-2002"
FT   CDS             join(18349510..18349569,18350044..18350967,
FT                   18351368..18351457,18351587..18351901)
FT                   /codon_start=1
FT                   /gene="Hyal1"
FT                   /locus_tag="mCG_18878"
FT                   /product="hyaluronoglucosaminidase 1"
FT                   /note="gene_id=mCG18878.1 transcript_id=mCT16205.1
FT                   protein_id=mCP21371.2"
FT                   /protein_id="EDL21203.1"
FT                   /translation="MLGLTQHAQKVWRMKSFSPEVSPGSSPATAGHLLRISTLFLTLLE
FT                   LAQVCRGSVVSNRPFITVWNGDTHWCLTEYGVDVDVSVFDVVANKEQSFQGSNMTIFYR
FT                   EELGTYPYYTPTGEPVFGGLPQNASLVTHLAHTFQDIKAAMPEPDFSGLAVIDWEAWRP
FT                   RWAFNWDSKDIYRQRSMELVQAEHPDWPETLVEAAAKNQFQEAAEAWMAGTLQLGQVLR
FT                   PRGLWGYYGFPDCYNNDFLSLNYTGQCPVFVRDQNDQLGWLWNQSYALYPSIYLPAALM
FT                   GTGKSQMYVRHRVQEALRVAIVSRDPHVPVMPYVQIFYEMTDYLLPLEELEHSLGESAA
FT                   QGVAGAVLWLSSDKTSTKESCQAIKAYMDSTLGPFIVNVTSAALLCSEALCSGHGRCVR
FT                   HPSYPEALLTLNPASFSIELTHDGRPPSLKGTLSLKDRAQMAMKFRCRCYRGWRGKWCD
FT                   KRGM"
FT   gene            18353299..18356544
FT                   /gene="Nat6"
FT                   /locus_tag="mCG_18876"
FT                   /note="gene_id=mCG18876.1"
FT   mRNA            join(18353299..18353425,18355314..18356544)
FT                   /gene="Nat6"
FT                   /locus_tag="mCG_18876"
FT                   /product="N-acetyltransferase 6"
FT                   /note="gene_id=mCG18876.1 transcript_id=mCT16203.1 created
FT                   on 16-JUL-2002"
FT   gene            18353797..18359851
FT                   /gene="Hyal3"
FT                   /locus_tag="mCG_140692"
FT                   /note="gene_id=mCG140692.0"
FT   mRNA            join(18353797..18353826,18357249..18358162,
FT                   18358879..18358968,18359072..18359851)
FT                   /gene="Hyal3"
FT                   /locus_tag="mCG_140692"
FT                   /product="hyaluronoglucosaminidase 3"
FT                   /note="gene_id=mCG140692.0 transcript_id=mCT170780.0
FT                   created on 17-JUL-2002"
FT   CDS             18355405..18356349
FT                   /codon_start=1
FT                   /gene="Nat6"
FT                   /locus_tag="mCG_18876"
FT                   /product="N-acetyltransferase 6"
FT                   /note="gene_id=mCG18876.1 transcript_id=mCT16203.1
FT                   protein_id=mCP21360.1"
FT                   /db_xref="GOA:Q3UVC9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="MGI:MGI:1888902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UVC9"
FT                   /protein_id="EDL21204.1"
FT                   /translation="MELILSTSPAKLTLDPARQPELTLRFNLSKLTLDPARQPELSLSP
FT                   RLAELTLDPTCHPEMSLSPGPAELTLDPQHQAKELPVPKLPELILEPVHCRPELMSACA
FT                   DLINDQWPRSRASRLHSLGQSSDAFPLCLMLLSPQPTPGAAPVVVGHARLSRVLDQPHS
FT                   LLVETVVVARPLRGRGFGRRLMEGLEAFARARGFRRLHLTTHDQLYFYAHLGYQLGEPV
FT                   QGLAFTNRRLSTTVLRAFSKPPCPQPPCKEPILAAQAVPRSSKGPPLPPPPPLPQSLTA
FT                   SPPPSPEPLPQSPLETCYRDLKGCPIFWMEKDI"
FT   CDS             join(18357266..18358162,18358879..18358968,
FT                   18359072..18359323)
FT                   /codon_start=1
FT                   /gene="Hyal3"
FT                   /locus_tag="mCG_140692"
FT                   /product="hyaluronoglucosaminidase 3"
FT                   /note="gene_id=mCG140692.0 transcript_id=mCT170780.0
FT                   protein_id=mCP93698.0"
FT                   /protein_id="EDL21205.1"
FT                   /translation="MIMHLGLMMVVGLTLCLMHGQALLQVPEHPFSVVWNVPSARCKAH
FT                   FGVHLPLDALGIVANHGQHFHGQNISIFYKNQFGLYPYFGPRGTAHNGGIPQAVSLDHH
FT                   LARAAHQILHSLGSSFAGLAVLDWEEWYPLWAGNWGPHRQVYLAASWVWTQQMFPGLDP
FT                   QEQLHKAHTSFEQAARALMEYTLQLGRTLRPSGLWGFYRYPACGNGWHKMASNYTGHCH
FT                   AAITTRNTQLRWLWAASSALFPSIYLPPRLPLAYRQAFVRHRLEEAFRVALLEHSHPLP
FT                   VLAYSRLTHRSSGRFLSLDDLMQTIGVSAALGTAGVVLWGDLSFSSSEEKCWRLHDYLV
FT                   GTLGPYVINVTKAAMACSHQRCHGHGRCARKDPGQMEAFLHLQPDDSLGAWNSFRCRCY
FT                   SGWAGPTCLEPKP"
FT   gene            18360209..18365537
FT                   /gene="Ifrd2"
FT                   /locus_tag="mCG_18874"
FT                   /note="gene_id=mCG18874.1"
FT   mRNA            join(18360209..18360438,18362395..18362514,
FT                   18362601..18362685,18362790..18362914,18362997..18363154,
FT                   18363288..18363338,18363424..18363602,18363694..18363799,
FT                   18364060..18364197,18364574..18364702,18364775..18364870,
FT                   18364974..18365537)
FT                   /gene="Ifrd2"
FT                   /locus_tag="mCG_18874"
FT                   /product="interferon-related developmental regulator 2"
FT                   /note="gene_id=mCG18874.1 transcript_id=mCT16201.1 created
FT                   on 17-JUL-2002"
FT   CDS             join(18360381..18360438,18362395..18362514,
FT                   18362601..18362685,18362790..18362914,18362997..18363154,
FT                   18363288..18363338,18363424..18363602,18363694..18363799,
FT                   18364060..18364197,18364574..18364702,18364775..18364870,
FT                   18364974..18365054)
FT                   /codon_start=1
FT                   /gene="Ifrd2"
FT                   /locus_tag="mCG_18874"
FT                   /product="interferon-related developmental regulator 2"
FT                   /note="gene_id=mCG18874.1 transcript_id=mCT16201.1
FT                   protein_id=mCP21340.2"
FT                   /db_xref="GOA:Q9D8U0"
FT                   /db_xref="InterPro:IPR006921"
FT                   /db_xref="InterPro:IPR007701"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:1316708"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D8U0"
FT                   /protein_id="EDL21206.1"
FT                   /translation="MPRARKGNALRKGGQRRGGGARSSTQADSGSSEDEAASEARSTTS
FT                   DCPSLLSATTEDCLGGEAVDEQSQQENLEEKLKGYVDCLTDKSAKTRQGALESLRLALA
FT                   SRLLPDFLLERSLTLADALEKCLKKGKGEEQALAAAVLGILCVQLGPGPKGEELFRSLQ
FT                   PLLISVLSDSTASPTARLHCASALGLGCYVAATDVQDLVSCLACLEGVFSWSCGTSGSA
FT                   ASLVPASLHGLLCAALQAWALLLTICPGTHISHILDRQLPRLPQLLSSESVNLRIAAGE
FT                   AIALLFELARDLEEDFVYEDMEALCGSLRTLATDSNKYRAKVDRRRQRSIFRAVLHFVE
FT                   GGECEEETVRFGLEVLYIDSWARHRIYTAFKDVLGSGIHYHLQNNELLRDIFGLGPVLV
FT                   LDAAALKACKISRFEKHLYNAAAFKARTKARSRARDKRADIL"
FT   gene            complement(18370174..18381731)
FT                   /gene="Sema3b"
FT                   /locus_tag="mCG_18861"
FT                   /note="gene_id=mCG18861.2"
FT   mRNA            complement(join(18370174..18371675,18372078..18372217,
FT                   18372304..18372359,18372451..18372608,18372831..18372872,
FT                   18372955..18373046,18373329..18373548,18373859..18374003,
FT                   18374085..18374154,18374261..18374372,18374461..18374606,
FT                   18375375..18375494,18375626..18375719,18375801..18375920,
FT                   18376311..18376373,18376547..18376704,18377473..18377659,
FT                   18377951..18378091,18381623..18381731))
FT                   /gene="Sema3b"
FT                   /locus_tag="mCG_18861"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3B, transcript variant
FT                   mCT170775"
FT                   /note="gene_id=mCG18861.2 transcript_id=mCT170775.0 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(18370174..18371675,18372078..18372217,
FT                   18372304..18372359,18372451..18372608,18372831..18372872,
FT                   18372955..18373046,18373329..18373548,18373859..18374003,
FT                   18374085..18374154,18374261..18374372,18374461..18374606,
FT                   18375375..18375494,18375626..18375719,18375801..18375920,
FT                   18376311..18376373,18376547..18376704,18377473..18377659,
FT                   18377951..18378091,18379538..18379596,18381623..18381731))
FT                   /gene="Sema3b"
FT                   /locus_tag="mCG_18861"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3B, transcript variant
FT                   mCT170776"
FT                   /note="gene_id=mCG18861.2 transcript_id=mCT170776.0 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(18370174..18371675,18372078..18372217,
FT                   18372304..18372359,18372451..18372608,18372831..18372872,
FT                   18372955..18373046,18373329..18373548,18373859..18374003,
FT                   18374085..18374154,18374261..18374372,18374461..18374606,
FT                   18375375..18375494,18375626..18375719,18375801..18375920,
FT                   18376311..18376373,18376547..18376704,18377473..18377659,
FT                   18379258..18379438,18379538..18379600,18381623..18381731))
FT                   /gene="Sema3b"
FT                   /locus_tag="mCG_18861"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3B, transcript variant
FT                   mCT170773"
FT                   /note="gene_id=mCG18861.2 transcript_id=mCT170773.0 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(18370174..18371675,18372078..18372217,
FT                   18372304..18372359,18372451..18372608,18372831..18372872,
FT                   18372955..18373046,18373329..18373548,18373859..18374003,
FT                   18374085..18374154,18374261..18374372,18374461..18374606,
FT                   18375375..18375494,18375626..18375719,18375840..18375920,
FT                   18376311..18376373,18376547..18376704,18377473..18377659,
FT                   18379054..18379187))
FT                   /gene="Sema3b"
FT                   /locus_tag="mCG_18861"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3B, transcript variant
FT                   mCT170772"
FT                   /note="gene_id=mCG18861.2 transcript_id=mCT170772.0 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(18370174..18371675,18372078..18372217,
FT                   18372304..18372359,18372451..18372608,18372831..18372872,
FT                   18372955..18373046,18373329..18373548,18373859..18374003,
FT                   18374085..18374154,18374261..18374372,18374461..18374606,
FT                   18375375..18375494,18375626..18375719,18375801..18375920,
FT                   18376311..18376373,18376547..18376704,18377473..18377659,
FT                   18377951..18378091,18379054..18379187))
FT                   /gene="Sema3b"
FT                   /locus_tag="mCG_18861"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3B, transcript variant
FT                   mCT170774"
FT                   /note="gene_id=mCG18861.2 transcript_id=mCT170774.0 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(18370174..18371675,18372078..18372217,
FT                   18372304..18372359,18372451..18372608,18372831..18372872,
FT                   18372955..18373046,18373329..18373548,18373859..18374003,
FT                   18374085..18374154,18374261..18374372,18374461..18374606,
FT                   18375375..18375494,18375626..18375719,18375801..18375920,
FT                   18376311..18376373,18376547..18376704,18377473..18377659,
FT                   18377776..18377906))
FT                   /gene="Sema3b"
FT                   /locus_tag="mCG_18861"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3B, transcript variant
FT                   mCT16189"
FT                   /note="gene_id=mCG18861.2 transcript_id=mCT16189.2 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(18371271..18371675,18372078..18372217,
FT                   18372304..18372359,18372451..18372608,18372831..18372872,
FT                   18372955..18373046,18373329..18373548,18373859..18374003,
FT                   18374085..18374154,18374261..18374372,18374461..18374606,
FT                   18375375..18375494,18375626..18375719,18375840..18375920,
FT                   18376311..18376373,18376547..18376704,18377473..18377581))
FT                   /codon_start=1
FT                   /gene="Sema3b"
FT                   /locus_tag="mCG_18861"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3B, isoform CRA_b"
FT                   /note="gene_id=mCG18861.2 transcript_id=mCT170772.0
FT                   protein_id=mCP93694.0 isoform=CRA_b"
FT                   /protein_id="EDL21210.1"
FT                   /translation="MGRAEAAAMIPGLALLWVAGLGDTAPNLPRLRLSFQELQARHGVR
FT                   TFRLERTCCYEALLVDEERGRLFVGAENHVASLSLDNISKRAKKLAWPAPVEWREECNW
FT                   AGKDIGTECMNFVKLLHAYNHTHLLACGTGAFHEPMLQLDRRKLEDGKGKTPYDPRHRA
FT                   ASVLVGEELYSGVTADLMGRDFTIFRSLGQNPSLRTEPHDSRWLNEPKFVKVFWIPESE
FT                   NPDDDKIYFFFRESAVEAAPAMGRMSVSRVGQICRNDLGGQRSLVNKWTTFLKARLVCS
FT                   VPGVEGDTHFDQLQDVFLLSSRDRQTPLLYAVFSTSSGVFQGSAVCVYSMNDVRRAFLG
FT                   PFAHKEGPTHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQFARNHPLMYNPV
FT                   LPMGGRPLFLQVGAGYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPNS
FT                   EGLLLEELQVFEDSAAITSMQISSKRQQLYIASRSAVAQIALHRCTALGRACAECCLAR
FT                   DPYCAWDGSACTRFQPTAKRRFRRQDIRNGDPSTLCSGDSSHSVLLEKKVLGVESGSAF
FT                   LECEPRSLQAHVQWTFQGAGEAAHTQVLAEERVERTARGLLLRGLRRQDSGVYLCVAVE
FT                   QGFSQPLRRLVLHVLSAAQAERLARAEEAAAPAPPGPKLWYRDFLQLVEPGGGGGANSL
FT                   RMCRPQPGHHSVAADSRRKGRNRRMHVSELRAERGPRSAAHW"
FT   CDS             complement(join(18371271..18371675,18372078..18372217,
FT                   18372304..18372359,18372451..18372608,18372831..18372872,
FT                   18372955..18373046,18373329..18373548,18373859..18374003,
FT                   18374085..18374154,18374261..18374372,18374461..18374606,
FT                   18375375..18375494,18375626..18375719,18375801..18375920,
FT                   18376311..18376373,18376547..18376704,18377473..18377581))
FT                   /codon_start=1
FT                   /gene="Sema3b"
FT                   /locus_tag="mCG_18861"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3B, isoform CRA_a"
FT                   /note="gene_id=mCG18861.2 transcript_id=mCT16189.2
FT                   protein_id=mCP21384.2 isoform=CRA_a"
FT                   /protein_id="EDL21207.1"
FT                   /translation="MGRAEAAAMIPGLALLWVAGLGDTAPNLPRLRLSFQELQARHGVR
FT                   TFRLERTCCYEALLVDEERGRLFVGAENHVASLSLDNISKRAKKLAWPAPVEWREECNW
FT                   AGKDIGTECMNFVKLLHAYNHTHLLACGTGAFHPTCAFVEVGHRLEEPMLQLDRRKLED
FT                   GKGKTPYDPRHRAASVLVGEELYSGVTADLMGRDFTIFRSLGQNPSLRTEPHDSRWLNE
FT                   PKFVKVFWIPESENPDDDKIYFFFRESAVEAAPAMGRMSVSRVGQICRNDLGGQRSLVN
FT                   KWTTFLKARLVCSVPGVEGDTHFDQLQDVFLLSSRDRQTPLLYAVFSTSSGVFQGSAVC
FT                   VYSMNDVRRAFLGPFAHKEGPTHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVI
FT                   QFARNHPLMYNPVLPMGGRPLFLQVGAGYTFTQIAADRVAAADGHYDVLFIGTDVGTVL
FT                   KVISVPKGSRPNSEGLLLEELQVFEDSAAITSMQISSKRQQLYIASRSAVAQIALHRCT
FT                   ALGRACAECCLARDPYCAWDGSACTRFQPTAKRRFRRQDIRNGDPSTLCSGDSSHSVLL
FT                   EKKVLGVESGSAFLECEPRSLQAHVQWTFQGAGEAAHTQVLAEERVERTARGLLLRGLR
FT                   RQDSGVYLCVAVEQGFSQPLRRLVLHVLSAAQAERLARAEEAAAPAPPGPKLWYRDFLQ
FT                   LVEPGGGGGANSLRMCRPQPGHHSVAADSRRKGRNRRMHVSELRAERGPRSAAHW"
FT   CDS             complement(join(18371271..18371675,18372078..18372217,
FT                   18372304..18372359,18372451..18372608,18372831..18372872,
FT                   18372955..18373046,18373329..18373548,18373859..18374003,
FT                   18374085..18374154,18374261..18374372,18374461..18374606,
FT                   18375375..18375494,18375626..18375719,18375801..18375920,
FT                   18376311..18376373,18376547..18376704,18377473..18377581))
FT                   /codon_start=1
FT                   /gene="Sema3b"
FT                   /locus_tag="mCG_18861"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3B, isoform CRA_a"
FT                   /note="gene_id=mCG18861.2 transcript_id=mCT170775.0
FT                   protein_id=mCP93691.0 isoform=CRA_a"
FT                   /protein_id="EDL21208.1"
FT                   /translation="MGRAEAAAMIPGLALLWVAGLGDTAPNLPRLRLSFQELQARHGVR
FT                   TFRLERTCCYEALLVDEERGRLFVGAENHVASLSLDNISKRAKKLAWPAPVEWREECNW
FT                   AGKDIGTECMNFVKLLHAYNHTHLLACGTGAFHPTCAFVEVGHRLEEPMLQLDRRKLED
FT                   GKGKTPYDPRHRAASVLVGEELYSGVTADLMGRDFTIFRSLGQNPSLRTEPHDSRWLNE
FT                   PKFVKVFWIPESENPDDDKIYFFFRESAVEAAPAMGRMSVSRVGQICRNDLGGQRSLVN
FT                   KWTTFLKARLVCSVPGVEGDTHFDQLQDVFLLSSRDRQTPLLYAVFSTSSGVFQGSAVC
FT                   VYSMNDVRRAFLGPFAHKEGPTHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVI
FT                   QFARNHPLMYNPVLPMGGRPLFLQVGAGYTFTQIAADRVAAADGHYDVLFIGTDVGTVL
FT                   KVISVPKGSRPNSEGLLLEELQVFEDSAAITSMQISSKRQQLYIASRSAVAQIALHRCT
FT                   ALGRACAECCLARDPYCAWDGSACTRFQPTAKRRFRRQDIRNGDPSTLCSGDSSHSVLL
FT                   EKKVLGVESGSAFLECEPRSLQAHVQWTFQGAGEAAHTQVLAEERVERTARGLLLRGLR
FT                   RQDSGVYLCVAVEQGFSQPLRRLVLHVLSAAQAERLARAEEAAAPAPPGPKLWYRDFLQ
FT                   LVEPGGGGGANSLRMCRPQPGHHSVAADSRRKGRNRRMHVSELRAERGPRSAAHW"
FT   CDS             complement(join(18371271..18371675,18372078..18372217,
FT                   18372304..18372359,18372451..18372608,18372831..18372872,
FT                   18372955..18373046,18373329..18373548,18373859..18374003,
FT                   18374085..18374154,18374261..18374372,18374461..18374606,
FT                   18375375..18375494,18375626..18375719,18375801..18375920,
FT                   18376311..18376373,18376547..18376704,18377473..18377581))
FT                   /codon_start=1
FT                   /gene="Sema3b"
FT                   /locus_tag="mCG_18861"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3B, isoform CRA_a"
FT                   /note="gene_id=mCG18861.2 transcript_id=mCT170776.0
FT                   protein_id=mCP93690.0 isoform=CRA_a"
FT                   /protein_id="EDL21209.1"
FT                   /translation="MGRAEAAAMIPGLALLWVAGLGDTAPNLPRLRLSFQELQARHGVR
FT                   TFRLERTCCYEALLVDEERGRLFVGAENHVASLSLDNISKRAKKLAWPAPVEWREECNW
FT                   AGKDIGTECMNFVKLLHAYNHTHLLACGTGAFHPTCAFVEVGHRLEEPMLQLDRRKLED
FT                   GKGKTPYDPRHRAASVLVGEELYSGVTADLMGRDFTIFRSLGQNPSLRTEPHDSRWLNE
FT                   PKFVKVFWIPESENPDDDKIYFFFRESAVEAAPAMGRMSVSRVGQICRNDLGGQRSLVN
FT                   KWTTFLKARLVCSVPGVEGDTHFDQLQDVFLLSSRDRQTPLLYAVFSTSSGVFQGSAVC
FT                   VYSMNDVRRAFLGPFAHKEGPTHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVI
FT                   QFARNHPLMYNPVLPMGGRPLFLQVGAGYTFTQIAADRVAAADGHYDVLFIGTDVGTVL
FT                   KVISVPKGSRPNSEGLLLEELQVFEDSAAITSMQISSKRQQLYIASRSAVAQIALHRCT
FT                   ALGRACAECCLARDPYCAWDGSACTRFQPTAKRRFRRQDIRNGDPSTLCSGDSSHSVLL
FT                   EKKVLGVESGSAFLECEPRSLQAHVQWTFQGAGEAAHTQVLAEERVERTARGLLLRGLR
FT                   RQDSGVYLCVAVEQGFSQPLRRLVLHVLSAAQAERLARAEEAAAPAPPGPKLWYRDFLQ
FT                   LVEPGGGGGANSLRMCRPQPGHHSVAADSRRKGRNRRMHVSELRAERGPRSAAHW"
FT   CDS             complement(join(18371271..18371675,18372078..18372217,
FT                   18372304..18372359,18372451..18372608,18372831..18372872,
FT                   18372955..18373046,18373329..18373548,18373859..18374003,
FT                   18374085..18374154,18374261..18374372,18374461..18374606,
FT                   18375375..18375494,18375626..18375719,18375801..18375920,
FT                   18376311..18376373,18376547..18376704,18377473..18377581))
FT                   /codon_start=1
FT                   /gene="Sema3b"
FT                   /locus_tag="mCG_18861"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3B, isoform CRA_a"
FT                   /note="gene_id=mCG18861.2 transcript_id=mCT170774.0
FT                   protein_id=mCP93693.0 isoform=CRA_a"
FT                   /protein_id="EDL21211.1"
FT                   /translation="MGRAEAAAMIPGLALLWVAGLGDTAPNLPRLRLSFQELQARHGVR
FT                   TFRLERTCCYEALLVDEERGRLFVGAENHVASLSLDNISKRAKKLAWPAPVEWREECNW
FT                   AGKDIGTECMNFVKLLHAYNHTHLLACGTGAFHPTCAFVEVGHRLEEPMLQLDRRKLED
FT                   GKGKTPYDPRHRAASVLVGEELYSGVTADLMGRDFTIFRSLGQNPSLRTEPHDSRWLNE
FT                   PKFVKVFWIPESENPDDDKIYFFFRESAVEAAPAMGRMSVSRVGQICRNDLGGQRSLVN
FT                   KWTTFLKARLVCSVPGVEGDTHFDQLQDVFLLSSRDRQTPLLYAVFSTSSGVFQGSAVC
FT                   VYSMNDVRRAFLGPFAHKEGPTHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVI
FT                   QFARNHPLMYNPVLPMGGRPLFLQVGAGYTFTQIAADRVAAADGHYDVLFIGTDVGTVL
FT                   KVISVPKGSRPNSEGLLLEELQVFEDSAAITSMQISSKRQQLYIASRSAVAQIALHRCT
FT                   ALGRACAECCLARDPYCAWDGSACTRFQPTAKRRFRRQDIRNGDPSTLCSGDSSHSVLL
FT                   EKKVLGVESGSAFLECEPRSLQAHVQWTFQGAGEAAHTQVLAEERVERTARGLLLRGLR
FT                   RQDSGVYLCVAVEQGFSQPLRRLVLHVLSAAQAERLARAEEAAAPAPPGPKLWYRDFLQ
FT                   LVEPGGGGGANSLRMCRPQPGHHSVAADSRRKGRNRRMHVSELRAERGPRSAAHW"
FT   CDS             complement(join(18371271..18371675,18372078..18372217,
FT                   18372304..18372359,18372451..18372608,18372831..18372872,
FT                   18372955..18373046,18373329..18373548,18373859..18374003,
FT                   18374085..18374154,18374261..18374372,18374461..18374606,
FT                   18375375..18375494,18375626..18375719,18375801..18375920,
FT                   18376311..18376373,18376547..18376704,18377473..18377581))
FT                   /codon_start=1
FT                   /gene="Sema3b"
FT                   /locus_tag="mCG_18861"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3B, isoform CRA_a"
FT                   /note="gene_id=mCG18861.2 transcript_id=mCT170773.0
FT                   protein_id=mCP93692.0 isoform=CRA_a"
FT                   /protein_id="EDL21212.1"
FT                   /translation="MGRAEAAAMIPGLALLWVAGLGDTAPNLPRLRLSFQELQARHGVR
FT                   TFRLERTCCYEALLVDEERGRLFVGAENHVASLSLDNISKRAKKLAWPAPVEWREECNW
FT                   AGKDIGTECMNFVKLLHAYNHTHLLACGTGAFHPTCAFVEVGHRLEEPMLQLDRRKLED
FT                   GKGKTPYDPRHRAASVLVGEELYSGVTADLMGRDFTIFRSLGQNPSLRTEPHDSRWLNE
FT                   PKFVKVFWIPESENPDDDKIYFFFRESAVEAAPAMGRMSVSRVGQICRNDLGGQRSLVN
FT                   KWTTFLKARLVCSVPGVEGDTHFDQLQDVFLLSSRDRQTPLLYAVFSTSSGVFQGSAVC
FT                   VYSMNDVRRAFLGPFAHKEGPTHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVI
FT                   QFARNHPLMYNPVLPMGGRPLFLQVGAGYTFTQIAADRVAAADGHYDVLFIGTDVGTVL
FT                   KVISVPKGSRPNSEGLLLEELQVFEDSAAITSMQISSKRQQLYIASRSAVAQIALHRCT
FT                   ALGRACAECCLARDPYCAWDGSACTRFQPTAKRRFRRQDIRNGDPSTLCSGDSSHSVLL
FT                   EKKVLGVESGSAFLECEPRSLQAHVQWTFQGAGEAAHTQVLAEERVERTARGLLLRGLR
FT                   RQDSGVYLCVAVEQGFSQPLRRLVLHVLSAAQAERLARAEEAAAPAPPGPKLWYRDFLQ
FT                   LVEPGGGGGANSLRMCRPQPGHHSVAADSRRKGRNRRMHVSELRAERGPRSAAHW"
FT   gene            complement(18386633..18404655)
FT                   /locus_tag="mCG_133140"
FT                   /note="gene_id=mCG133140.1"
FT   mRNA            complement(join(18386633..18387600,18388114..18388327,
FT                   18388657..18388810,18388916..18389045,18389413..18389541,
FT                   18404412..18404655))
FT                   /locus_tag="mCG_133140"
FT                   /product="mCG133140, transcript variant mCT170740"
FT                   /note="gene_id=mCG133140.1 transcript_id=mCT170740.0
FT                   created on 17-JUL-2002"
FT   mRNA            complement(join(18386639..18387217,18388110..18388327,
FT                   18388657..18388810,18388916..18389045,18389413..18389541,
FT                   18404412..18404655))
FT                   /locus_tag="mCG_133140"
FT                   /product="mCG133140, transcript variant mCT134504"
FT                   /note="gene_id=mCG133140.1 transcript_id=mCT134504.1
FT                   created on 17-JUL-2002"
FT   CDS             complement(join(18389534..18389541,18404412..18404532))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133140"
FT                   /product="mCG133140, isoform CRA_a"
FT                   /note="gene_id=mCG133140.1 transcript_id=mCT170740.0
FT                   protein_id=mCP93658.0 isoform=CRA_a"
FT                   /protein_id="EDL21213.1"
FT                   /translation="MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAT"
FT   CDS             complement(join(18389534..18389541,18404412..18404532))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133140"
FT                   /product="mCG133140, isoform CRA_a"
FT                   /note="gene_id=mCG133140.1 transcript_id=mCT134504.1
FT                   protein_id=mCP68646.1 isoform=CRA_a"
FT                   /protein_id="EDL21214.1"
FT                   /translation="MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAT"
FT   gene            complement(18420336..18438631)
FT                   /gene="Slc38a3"
FT                   /locus_tag="mCG_18879"
FT                   /note="gene_id=mCG18879.2"
FT   mRNA            complement(join(18420336..18421218,18421309..18421412,
FT                   18424215..18424359,18424448..18424572,18424777..18424877,
FT                   18425119..18425198,18425284..18425454,18425640..18425698,
FT                   18425779..18425861,18426814..18426895,18426994..18427086,
FT                   18427178..18427251,18427821..18427936,18428116..18428194,
FT                   18428279..18428428,18438481..18438631))
FT                   /gene="Slc38a3"
FT                   /locus_tag="mCG_18879"
FT                   /product="solute carrier family 38, member 3, transcript
FT                   variant mCT170781"
FT                   /note="gene_id=mCG18879.2 transcript_id=mCT170781.0 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(18420336..18421218,18421309..18421412,
FT                   18424215..18424359,18424448..18424572,18424777..18424877,
FT                   18425119..18425198,18425284..18425454,18425640..18425698,
FT                   18425779..18425861,18426814..18426895,18426994..18427086,
FT                   18427178..18427251,18427821..18427936,18428116..18428194,
FT                   18428279..18428428,18436767..18437001))
FT                   /gene="Slc38a3"
FT                   /locus_tag="mCG_18879"
FT                   /product="solute carrier family 38, member 3, transcript
FT                   variant mCT170783"
FT                   /note="gene_id=mCG18879.2 transcript_id=mCT170783.0 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(18420336..18421218,18421309..18421412,
FT                   18424215..18424359,18424448..18424572,18424777..18424877,
FT                   18425119..18425198,18425284..18425454,18425640..18425698,
FT                   18425779..18425861,18426814..18426895,18426994..18427086,
FT                   18427178..18427251,18427821..18427936,18428116..18428194,
FT                   18428279..18428428,18436935..18437000))
FT                   /gene="Slc38a3"
FT                   /locus_tag="mCG_18879"
FT                   /product="solute carrier family 38, member 3, transcript
FT                   variant mCT16206"
FT                   /note="gene_id=mCG18879.2 transcript_id=mCT16206.1 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(18420336..18421218,18421309..18421412,
FT                   18424215..18424359,18424448..18424572,18424777..18424877,
FT                   18425119..18425198,18425284..18425454,18425640..18425698,
FT                   18425779..18425861,18426814..18426895,18426994..18427086,
FT                   18427178..18427251,18427821..18427936,18428116..18428194,
FT                   18428279..18428428,18434759..18435052))
FT                   /gene="Slc38a3"
FT                   /locus_tag="mCG_18879"
FT                   /product="solute carrier family 38, member 3, transcript
FT                   variant mCT170784"
FT                   /note="gene_id=mCG18879.2 transcript_id=mCT170784.0 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(18420336..18421218,18421309..18421412,
FT                   18424215..18424359,18424448..18424572,18424777..18424877,
FT                   18425119..18425198,18425284..18425454,18425640..18425698,
FT                   18425779..18425861,18426814..18426895,18426994..18427086,
FT                   18427178..18427251,18427821..18427936,18428116..18428194,
FT                   18428279..18428713))
FT                   /gene="Slc38a3"
FT                   /locus_tag="mCG_18879"
FT                   /product="solute carrier family 38, member 3, transcript
FT                   variant mCT170782"
FT                   /note="gene_id=mCG18879.2 transcript_id=mCT170782.0 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(18421114..18421218,18421309..18421412,
FT                   18424215..18424359,18424448..18424572,18424777..18424877,
FT                   18425119..18425198,18425284..18425454,18425640..18425698,
FT                   18425779..18425861,18426814..18426895,18426994..18427086,
FT                   18427178..18427251,18427821..18427936,18428116..18428194,
FT                   18428279..18428379))
FT                   /codon_start=1
FT                   /gene="Slc38a3"
FT                   /locus_tag="mCG_18879"
FT                   /product="solute carrier family 38, member 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18879.2 transcript_id=mCT16206.1
FT                   protein_id=mCP21328.1 isoform=CRA_a"
FT                   /protein_id="EDL21215.1"
FT                   /translation="MEIPRQTEMVELVPNGKHLEGLLPVGVPTTDTQRTEDTQHCGEGK
FT                   GFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIMGSGILGLAYAMANTGIILFLFLLTA
FT                   VALLSSYSIHLLLKSSGIVGIRAYEQLGYRAFGTPGKLAAALAITLQNIGAMSSYLYII
FT                   KSELPLVIQTFLNLEKPASVWYMDGNYLVILVSVTIILPLALMRQLGYLGYSSGFSLSC
FT                   MVFFLIAVIYKKFQVPCPLAHNLANATGNFSHMVVAEEKAQLQGEPDAAAEAFCTPSYF
FT                   TLNSQTAYTIPIMAFAFVCHPEVLPIYTELKDPSKRKMQHISNLSIAVMYVMYFLAALF
FT                   GYLTFYDGVESELLHTYSKVDPFDVLILCVRVAVLIAVTLTVPIVLFPVRRAIQQMLFQ
FT                   NQEFSWLRHVLIATGLLTCINLLVIFAPNILGIFGIIGATSAPCLIFIFPAIFYFRIMP
FT                   TDKEPARSTPKILALCFAAVGFLLMTMSLSFIIIDWVSGTSQHGGNH"
FT   CDS             complement(join(18421114..18421218,18421309..18421412,
FT                   18424215..18424359,18424448..18424572,18424777..18424877,
FT                   18425119..18425198,18425284..18425454,18425640..18425698,
FT                   18425779..18425861,18426814..18426895,18426994..18427086,
FT                   18427178..18427251,18427821..18427936,18428116..18428194,
FT                   18428279..18428379))
FT                   /codon_start=1
FT                   /gene="Slc38a3"
FT                   /locus_tag="mCG_18879"
FT                   /product="solute carrier family 38, member 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18879.2 transcript_id=mCT170781.0
FT                   protein_id=mCP93700.0 isoform=CRA_a"
FT                   /protein_id="EDL21216.1"
FT                   /translation="MEIPRQTEMVELVPNGKHLEGLLPVGVPTTDTQRTEDTQHCGEGK
FT                   GFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIMGSGILGLAYAMANTGIILFLFLLTA
FT                   VALLSSYSIHLLLKSSGIVGIRAYEQLGYRAFGTPGKLAAALAITLQNIGAMSSYLYII
FT                   KSELPLVIQTFLNLEKPASVWYMDGNYLVILVSVTIILPLALMRQLGYLGYSSGFSLSC
FT                   MVFFLIAVIYKKFQVPCPLAHNLANATGNFSHMVVAEEKAQLQGEPDAAAEAFCTPSYF
FT                   TLNSQTAYTIPIMAFAFVCHPEVLPIYTELKDPSKRKMQHISNLSIAVMYVMYFLAALF
FT                   GYLTFYDGVESELLHTYSKVDPFDVLILCVRVAVLIAVTLTVPIVLFPVRRAIQQMLFQ
FT                   NQEFSWLRHVLIATGLLTCINLLVIFAPNILGIFGIIGATSAPCLIFIFPAIFYFRIMP
FT                   TDKEPARSTPKILALCFAAVGFLLMTMSLSFIIIDWVSGTSQHGGNH"
FT   CDS             complement(join(18421114..18421218,18421309..18421412,
FT                   18424215..18424359,18424448..18424572,18424777..18424877,
FT                   18425119..18425198,18425284..18425454,18425640..18425698,
FT                   18425779..18425861,18426814..18426895,18426994..18427086,
FT                   18427178..18427251,18427821..18427936,18428116..18428194,
FT                   18428279..18428379))
FT                   /codon_start=1
FT                   /gene="Slc38a3"
FT                   /locus_tag="mCG_18879"
FT                   /product="solute carrier family 38, member 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18879.2 transcript_id=mCT170783.0
FT                   protein_id=mCP93699.0 isoform=CRA_a"
FT                   /protein_id="EDL21217.1"
FT                   /translation="MEIPRQTEMVELVPNGKHLEGLLPVGVPTTDTQRTEDTQHCGEGK
FT                   GFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIMGSGILGLAYAMANTGIILFLFLLTA
FT                   VALLSSYSIHLLLKSSGIVGIRAYEQLGYRAFGTPGKLAAALAITLQNIGAMSSYLYII
FT                   KSELPLVIQTFLNLEKPASVWYMDGNYLVILVSVTIILPLALMRQLGYLGYSSGFSLSC
FT                   MVFFLIAVIYKKFQVPCPLAHNLANATGNFSHMVVAEEKAQLQGEPDAAAEAFCTPSYF
FT                   TLNSQTAYTIPIMAFAFVCHPEVLPIYTELKDPSKRKMQHISNLSIAVMYVMYFLAALF
FT                   GYLTFYDGVESELLHTYSKVDPFDVLILCVRVAVLIAVTLTVPIVLFPVRRAIQQMLFQ
FT                   NQEFSWLRHVLIATGLLTCINLLVIFAPNILGIFGIIGATSAPCLIFIFPAIFYFRIMP
FT                   TDKEPARSTPKILALCFAAVGFLLMTMSLSFIIIDWVSGTSQHGGNH"
FT   CDS             complement(join(18421114..18421218,18421309..18421412,
FT                   18424215..18424359,18424448..18424572,18424777..18424877,
FT                   18425119..18425198,18425284..18425454,18425640..18425698,
FT                   18425779..18425861,18426814..18426895,18426994..18427086,
FT                   18427178..18427251,18427821..18427936,18428116..18428194,
FT                   18428279..18428379))
FT                   /codon_start=1
FT                   /gene="Slc38a3"
FT                   /locus_tag="mCG_18879"
FT                   /product="solute carrier family 38, member 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18879.2 transcript_id=mCT170782.0
FT                   protein_id=mCP93702.0 isoform=CRA_a"
FT                   /protein_id="EDL21218.1"
FT                   /translation="MEIPRQTEMVELVPNGKHLEGLLPVGVPTTDTQRTEDTQHCGEGK
FT                   GFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIMGSGILGLAYAMANTGIILFLFLLTA
FT                   VALLSSYSIHLLLKSSGIVGIRAYEQLGYRAFGTPGKLAAALAITLQNIGAMSSYLYII
FT                   KSELPLVIQTFLNLEKPASVWYMDGNYLVILVSVTIILPLALMRQLGYLGYSSGFSLSC
FT                   MVFFLIAVIYKKFQVPCPLAHNLANATGNFSHMVVAEEKAQLQGEPDAAAEAFCTPSYF
FT                   TLNSQTAYTIPIMAFAFVCHPEVLPIYTELKDPSKRKMQHISNLSIAVMYVMYFLAALF
FT                   GYLTFYDGVESELLHTYSKVDPFDVLILCVRVAVLIAVTLTVPIVLFPVRRAIQQMLFQ
FT                   NQEFSWLRHVLIATGLLTCINLLVIFAPNILGIFGIIGATSAPCLIFIFPAIFYFRIMP
FT                   TDKEPARSTPKILALCFAAVGFLLMTMSLSFIIIDWVSGTSQHGGNH"
FT   CDS             complement(join(18421114..18421218,18421309..18421412,
FT                   18424215..18424359,18424448..18424572,18424777..18424877,
FT                   18425119..18425198,18425284..18425454,18425640..18425698,
FT                   18425779..18425861,18426814..18426895,18426994..18427086,
FT                   18427178..18427251,18427821..18427936,18428116..18428194,
FT                   18428279..18428379))
FT                   /codon_start=1
FT                   /gene="Slc38a3"
FT                   /locus_tag="mCG_18879"
FT                   /product="solute carrier family 38, member 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18879.2 transcript_id=mCT170784.0
FT                   protein_id=mCP93701.0 isoform=CRA_a"
FT                   /protein_id="EDL21219.1"
FT                   /translation="MEIPRQTEMVELVPNGKHLEGLLPVGVPTTDTQRTEDTQHCGEGK
FT                   GFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIMGSGILGLAYAMANTGIILFLFLLTA
FT                   VALLSSYSIHLLLKSSGIVGIRAYEQLGYRAFGTPGKLAAALAITLQNIGAMSSYLYII
FT                   KSELPLVIQTFLNLEKPASVWYMDGNYLVILVSVTIILPLALMRQLGYLGYSSGFSLSC
FT                   MVFFLIAVIYKKFQVPCPLAHNLANATGNFSHMVVAEEKAQLQGEPDAAAEAFCTPSYF
FT                   TLNSQTAYTIPIMAFAFVCHPEVLPIYTELKDPSKRKMQHISNLSIAVMYVMYFLAALF
FT                   GYLTFYDGVESELLHTYSKVDPFDVLILCVRVAVLIAVTLTVPIVLFPVRRAIQQMLFQ
FT                   NQEFSWLRHVLIATGLLTCINLLVIFAPNILGIFGIIGATSAPCLIFIFPAIFYFRIMP
FT                   TDKEPARSTPKILALCFAAVGFLLMTMSLSFIIIDWVSGTSQHGGNH"
FT   gene            complement(18444047..18448982)
FT                   /gene="Gnat1"
FT                   /locus_tag="mCG_1032920"
FT                   /note="gene_id=mCG1032920.1"
FT   mRNA            complement(join(18444047..18445155,18445459..18445650,
FT                   18445768..18445921,18446115..18446244,18446462..18446590,
FT                   18446697..18446854,18446942..18447083,18447199..18447241,
FT                   18448805..18448982))
FT                   /gene="Gnat1"
FT                   /locus_tag="mCG_1032920"
FT                   /product="guanine nucleotide binding protein, alpha
FT                   transducing 1"
FT                   /note="gene_id=mCG1032920.1 transcript_id=mCT150624.1
FT                   created on 17-JUL-2002"
FT   CDS             complement(join(18445460..18445650,18445768..18445921,
FT                   18446115..18446244,18446462..18446590,18446697..18446854,
FT                   18446942..18447083,18447199..18447241,18448805..18448910))
FT                   /codon_start=1
FT                   /gene="Gnat1"
FT                   /locus_tag="mCG_1032920"
FT                   /product="guanine nucleotide binding protein, alpha
FT                   transducing 1"
FT                   /note="gene_id=mCG1032920.1 transcript_id=mCT150624.1
FT                   protein_id=mCP68733.1"
FT                   /protein_id="EDL21220.1"
FT                   /translation="MGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTI
FT                   VKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLM
FT                   HMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGY
FT                   VPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAA
FT                   LSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFATTSIVLFLNKKDVFSEKIKKAHLSI
FT                   CFPDYDGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIII
FT                   KENLKDCGLF"
FT   gene            complement(18450857..18479942)
FT                   /gene="Sema3f"
FT                   /locus_tag="mCG_18872"
FT                   /note="gene_id=mCG18872.2"
FT   mRNA            complement(join(18450857..18452197,18452916..18453049,
FT                   18453329..18453396,18453578..18453735,18453906..18453947,
FT                   18454044..18454132,18454802..18455024,18456665..18456809,
FT                   18456965..18457034,18457205..18457319,18457424..18457563,
FT                   18457705..18457824,18459163..18459256,18461639..18461758,
FT                   18461860..18461922,18462027..18462187,18474896..18475056,
FT                   18479790..18479942))
FT                   /gene="Sema3f"
FT                   /locus_tag="mCG_18872"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3 F, transcript
FT                   variant mCT170778"
FT                   /note="gene_id=mCG18872.2 transcript_id=mCT170778.0 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(18450857..18452197,18452916..18453049,
FT                   18453329..18453396,18453578..18453735,18453906..18453947,
FT                   18454044..18454132,18454802..18455024,18456665..18456809,
FT                   18456965..18457034,18457205..18457319,18457424..18457563,
FT                   18457705..18457824,18459163..18459256,18461639..18461758,
FT                   18461860..18461922,18462027..18462187,18474896..18475056,
FT                   18478883..18478944))
FT                   /gene="Sema3f"
FT                   /locus_tag="mCG_18872"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3 F, transcript
FT                   variant mCT16199"
FT                   /note="gene_id=mCG18872.2 transcript_id=mCT16199.2 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(18450857..18452197,18452916..18453049,
FT                   18453329..18453396,18453578..18453735,18453906..18453947,
FT                   18454044..18454132,18454802..18455024,18456665..18456809,
FT                   18456965..18457034,18457205..18457319,18457424..18457563,
FT                   18457705..18457824,18459163..18459256,18460827..18460919,
FT                   18461639..18461758,18461860..18461922,18462027..18462187,
FT                   18474896..18475056))
FT                   /gene="Sema3f"
FT                   /locus_tag="mCG_18872"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3 F, transcript
FT                   variant mCT170777"
FT                   /note="gene_id=mCG18872.2 transcript_id=mCT170777.0 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(18451787..18452197,18452916..18453049,
FT                   18453329..18453396,18453578..18453735,18453906..18453947,
FT                   18454044..18454132,18454802..18455024,18456665..18456809,
FT                   18456965..18457034,18457205..18457319,18457424..18457563,
FT                   18457705..18457824,18459163..18459256,18461639..18461758,
FT                   18461860..18461922,18462027..18462187,18474896..18475007))
FT                   /codon_start=1
FT                   /gene="Sema3f"
FT                   /locus_tag="mCG_18872"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3 F, isoform CRA_a"
FT                   /note="gene_id=mCG18872.2 transcript_id=mCT16199.2
FT                   protein_id=mCP21327.1 isoform=CRA_a"
FT                   /protein_id="EDL21221.1"
FT                   /translation="MLVTAFILWASLLTGAWPATPIQDQLPATPRVRLSFKELKATGTA
FT                   HFFNFLLNTTDYRILLKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEEC
FT                   ILSGKDGNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQDYIFYLEPEKL
FT                   ESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQTAMRTDQYNSRWL
FT                   NDPSFIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGHCCLVN
FT                   KWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDIRNPVIYAVFTSSGSVFRGSAV
FT                   CVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPSMKSTKDYPDE
FT                   VINFMRTHPLMYQAVYPLQRRPLVVRTGAPYRLTTVAVDQVDAADGRYEVLFLGTDRGT
FT                   VQKVIVLPKDDQEVEELMLEEVEVFKEPAPVKTMTISSKRQQLYVASAVGVTHLSLHRC
FT                   QAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDVRHGNPIRQCRGFNSNANK
FT                   NAVESVQYGVAGSAAFLECQPRSPQATVKWLFQRDPSDRRREIRAEDRFLRTEQGLLLR
FT                   ALQLGDRGLYSCTATENNFKHIVTRVQLHVLGRDAVHAALFPPLAVSVPPPPGTGPPTP
FT                   PYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGALRPPELQDQKKPRNRRHHPPD
FT                   T"
FT   CDS             complement(join(18451787..18452197,18452916..18453049,
FT                   18453329..18453396,18453578..18453735,18453906..18453947,
FT                   18454044..18454132,18454802..18455024,18456665..18456809,
FT                   18456965..18457034,18457205..18457319,18457424..18457563,
FT                   18457705..18457824,18459163..18459256,18461639..18461758,
FT                   18461860..18461922,18462027..18462187,18474896..18475007))
FT                   /codon_start=1
FT                   /gene="Sema3f"
FT                   /locus_tag="mCG_18872"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3 F, isoform CRA_a"
FT                   /note="gene_id=mCG18872.2 transcript_id=mCT170778.0
FT                   protein_id=mCP93695.0 isoform=CRA_a"
FT                   /protein_id="EDL21222.1"
FT                   /translation="MLVTAFILWASLLTGAWPATPIQDQLPATPRVRLSFKELKATGTA
FT                   HFFNFLLNTTDYRILLKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEEC
FT                   ILSGKDGNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQDYIFYLEPEKL
FT                   ESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQTAMRTDQYNSRWL
FT                   NDPSFIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGHCCLVN
FT                   KWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDIRNPVIYAVFTSSGSVFRGSAV
FT                   CVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPSMKSTKDYPDE
FT                   VINFMRTHPLMYQAVYPLQRRPLVVRTGAPYRLTTVAVDQVDAADGRYEVLFLGTDRGT
FT                   VQKVIVLPKDDQEVEELMLEEVEVFKEPAPVKTMTISSKRQQLYVASAVGVTHLSLHRC
FT                   QAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDVRHGNPIRQCRGFNSNANK
FT                   NAVESVQYGVAGSAAFLECQPRSPQATVKWLFQRDPSDRRREIRAEDRFLRTEQGLLLR
FT                   ALQLGDRGLYSCTATENNFKHIVTRVQLHVLGRDAVHAALFPPLAVSVPPPPGTGPPTP
FT                   PYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGALRPPELQDQKKPRNRRHHPPD
FT                   T"
FT   CDS             complement(join(18451787..18452197,18452916..18453049,
FT                   18453329..18453396,18453578..18453735,18453906..18453947,
FT                   18454044..18454132,18454802..18455024,18456665..18456809,
FT                   18456965..18457034,18457205..18457319,18457424..18457563,
FT                   18457705..18457824,18459163..18459256,18460827..18460919,
FT                   18461639..18461758,18461860..18461922,18462027..18462187,
FT                   18474896..18475007))
FT                   /codon_start=1
FT                   /gene="Sema3f"
FT                   /locus_tag="mCG_18872"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3 F, isoform CRA_b"
FT                   /note="gene_id=mCG18872.2 transcript_id=mCT170777.0
FT                   protein_id=mCP93696.0 isoform=CRA_b"
FT                   /protein_id="EDL21223.1"
FT                   /translation="MLVTAFILWASLLTGAWPATPIQDQLPATPRVRLSFKELKATGTA
FT                   HFFNFLLNTTDYRILLKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEEC
FT                   ILSGKDGNGECGNFVRLIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQALPWTQMQVVR
FT                   GRGSRATDGADRPTPTAPRQDYIFYLEPEKLESGKGKCPYDPKLDTASALINEELYAGV
FT                   YIDFMGTDAAIFRTLGKQTAMRTDQYNSRWLNDPSFIHAELIPDSAERNDDKLYFFFRE
FT                   RSAEAPQNPAVYARIGRICLNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQ
FT                   DVFVQQTQDIRNPVIYAVFTSSGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMP
FT                   FSGKMPYPRPGTCPGGTFTPSMKSTKDYPDEVINFMRTHPLMYQAVYPLQRRPLVVRTG
FT                   APYRLTTVAVDQVDAADGRYEVLFLGTDRGTVQKVIVLPKDDQEVEELMLEEVEVFKEP
FT                   APVKTMTISSKRQQLYVASAVGVTHLSLHRCQAYGAACADCCLARDPYCAWDGQACSRY
FT                   TASSKRRSRRQDVRHGNPIRQCRGFNSNANKNAVESVQYGVAGSAAFLECQPRSPQATV
FT                   KWLFQRDPSDRRREIRAEDRFLRTEQGLLLRALQLGDRGLYSCTATENNFKHIVTRVQL
FT                   HVLGRDAVHAALFPPLAVSVPPPPGTGPPTPPYQELAQLLAQPEVGLIHQYCQGYWRHV
FT                   PPSPREAPGALRPPELQDQKKPRNRRHHPPDT"
FT   gene            complement(18512110..18542491)
FT                   /gene="Rbm5"
FT                   /locus_tag="mCG_18862"
FT                   /note="gene_id=mCG18862.1"
FT   mRNA            complement(join(18512110..18512707,18514011..18514140,
FT                   18514220..18514317,18515456..18515530,18515802..18515981,
FT                   18516554..18516625,18516706..18516855,18517637..18517798,
FT                   18521326..18521417,18521626..18521710,18522081..18522166,
FT                   18523340..18523412,18523497..18523574,18523732..18523819,
FT                   18524598..18524695,18525647..18525807,18526048..18526113,
FT                   18527409..18527469,18528465..18528548,18531332..18531405,
FT                   18531878..18531947,18537005..18537160,18539050..18539215,
FT                   18541069..18541134,18542393..18542491))
FT                   /gene="Rbm5"
FT                   /locus_tag="mCG_18862"
FT                   /product="RNA binding motif protein 5, transcript variant
FT                   mCT16190"
FT                   /note="gene_id=mCG18862.1 transcript_id=mCT16190.2 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(18512110..18512707,18514011..18514140,
FT                   18514220..18514317,18515456..18515530,18515802..18515981,
FT                   18516554..18516625,18516706..18516855,18517637..18517798,
FT                   18521326..18521417,18521626..18521710,18522081..18522166,
FT                   18523340..18523412,18523497..18523574,18523732..18523819,
FT                   18524598..18524695,18525647..18525807,18526048..18526113,
FT                   18527409..18527469,18528465..18531947,18537005..18537160,
FT                   18539050..18539215,18541069..18541134,18542393..>18542489))
FT                   /gene="Rbm5"
FT                   /locus_tag="mCG_18862"
FT                   /product="RNA binding motif protein 5, transcript variant
FT                   mCT191518"
FT                   /note="gene_id=mCG18862.1 transcript_id=mCT191518.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(18512110..18512707,18514011..18514140,
FT                   18514220..18514317,18515456..18515530,18515802..18515981,
FT                   18516554..18516625,18516706..18516855,18517637..18517798,
FT                   18521326..18521417,18521626..18521710,18522081..18522166,
FT                   18523340..18523412,18523497..18523574,18523732..18523819,
FT                   18524598..18524695,18525647..18525807,18526048..18526113,
FT                   18527409..18527469,18528465..18528548,18531332..18531405,
FT                   18531878..18531947,18537005..18537160,18539050..18539215,
FT                   18541069..18541134,18542060..18542176))
FT                   /gene="Rbm5"
FT                   /locus_tag="mCG_18862"
FT                   /product="RNA binding motif protein 5, transcript variant
FT                   mCT171612"
FT                   /note="gene_id=mCG18862.1 transcript_id=mCT171612.0 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(18512119..18512707,18514011..18514140,
FT                   18514220..18514317,18515456..18515530,18515802..18515981,
FT                   18516554..18516625,18516706..18516855,18517637..18517798,
FT                   18521326..18521417,18521626..18521710,18522081..18522166,
FT                   18523340..18523412,18523497..18523574,18523732..18523819,
FT                   18524598..18524695,18525647..18525807,18526048..18526113,
FT                   18527409..18527469,18528465..18528548,18531878..18531947,
FT                   18537005..18537160,18539050..18539215,18541069..18541134,
FT                   18542393..>18542488))
FT                   /gene="Rbm5"
FT                   /locus_tag="mCG_18862"
FT                   /product="RNA binding motif protein 5, transcript variant
FT                   mCT191517"
FT                   /note="gene_id=mCG18862.1 transcript_id=mCT191517.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(18512582..18512707,18514011..18514140,
FT                   18514220..18514317,18515456..18515530,18515802..18515981,
FT                   18516554..18516625,18516706..18516855,18517637..18517798,
FT                   18521326..18521417,18521626..18521710,18522081..18522166,
FT                   18523340..18523412,18523497..18523574,18523732..18523819,
FT                   18524598..18524695,18525647..18525807,18526048..18526113,
FT                   18527409..18527469,18528465..18528548,18531332..18531405,
FT                   18531878..18531947,18537005..18537160,18539050..18539215,
FT                   18541069..18541085))
FT                   /codon_start=1
FT                   /gene="Rbm5"
FT                   /locus_tag="mCG_18862"
FT                   /product="RNA binding motif protein 5, isoform CRA_a"
FT                   /note="gene_id=mCG18862.1 transcript_id=mCT171612.0
FT                   protein_id=mCP94531.0 isoform=CRA_a"
FT                   /protein_id="EDL21224.1"
FT                   /translation="MGSDKRVSRTERSGRYGSIIDRDDRDERESRSRRRDSDYKRSSDD
FT                   RRGDRYDDYRDYDSPERERERRNSDRSEDGYHSDGDYGEHDYRHDISDERESKTIMLRG
FT                   LPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKK
FT                   LVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTES
FT                   AQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQL
FT                   SSAMDASQLLQILQSLHPPLKIDGKTIGVDFAKSARKDLVLPDGNRVSAFSVASTAIAA
FT                   AQWSSTQSQSGEGGSVDYSYMQPGQDGYTQYTQYSQDYQQFYQQQAGGLESDTSATSGT
FT                   TVTTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPD
FT                   TSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAEASSNQQT
FT                   GLPSTKEGKEKKEKPKSKTAQQIAKDMERWAKSLNKQKENFKNSFQPVNSLREEERRES
FT                   AAADAGFALFEKKGALAERQQLLPELVRNGDEENPLKRGLVAAYSGDSDNEEELVERLE
FT                   SEEEKLADWKKMACLLCRRQFPNRDALVRHQQLSDLHKQNMDIYRRSRLSEQELEALEL
FT                   REREMKYRDRAAERREKYGIPEPPEPKRKKQFDAGTVNYEQPTKDGIDHSNIGNKMLQA
FT                   MGWREGSGLGRKCQGITAPIEAQVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARFT
FT                   EME"
FT   CDS             complement(join(18512582..18512707,18514011..18514140,
FT                   18514220..18514317,18515456..18515530,18515802..18515981,
FT                   18516554..18516625,18516706..18516855,18517637..18517798,
FT                   18521326..18521417,18521626..18521710,18522081..18522166,
FT                   18523340..18523412,18523497..18523574,18523732..18523819,
FT                   18524598..18524695,18525647..18525807,18526048..18526113,
FT                   18527409..18527469,18528465..18528548,18531332..18531405,
FT                   18531878..18531947,18537005..18537160,18539050..18539215,
FT                   18541069..18541085))
FT                   /codon_start=1
FT                   /gene="Rbm5"
FT                   /locus_tag="mCG_18862"
FT                   /product="RNA binding motif protein 5, isoform CRA_a"
FT                   /note="gene_id=mCG18862.1 transcript_id=mCT16190.2
FT                   protein_id=mCP21280.2 isoform=CRA_a"
FT                   /protein_id="EDL21228.1"
FT                   /translation="MGSDKRVSRTERSGRYGSIIDRDDRDERESRSRRRDSDYKRSSDD
FT                   RRGDRYDDYRDYDSPERERERRNSDRSEDGYHSDGDYGEHDYRHDISDERESKTIMLRG
FT                   LPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKK
FT                   LVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTES
FT                   AQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQL
FT                   SSAMDASQLLQILQSLHPPLKIDGKTIGVDFAKSARKDLVLPDGNRVSAFSVASTAIAA
FT                   AQWSSTQSQSGEGGSVDYSYMQPGQDGYTQYTQYSQDYQQFYQQQAGGLESDTSATSGT
FT                   TVTTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPD
FT                   TSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAEASSNQQT
FT                   GLPSTKEGKEKKEKPKSKTAQQIAKDMERWAKSLNKQKENFKNSFQPVNSLREEERRES
FT                   AAADAGFALFEKKGALAERQQLLPELVRNGDEENPLKRGLVAAYSGDSDNEEELVERLE
FT                   SEEEKLADWKKMACLLCRRQFPNRDALVRHQQLSDLHKQNMDIYRRSRLSEQELEALEL
FT                   REREMKYRDRAAERREKYGIPEPPEPKRKKQFDAGTVNYEQPTKDGIDHSNIGNKMLQA
FT                   MGWREGSGLGRKCQGITAPIEAQVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARFT
FT                   EME"
FT   CDS             complement(join(18512582..18512707,18514011..18514140,
FT                   18514220..18514317,18515456..18515530,18515802..18515981,
FT                   18516554..18516625,18516706..18516855,18517637..18517798,
FT                   18521326..18521417,18521626..18521710,18522081..18522166,
FT                   18523340..18523412,18523497..18523574,18523732..18523819,
FT                   18524598..18524695,18525647..18525807,18526048..18526113,
FT                   18527409..18527469,18528465..18528548,18531878..>18531889))
FT                   /codon_start=1
FT                   /gene="Rbm5"
FT                   /locus_tag="mCG_18862"
FT                   /product="RNA binding motif protein 5, isoform CRA_b"
FT                   /note="gene_id=mCG18862.1 transcript_id=mCT191517.0
FT                   protein_id=mCP112494.0 isoform=CRA_b"
FT                   /protein_id="EDL21225.1"
FT                   /translation="RGKQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCF
FT                   RCGADKFDSEQEVPPGTTESAQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNN
FT                   IRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPPLKIDGKTIGVDFAKSARKDL
FT                   VLPDGNRVSAFSVASTAIAAAQWSSTQSQSGEGGSVDYSYMQPGQDGYTQYTQYSQDYQ
FT                   QFYQQQAGGLESDTSATSGTTVTTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPSTSTST
FT                   QAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLY
FT                   WDGEKETYVPAAEASSNQQTGLPSTKEGKEKKEKPKSKTAQQIAKDMERWAKSLNKQKE
FT                   NFKNSFQPVNSLREEERRESAAADAGFALFEKKGALAERQQLLPELVRNGDEENPLKRG
FT                   LVAAYSGDSDNEEELVERLESEEEKLADWKKMACLLCRRQFPNRDALVRHQQLSDLHKQ
FT                   NMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRKKQFDAGTVNY
FT                   EQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLKGAGLGAKGSAYG
FT                   LSGADSYKDAVRKAMFARFTEME"
FT   CDS             complement(join(18512582..18512707,18514011..18514140,
FT                   18514220..18514317,18515456..18515530,18515802..18515981,
FT                   18516554..18516625,18516706..18516855,18517637..18517798,
FT                   18521326..18521417,18521626..18521710,18522081..18522166,
FT                   18523340..18523412,18523497..18523574,18523732..18523819,
FT                   18524598..18524695,18525647..18525807,18526048..18526113,
FT                   18527409..18527469,18528465..>18528707))
FT                   /codon_start=1
FT                   /gene="Rbm5"
FT                   /locus_tag="mCG_18862"
FT                   /product="RNA binding motif protein 5, isoform CRA_c"
FT                   /note="gene_id=mCG18862.1 transcript_id=mCT191518.0
FT                   protein_id=mCP112495.0 isoform=CRA_c"
FT                   /protein_id="EDL21226.1"
FT                   /translation="SIGWAEYRWRWLVFPVCCPFNSRALIFPKCALPWENGHIYLTMGI
FT                   TNCFFFLQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFDSE
FT                   QEVPPGTTESAQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQ
FT                   QNRGFAFVQLSSAMDASQLLQILQSLHPPLKIDGKTIGVDFAKSARKDLVLPDGNRVSA
FT                   FSVASTAIAAAQWSSTQSQSGEGGSVDYSYMQPGQDGYTQYTQYSQDYQQFYQQQAGGL
FT                   ESDTSATSGTTVTTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPSTSTSTQAPAASPTGV
FT                   VPGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVP
FT                   AAEASSNQQTGLPSTKEGKEKKEKPKSKTAQQIAKDMERWAKSLNKQKENFKNSFQPVN
FT                   SLREEERRESAAADAGFALFEKKGALAERQQLLPELVRNGDEENPLKRGLVAAYSGDSD
FT                   NEEELVERLESEEEKLADWKKMACLLCRRQFPNRDALVRHQQLSDLHKQNMDIYRRSRL
FT                   SEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRKKQFDAGTVNYEQPTKDGIDH
FT                   SNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLKGAGLGAKGSAYGLSGADSYKDA
FT                   VRKAMFARFTEME"
FT   mRNA            complement(join(<18517689..18517798,18521326..18521417,
FT                   18521626..18521710,18522081..18522166,18523340..18523412,
FT                   18523497..18523574,18523732..18523819,18524598..18524695,
FT                   18525647..18525807,18526048..18526113,18527409..18527469,
FT                   18528465..18528548,18531332..18531405,18531878..18531947,
FT                   18537005..18537156,18539050..18539215,18541069..18541134,
FT                   18542393..>18542459))
FT                   /gene="Rbm5"
FT                   /locus_tag="mCG_18862"
FT                   /product="RNA binding motif protein 5, transcript variant
FT                   mCT191519"
FT                   /note="gene_id=mCG18862.1 transcript_id=mCT191519.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<18517689..18517798,18521326..18521417,
FT                   18521626..18521710,18522081..18522166,18523340..18523412,
FT                   18523497..18523574,18523732..18523819,18524598..18524695,
FT                   18525647..18525807,18526048..18526113,18527409..18527469,
FT                   18528465..18528548,18531332..18531405,18531878..18531947,
FT                   18537005..18537156,18539050..>18539056))
FT                   /codon_start=1
FT                   /gene="Rbm5"
FT                   /locus_tag="mCG_18862"
FT                   /product="RNA binding motif protein 5, isoform CRA_d"
FT                   /note="gene_id=mCG18862.1 transcript_id=mCT191519.0
FT                   protein_id=mCP112496.0 isoform=CRA_d"
FT                   /protein_id="EDL21227.1"
FT                   /translation="SRERERRNSDRSEDGYHSDGDYGEHDYRHDISDERESKTIMLRGL
FT                   PITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKL
FT                   VIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESA
FT                   QSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLS
FT                   SAMDASQLLQILQSLHPPLKIDGKTIGVDFAKSARKDLVLPDGNRVSAFSVASTAIAAA
FT                   QWSSTQSQSGEGGSVDYSYMQPGQDGYTQYTQYSQDYQQFYQQQAGGLESDTSATSGTT
FT                   VTTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDT
FT                   STYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAEASSNQQTG
FT                   LPST"
FT   gene            complement(18545073..18644750)
FT                   /gene="Rbm6"
FT                   /locus_tag="mCG_18871"
FT                   /note="gene_id=mCG18871.2"
FT   mRNA            complement(join(18545073..18545320,18546105..18546234,
FT                   18549659..18549756,18551254..18551328,18554437..18554688,
FT                   18555515..18555610,18559473..18559619,18560000..18560085,
FT                   18560329..18560410,18560551..18560593,18561831..18561928,
FT                   18563218..18563378,18563887..18564153,18568599..18568659,
FT                   18572809..18572883,18605492..18605565,18619321..18619390,
FT                   18622947..18623036,18624157..18625435,18632365..18632475,
FT                   18644578..18644750))
FT                   /gene="Rbm6"
FT                   /locus_tag="mCG_18871"
FT                   /product="RNA binding motif protein 6, transcript variant
FT                   mCT16198"
FT                   /note="gene_id=mCG18871.2 transcript_id=mCT16198.2 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(18545078..18545320,18546105..18546234,
FT                   18549659..18549756,18551254..18551328,18554437..18554688,
FT                   18555515..18555610,18559473..18559619,18560000..18560085,
FT                   18560329..18560410,18560551..18560593,18561831..18561928,
FT                   18563218..18563378,18563887..18564153,18568599..18568659,
FT                   18572809..18572883,18605492..18605565,18619321..18619390,
FT                   18622947..18623036,18624157..18625706,18632365..18632475,
FT                   18644578..>18644654))
FT                   /gene="Rbm6"
FT                   /locus_tag="mCG_18871"
FT                   /product="RNA binding motif protein 6, transcript variant
FT                   mCT191551"
FT                   /note="gene_id=mCG18871.2 transcript_id=mCT191551.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(18545195..18545320,18546105..18546234,
FT                   18549659..18549756,18551254..18551328,18554437..18554688,
FT                   18555515..18555610,18559473..18559619,18560000..18560085,
FT                   18560329..18560410,18560551..18560593,18561831..18561928,
FT                   18563218..18563378,18563887..18564153,18568599..18568659,
FT                   18572809..18572883,18605492..18605565,18619321..18619390,
FT                   18622947..18623036,18624157..18625435,18632365..18632408))
FT                   /codon_start=1
FT                   /gene="Rbm6"
FT                   /locus_tag="mCG_18871"
FT                   /product="RNA binding motif protein 6, isoform CRA_b"
FT                   /note="gene_id=mCG18871.2 transcript_id=mCT16198.2
FT                   protein_id=mCP21299.2 isoform=CRA_b"
FT                   /protein_id="EDL21230.1"
FT                   /translation="MWGDSRSANRTGPFRGSQEERFAPGWNRDYPPPPLKSHAQERHSG
FT                   NFPGRDSLPFDFQGHSGPPFANVEEHSFSYGGRDGPHGDYQGGEGPGHDFRGGDFSSSD
FT                   FQSRDSAQLDFRNRDIHSGDFRDREGPPMDYRGGDGTPMDYRGRETPHMNYRDRDSHTV
FT                   DFRSRDVPPTDFRGRGTYDLDFRGREGSHSDFRGRDLSDLDFRSRDQSRSDFRNRDVSD
FT                   LDFRDKDGTQVDFRGRGSATTDLDFRNRDTPHSDFRGRHRTRTYQDFRGREVGPCMEFK
FT                   DREMPPMDPKVLDYIQPSPQEREHSGMNMNKREESIHDHAMERPAFGVQKGEFEHSETR
FT                   EGETQSGTFEHESQSDFQNSQSPVQEQDKPKLSGGEQQSSDAGLFKEEGDLDFLGQQDT
FT                   DYRSIEYCDVDHRLPGNQIFGYGQSKSFSQGKMSRDAQQDLQDQDYRTGPSEEKPNRLI
FT                   RLSGVPENATKEEILNAFRTSDGIPVKDLQLKEYNTGYDYGYVCVEFSLLEDAIGCMEA
FT                   NQGTLMIHDKEVTLEYVPSPDFWYCKRCKASTGGHQSSCSFCKGPKEEVKQELVSYPQP
FT                   QKTSIPVPSEKQPNQPRPADKEHELRKREEGQESRLGHQKRDTERYFPHSRREGLTFRR
FT                   DREKEPWSGDSRQDGESKTIMLKRIYRSTPPEVIVEVLEPYVHLTTANVRIIKNRTGPM
FT                   GHTYGFIDLDSHAEALRVVKILQNLDPPFSIDGKMVAVNLATGKRRNDSGDHSDHMHYY
FT                   QGKKYFRDRRGGNRNSDWSSDTNRQGQQSSSDCYIYDSTTGYYYDPLAGTYYDPNTQQE
FT                   VYVPQDPESPDEEEIKEKKSTSQGKSNSKKETSKRDGKEKKDRGMTKFQESTSEGKPPL
FT                   EDVFKKPLPPTVKKEESPPPPKVVNPLIGLLGEYGGDSDYEEEEEEEQAPPVQPQPQPR
FT                   EEMTKKENEDDKLTDWNKLACLLCRRQFPNKEVLTKHQQLSDLHKQNLEIHRKIKQSEQ
FT                   ELAYLERREREGRFKEKGNDRREKLQSFDSPERKRIKYSRETDSDRNPVDKEDTDTSSK
FT                   GGCAQQATGWRKGAGLGYSHPGLGSSEEIEGRMRGPGGGPPGRTSKRQSNETYRDAVRR
FT                   VMFARYKELD"
FT   CDS             complement(join(18545195..18545320,18546105..18546234,
FT                   18549659..18549756,18551254..18551328,18554437..18554688,
FT                   18555515..18555610,18559473..18559619,18560000..18560085,
FT                   18560329..18560410,18560551..18560593,18561831..18561928,
FT                   18563218..18563378,18563887..18564153,18568599..18568659,
FT                   18572809..18572883,18605492..18605565,18619321..18619390,
FT                   18622947..18623036,18624157..>18625455))
FT                   /codon_start=1
FT                   /gene="Rbm6"
FT                   /locus_tag="mCG_18871"
FT                   /product="RNA binding motif protein 6, isoform CRA_a"
FT                   /note="gene_id=mCG18871.2 transcript_id=mCT191551.0
FT                   protein_id=mCP112506.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5DTS4"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR028806"
FT                   /db_xref="MGI:MGI:1338037"
FT                   /db_xref="UniProtKB/TrEMBL:Q5DTS4"
FT                   /protein_id="EDL21229.1"
FT                   /translation="PCLCFYSGSQEERFAPGWNRDYPPPPLKSHAQERHSGNFPGRDSL
FT                   PFDFQGHSGPPFANVEEHSFSYGGRDGPHGDYQGGEGPGHDFRGGDFSSSDFQSRDSAQ
FT                   LDFRNRDIHSGDFRDREGPPMDYRGGDGTPMDYRGRETPHMNYRDRDSHTVDFRSRDVP
FT                   PTDFRGRGTYDLDFRGREGSHSDFRGRDLSDLDFRSRDQSRSDFRNRDVSDLDFRDKDG
FT                   TQVDFRGRGSATTDLDFRNRDTPHSDFRGRHRTRTYQDFRGREVGPCMEFKDREMPPMD
FT                   PKVLDYIQPSPQEREHSGMNMNKREESIHDHAMERPAFGVQKGEFEHSETREGETQSGT
FT                   FEHESQSDFQNSQSPVQEQDKPKLSGGEQQSSDAGLFKEEGDLDFLGQQDTDYRSIEYC
FT                   DVDHRLPGNQIFGYGQSKSFSQGKMSRDAQQDLQDQDYRTGPSEEKPNRLIRLSGVPEN
FT                   ATKEEILNAFRTSDGIPVKDLQLKEYNTGYDYGYVCVEFSLLEDAIGCMEANQGTLMIH
FT                   DKEVTLEYVPSPDFWYCKRCKASTGGHQSSCSFCKGPKEEVKQELVSYPQPQKTSIPVP
FT                   SEKQPNQPRPADKEHELRKREEGQESRLGHQKRDTERYFPHSRREGLTFRRDREKEPWS
FT                   GDSRQDGESKTIMLKRIYRSTPPEVIVEVLEPYVHLTTANVRIIKNRTGPMGHTYGFID
FT                   LDSHAEALRVVKILQNLDPPFSIDGKMVAVNLATGKRRNDSGDHSDHMHYYQGKKYFRD
FT                   RRGGNRNSDWSSDTNRQGQQSSSDCYIYDSTTGYYYDPLAGTYYDPNTQQEVYVPQDPE
FT                   SPDEEEIKEKKSTSQGKSNSKKETSKRDGKEKKDRGMTKFQESTSEGKPPLEDVFKKPL
FT                   PPTVKKEESPPPPKVVNPLIGLLGEYGGDSDYEEEEEEEQAPPVQPQPQPREEMTKKEN
FT                   EDDKLTDWNKLACLLCRRQFPNKEVLTKHQQLSDLHKQNLEIHRKIKQSEQELAYLERR
FT                   EREGRFKEKGNDRREKLQSFDSPERKRIKYSRETDSDRNPVDKEDTDTSSKGGCAQQAT
FT                   GWRKGAGLGYSHPGLGSSEEIEGRMRGPGGGPPGRTSKRQSNETYRDAVRRVMFARYKE
FT                   LD"
FT   gene            <18551833..18580049
FT                   /locus_tag="mCG_145338"
FT                   /note="gene_id=mCG145338.0"
FT   mRNA            join(<18551833..18551852,18575041..18575093,
FT                   18575507..18578063,18579913..18580049)
FT                   /locus_tag="mCG_145338"
FT                   /product="mCG145338"
FT                   /note="gene_id=mCG145338.0 transcript_id=mCT184762.0
FT                   created on 05-JUN-2003"
FT   CDS             <18576230..18576631
FT                   /codon_start=1
FT                   /locus_tag="mCG_145338"
FT                   /product="mCG145338"
FT                   /note="gene_id=mCG145338.0 transcript_id=mCT184762.0
FT                   protein_id=mCP105888.0"
FT                   /protein_id="EDL21231.1"
FT                   /translation="SSLARSPIGSPILRLSHMFQNRFLFSFGALVLLCNSGWPETHWNQ
FT                   PTSVSRVLGIKACNTVSNVLFIWLQTSSSSPVSTSPVLSLIAMIPYLLLQYKQSLQSIH
FT                   TQLETSRHSETAKDCEMVLIFPLKNSQLF"
FT   gene            18644388..18645168
FT                   /locus_tag="mCG_147715"
FT                   /note="gene_id=mCG147715.0"
FT   mRNA            18644388..18645168
FT                   /locus_tag="mCG_147715"
FT                   /product="mCG147715"
FT                   /note="gene_id=mCG147715.0 transcript_id=mCT187978.0
FT                   created on 13-JAN-2004"
FT   CDS             18644727..18645116
FT                   /codon_start=1
FT                   /locus_tag="mCG_147715"
FT                   /product="mCG147715"
FT                   /note="gene_id=mCG147715.0 transcript_id=mCT187978.0
FT                   protein_id=mCP108538.0"
FT                   /db_xref="MGI:MGI:1922352"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D573"
FT                   /protein_id="EDL21232.1"
FT                   /translation="MKYGRKSRGLLSRRALRAAALTAGGAAAQWKGTLLATAQLEGTLL
FT                   RRACRELWFGFSAVTASLVFSSQVCKGSGWLRQPSDTPCQVLGDGPALPLGKERDCQFG
FT                   CRKWEEIFPVLFRYGKGLLAFRLHK"
FT   gene            <18660076..18675065
FT                   /gene="Mon1a"
FT                   /locus_tag="mCG_18881"
FT                   /note="gene_id=mCG18881.3"
FT   mRNA            join(<18660076..18660327,18670614..18670753,
FT                   18671959..18672447,18673139..18675057)
FT                   /gene="Mon1a"
FT                   /locus_tag="mCG_18881"
FT                   /product="MON1 homolog A (yeast), transcript variant
FT                   mCT191522"
FT                   /note="gene_id=mCG18881.3 transcript_id=mCT191522.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(18660107..18660327,18670614..18670753,
FT                   18671959..18672447,18673139..18673904,18674548..18674695,
FT                   18674794..18675065)
FT                   /gene="Mon1a"
FT                   /locus_tag="mCG_18881"
FT                   /product="MON1 homolog A (yeast), transcript variant
FT                   mCT16208"
FT                   /note="gene_id=mCG18881.3 transcript_id=mCT16208.2 created
FT                   on 06-AUG-2002"
FT   CDS             join(<18660233..18660327,18670614..18670753,
FT                   18671959..18672447,18673139..18673908)
FT                   /codon_start=1
FT                   /gene="Mon1a"
FT                   /locus_tag="mCG_18881"
FT                   /product="MON1 homolog A (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG18881.3 transcript_id=mCT191522.0
FT                   protein_id=mCP112508.0 isoform=CRA_a"
FT                   /protein_id="EDL21233.1"
FT                   /translation="GQALLDTYIFPGVWQRAVTGTLGRSCVSPRNRTAQKMAADMQRKR
FT                   SSECPEGTLAPSNGQSVERAESPTPGLTQGTEPGAGQEGAMFVHTRSYEDLTELEDREA
FT                   SGDSPKECVGSPPPLATDMRQISQDFSELSTQLTGVARDLQEEMLPGSSEDWPEPQGAA
FT                   GRGAATEPSQEGSTEGEEEDATEAWRLHQKHVFVLSEAGKPVYSRYGSEEALSSTMGVM
FT                   VALVSFLEADKNAIRSIHADGYKVVFVRRSPLVLVAVARTRQSAQELAQELLYIYYQIL
FT                   SLLTGAQLSHIFQQKQNYDLRRLLSGSERITDNLLQLMARDPSFLMGAARCLPLAAAVR
FT                   DTVSASLQQARARSLVFSILLAHNQLVALVRRKDQFLHPIDLHLLFNLISSSSSFREGE
FT                   AWTPVCLPKFNAAGFFHAHISYLEPDTDLCLLLISTDREDFFAVSDCRRRFQERLRKRG
FT                   THLALREALRTPYYSVAQVGIPDLRHFLYKSKSSGLFTR"
FT   CDS             join(18670627..18670753,18671959..18672447,
FT                   18673139..18673904,18674548..18674695,18674794..18674934)
FT                   /codon_start=1
FT                   /gene="Mon1a"
FT                   /locus_tag="mCG_18881"
FT                   /product="MON1 homolog A (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG18881.3 transcript_id=mCT16208.2
FT                   protein_id=mCP21259.2 isoform=CRA_b"
FT                   /protein_id="EDL21234.1"
FT                   /translation="MAADMQRKRSSECPEGTLAPSNGQSVERAESPTPGLTQGTEPGAG
FT                   QEGAMFVHTRSYEDLTELEDREASGDSPKECVGSPPPLATDMRQISQDFSELSTQLTGV
FT                   ARDLQEEMLPGSSEDWPEPQGAAGRGAATEPSQEGSTEGEEEDATEAWRLHQKHVFVLS
FT                   EAGKPVYSRYGSEEALSSTMGVMVALVSFLEADKNAIRSIHADGYKVVFVRRSPLVLVA
FT                   VARTRQSAQELAQELLYIYYQILSLLTGAQLSHIFQQKQNYDLRRLLSGSERITDNLLQ
FT                   LMARDPSFLMGAARCLPLAAAVRDTVSASLQQARARSLVFSILLAHNQLVALVRRKDQF
FT                   LHPIDLHLLFNLISSSSSFREGEAWTPVCLPKFNAAGFFHAHISYLEPDTDLCLLLIST
FT                   DREDFFAVSDCRRRFQERLRKRGTHLALREALRTPYYSVAQVGIPDLRHFLYKSKSSGL
FT                   FTSPEIEAPYSSEEEQERLLGLYQYLHSRAHNASRPLKTIYYTGPNENLLAWVTGAFEL
FT                   YMCYSPLGTKASAVSAIHKLMRWIRKEEDRLFILTPLTY"
FT   gene            18678829..18692326
FT                   /gene="Mst1r"
FT                   /locus_tag="mCG_18868"
FT                   /note="gene_id=mCG18868.1"
FT   mRNA            join(18678829..18680320,18683462..18683650,
FT                   18683736..18683864,18684020..18684190,18684514..18684674,
FT                   18685018..18685183,18685291..18685427,18686162..18686323,
FT                   18686418..18686511,18686654..18686869,18686955..18687101,
FT                   18687182..18687347,18687649..18687876,18688232..18688312,
FT                   18688497..18688678,18688760..18688869,18689144..18689309,
FT                   18689709..18689845,18691757..18692326)
FT                   /gene="Mst1r"
FT                   /locus_tag="mCG_18868"
FT                   /product="macrophage stimulating 1 receptor (c-met-related
FT                   tyrosine kinase)"
FT                   /note="gene_id=mCG18868.1 transcript_id=mCT16188.1 created
FT                   on 17-JUL-2002"
FT   CDS             join(18679085..18680320,18683462..18683650,
FT                   18683736..18683864,18684020..18684190,18684514..18684674,
FT                   18685018..18685183,18685291..18685427,18686162..18686323,
FT                   18686418..18686511,18686654..18686869,18686955..18687101,
FT                   18687182..18687347,18687649..18687876,18688232..18688312,
FT                   18688497..18688678,18688760..18688869,18689144..18689309,
FT                   18689709..18689845,18691757..18692015)
FT                   /codon_start=1
FT                   /gene="Mst1r"
FT                   /locus_tag="mCG_18868"
FT                   /product="macrophage stimulating 1 receptor (c-met-related
FT                   tyrosine kinase)"
FT                   /note="gene_id=mCG18868.1 transcript_id=mCT16188.1
FT                   protein_id=mCP21361.1"
FT                   /db_xref="GOA:B2RUR6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR016244"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:99614"
FT                   /db_xref="UniProtKB/TrEMBL:B2RUR6"
FT                   /protein_id="EDL21235.1"
FT                   /translation="MGLPLPLLQSSLLLMLLLRLSAASTNLNWQCPRIPYAASRDFSVK
FT                   YVVPSFSAGGRVQATAAYEDSTNSAVFVATRNHLHVLGPDLQFIENLTTGPIGNPGCQT
FT                   CASCGPGPHGPPKDTDTLVLVMEPGLPALVSCGSTLQGRCFLHELEPRGKALHLAAPAC
FT                   LFSANNNKPEACTDCVASPLGTRVTVVEQGHASYFYVASSLDPELAASFSPRSVSIRRL
FT                   KSDTSGFQPGFPSLSVLPKYLASYLIKYVYSFHSGDFVYFLTVQPISVTSPPSALHTRL
FT                   VRLNAVEPEIGDYRELVLDCHFAPKRRRRGAPEGTQPYPVLQAAHSAPVDAKLAVELSI
FT                   SEGQEVLFGVFVTVKDGGSGMGPNSVVCAFPIYHLNILIEEGVEYCCHSSNSSSLLSRG
FT                   LDFFQTPSFCPNPPGGEASGPSSRCHYFPLMVHASFTRVDLFNGLLGSVKVTALHVTRL
FT                   GNVTVAHMGTVDGRVLQVEIARSLNYLLYVSNFSLGSSGQPVHRDVSRLGNDLLFASGD
FT                   QVFKVPIQGPGCRHFLTCWRCLRAQRFMGCGWCGDRCDRQKECPGSWQQDHCPPEISEF
FT                   YPHSGPLRGTTRLTLCGSNFYLRPDDVVPEGTHQITVGQSPCRLLPKDSSSPRPGSLKE
FT                   FIQELECELEPLVTQAVGTTNISLVITNMPAGKHFRVEGISVQEGFSFVEPVLTSIKPD
FT                   FGPRAGGTYLTLEGQSLSVGTSRAVLVNGTQCRLEQVNEEQILCVTPPGAGTARVPLHL
FT                   QIGGAEVPGSWTFHYKEDPIVLDISPKCGYSGSHIMIHGQHLTSAWHFTLSFHDGQSTV
FT                   ESRCAGQFVEQQQRRCRLPEYVVRNPQGWATGNLSVWGDGAAGFTLPGFRFLPPPSPLR
FT                   AGLVELKPEEHSVKVEYVGLGAVADCVTVNMTVGGEVCQHELRGDVVICPLPPSLQLGK
FT                   DGVPLQVCVDGGCHILSQVVRSSPGRASQRILLIALLVLILLVAVLAVALIFNSRRRKK
FT                   QLGAHSLSPTTLSDINDTASGAPNHEESSESRDGTSVPLLRTESIRLQDLDRMLLAEVK
FT                   DVLIPHEQVVIHTDQVIGKGHFGVVYHGEYTDGAQNQTHCAIKSLSRITEVQEVEAFLR
FT                   EGLLMRGLHHPNILALIGIMLPPEGLPRVLLPYMRHGDLLRFIRSPQRNPTVKDLVSFG
FT                   LQVACGMEYLAEQKFVHRDLAARNCMLDESFTVKVADFGLARGVLDKEYYSVRQHRHAR
FT                   LPVKWMALESLQTYRFTTKSDVWSFGVLLWELLTRGAPPYPHIDPFDLSHFLAQGRRLP
FT                   QPEYCPDSLYHVMLRCWEADPAARPTFRALVLEVKQVVASLLGDHYVQLTAAYVNVGPR
FT                   AVDDGSVPPEQVQPSPQHCRSTSKPRPLSEPPLPT"
FT   gene            18700310..18704303
FT                   /gene="4921517D21Rik"
FT                   /locus_tag="mCG_18858"
FT                   /note="gene_id=mCG18858.1"
FT   mRNA            18700310..18704303
FT                   /gene="4921517D21Rik"
FT                   /locus_tag="mCG_18858"
FT                   /product="RIKEN cDNA 4921517D21"
FT                   /note="gene_id=mCG18858.1 transcript_id=mCT16184.1 created
FT                   on 17-JUL-2002"
FT   CDS             18700322..18703945
FT                   /codon_start=1
FT                   /gene="4921517D21Rik"
FT                   /locus_tag="mCG_18858"
FT                   /product="RIKEN cDNA 4921517D21"
FT                   /note="gene_id=mCG18858.1 transcript_id=mCT16184.1
FT                   protein_id=mCP21359.2"
FT                   /db_xref="GOA:Q9D5V1"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="MGI:MGI:1914972"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D5V1"
FT                   /protein_id="EDL21236.1"
FT                   /translation="MEDTKKVGGPDPSGPQGHPLPSSQQLTGGFKVSQGPWMNPKSLYS
FT                   KQGLSLSTGAINSTSQAPASQPMLQLLHNSAQVNSQCDYARASQDTSRFSSNPYPNPVV
FT                   GTQEHLLMDDGTQTLPMPPDNNGTDDKAQYRFNLSQNQLQIGRESKAPAKVLVGWGKGT
FT                   CNIGQMASEGSRKSRWLPYFLSGESGVVEGQAPLLTQAPVQDQRQDKCPCLAQSPTLNK
FT                   ATSSPSLPLPTSVPASVAAVNGLPAPAAVKPYTYSPNYLTNTTAAAKDLPLDLRNGGNQ
FT                   LSVLSDPSKKDKVYFFLKETPPTPTSSPAEFSPKIQDQEVAKVQVPIQQSEYPAKKCLV
FT                   SRLDTLTSTSEPLDSFKIQENSHKVCSSHPDKQPPNACNNNNCSNVPLPVLQGAYSKHS
FT                   LPQSPRGVIQSPISGAPTCQLQDAVEDHVLVFDMATGNTRMGLLCHDPMGSRAVLVGLT
FT                   PSHPSNHVSDNTLSAWSLSRPILSPNSDHPSLWSTTAVLSSPVPSSLSAGSYREVALVS
FT                   KEAKHNLEPRTSPGTESPIRMLARPVVPGTPIQYGEKISAQVPDPSWPKSDAEKMGTDH
FT                   TIWKLDSPTVQPRKLQWIKPDPVSTVDIQVVSRSPLQEKAGSTNQQAAHPSVPQAEGTG
FT                   QVFLTGQSFLNGQNLLARQPPVAEQGSLSGQLPSTKQLPLTCAPHLNEQTPLPRQLSLT
FT                   RHVPVPVKPPTTKEPPFTSGEPIQPQENEPLCNATHVGILRVPLTPEGTCLYVNRDKVE
FT                   NNRVQRSSINQPQSWQPSNPHRAQQEQLSLITFTGCKDLPISMVATESTNGHQFKMTSE
FT                   DITHASVVAHLGLLRGNCYELVSTVDTVPVQSAVLCNRSSSPYQKMAAIVIDTGTGFTK
FT                   CGLAQENHVLSVVPSQVQMLQHPPQGQPQYVVPEHQEGSYSVLNRGVVSDWDALEVLWQ
FT                   HLFYCKLKVQPEEMAVLVADSPISPRTNREKVAEILFERFHVPAMQTVHQALLTLYAYG
FT                   RTTGLVVGSGHGTSYVAPIITGDLAPIDTYRLDVAGADLTDYLTQLLLSGGHSLPKGGI
FT                   IRQIKEACCYVAMDTATEMARNQSQVQVDFVLPDKHVITLGSERFCCPEALFQPNLLGL
FT                   NQLGLPQLALLSINRLEVKQQEQLLANVVLEGGSTLINGFPERMRQELGPGATVLGSPH
FT                   RAVAAWLGGSIMACRDSFQSLWLTRREYEEEGPWAVYKYQL"
FT   gene            <18708054..18721830
FT                   /gene="Camkv"
FT                   /locus_tag="mCG_144017"
FT                   /note="gene_id=mCG144017.0"
FT   mRNA            join(<18708054..18708185,18717419..18717522,
FT                   18717629..18717760,18717930..18718004,18718219..18718357,
FT                   18718480..18718600,18718758..18718833,18718923..18719059,
FT                   18719222..18719300,18719520..18719607,18719884..18721830)
FT                   /gene="Camkv"
FT                   /locus_tag="mCG_144017"
FT                   /product="CaM kinase-like vesicle-associated"
FT                   /note="gene_id=mCG144017.0 transcript_id=mCT183441.0
FT                   created on 04-JUN-2003"
FT   CDS             join(<18708054..18708185,18717419..18717522,
FT                   18717629..18717760,18717930..18718004,18718219..18718357,
FT                   18718480..18718600,18718758..18718833,18718923..18719059,
FT                   18719222..18719300,18719520..18719607,18719884..18720480)
FT                   /codon_start=1
FT                   /gene="Camkv"
FT                   /locus_tag="mCG_144017"
FT                   /product="CaM kinase-like vesicle-associated"
FT                   /note="gene_id=mCG144017.0 transcript_id=mCT183441.0
FT                   protein_id=mCP105883.0"
FT                   /protein_id="EDL21237.1"
FT                   /translation="RFWSRSGCSWRRVCPACPERILPAAPGALLSGLSLPACDRPALQS
FT                   LAMPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLHTCKKFQK
FT                   RDGRKVRKAAKNEIGILKMVKHPNILQLVDVFVTRKEYFIFLELATGREVFDWILDQGY
FT                   YSERDTSNVVRQVLEAVAYLHSLKIVHRNLKLENLVYYNRLKNSKIVISDFHLAKLENG
FT                   LIKEPCGTPEYLAPEVVGRQRYGRPVDCWAIGVIMYILLSGNPPFYEEVEEDDYENHDK
FT                   NLFRKILAGDYEFDSPYWDDISQAAKDLVTRLMEVEQDQRITAEEAISHEWISGNAASD
FT                   KNIKDGVCAQIEKNFARAKWKKAVRVTTLMKRLRAPEQSGTAATQSASDAATPGAAGGA
FT                   IAAAAAAAAAGGAASASGASATAATEGGAGCAAKSDDIASADRSATPATDGSATPATDG
FT                   SVTPATDGSITPATDGSVTPATDRSATPATDGRATPATEESTVPATQSSALPAAKAAAT
FT                   PEPAVAQPDSTALEGATGQAPPSSKGEEATGCAQESQRVETS"
FT   gene            <18722276..18744405
FT                   /gene="Traip"
FT                   /locus_tag="mCG_18854"
FT                   /note="gene_id=mCG18854.3"
FT   mRNA            join(<18722276..18722519,18723183..18723312,
FT                   18728005..18728062,18728486..18728569,18730953..18730992,
FT                   18731576..18731703,18733115..18733209,18733679..18735553,
FT                   18740730..18740885,18741844..18741910,18742140..18742188,
FT                   18742606..18742755,18742845..18742895,18743111..18743662)
FT                   /gene="Traip"
FT                   /locus_tag="mCG_18854"
FT                   /product="TRAF-interacting protein, transcript variant
FT                   mCT191550"
FT                   /note="gene_id=mCG18854.3 transcript_id=mCT191550.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(18722279..18722519,18723183..18723312,
FT                   18728005..18728062,18728486..18728569,18730953..18730992,
FT                   18731576..18731703,18733115..18733209,18733679..18733792,
FT                   18734391..18734478,18734967..18735056,18735465..18735553,
FT                   18740730..18740885,18742140..18742188,18742606..18742755,
FT                   18742845..18742895,18743111..18744405)
FT                   /gene="Traip"
FT                   /locus_tag="mCG_18854"
FT                   /product="TRAF-interacting protein, transcript variant
FT                   mCT170770"
FT                   /note="gene_id=mCG18854.3 transcript_id=mCT170770.0 created
FT                   on 17-JUL-2002"
FT   CDS             join(<18722453..18722519,18723183..18723312,
FT                   18728005..18728062,18728486..18728569,18730953..18730992,
FT                   18731576..18731703,18733115..18733209,18733679..18733847)
FT                   /codon_start=1
FT                   /gene="Traip"
FT                   /locus_tag="mCG_18854"
FT                   /product="TRAF-interacting protein, isoform CRA_b"
FT                   /note="gene_id=mCG18854.3 transcript_id=mCT191550.0
FT                   protein_id=mCP112491.0 isoform=CRA_b"
FT                   /protein_id="EDL21239.1"
FT                   /translation="RGFVISWSLKHLYLQNHHPTVSAGSLGCLSRAIMPIRALCTICSD
FT                   FFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKKTIINKLFFDLAQEEE
FT                   NVLDAEFLKNELDSVKAQLSQKDREKRDSQAIIDTLRDTLEERNATVESLQNALNKAEM
FT                   LCSTLKKQMKFLEQRQDETKQAREEAHRLKCKMKTMEQIELLLQSQRSEVEEMIRDMGV
FT                   GQSAVEQLAVYCVSLKKCVSSGVPLPSSFVMQIL"
FT   mRNA            join(18723101..18723312,18728005..18728062,
FT                   18728486..18728569,18730953..18730992,18731576..18731703,
FT                   18733115..18733209,18733679..18733792,18734391..18734478,
FT                   18734967..18735056,18735465..18735553,18740730..18740885,
FT                   18742140..18742188,18742606..18742755,18742845..18742895,
FT                   18743111..18744405)
FT                   /gene="Traip"
FT                   /locus_tag="mCG_18854"
FT                   /product="TRAF-interacting protein, transcript variant
FT                   mCT16181"
FT                   /note="gene_id=mCG18854.3 transcript_id=mCT16181.2 created
FT                   on 17-JUL-2002"
FT   CDS             join(18723215..18723312,18728005..18728062,
FT                   18728486..18728569,18730953..18730992,18731576..18731703,
FT                   18733115..18733209,18733679..18733792,18734391..18734478,
FT                   18734967..18735056,18735465..18735553,18740730..18740885,
FT                   18742140..18742188,18742606..18742755,18742845..18742895,
FT                   18743111..18743233)
FT                   /codon_start=1
FT                   /gene="Traip"
FT                   /locus_tag="mCG_18854"
FT                   /product="TRAF-interacting protein, isoform CRA_a"
FT                   /note="gene_id=mCG18854.3 transcript_id=mCT170770.0
FT                   protein_id=mCP93688.0 isoform=CRA_a"
FT                   /protein_id="EDL21238.1"
FT                   /translation="MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRT
FT                   CPQCRIQVGKKTIINKLFFDLAQEEENVLDAEFLKNELDSVKAQLSQKDREKRDSQAII
FT                   DTLRDTLEERNATVESLQNALNKAEMLCSTLKKQMKFLEQRQDETKQAREEAHRLKCKM
FT                   KTMEQIELLLQSQRSEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKATGELA
FT                   DRLKKDLVSSRSKLKTLNTELDQAKLELRSAQKDLQSADQEITSLRKKLMILQGTLSLP
FT                   PATNETVSRLVFESPAPVEMMNPRLHQPPFGDEIDLNTTFDVNTPPTQTSGSQHCLPKK
FT                   LCLERARSPMQNVLKKVHKVSKPESQLSLGGQRCVGELDEELAGAFPLFIRNAVLGQKQ
FT                   PNRTTAESRCSTDVVRIGFDGLGGRTKFIQPRDTTIIRPVPVKSKAKSKQKVRIKTVSS
FT                   ASQPKLDTFLCQ"
FT   CDS             join(18723215..18723312,18728005..18728062,
FT                   18728486..18728569,18730953..18730992,18731576..18731703,
FT                   18733115..18733209,18733679..18733792,18734391..18734478,
FT                   18734967..18735056,18735465..18735553,18740730..18740885,
FT                   18742140..18742188,18742606..18742755,18742845..18742895,
FT                   18743111..18743233)
FT                   /codon_start=1
FT                   /gene="Traip"
FT                   /locus_tag="mCG_18854"
FT                   /product="TRAF-interacting protein, isoform CRA_a"
FT                   /note="gene_id=mCG18854.3 transcript_id=mCT16181.2
FT                   protein_id=mCP21329.2 isoform=CRA_a"
FT                   /protein_id="EDL21240.1"
FT                   /translation="MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRT
FT                   CPQCRIQVGKKTIINKLFFDLAQEEENVLDAEFLKNELDSVKAQLSQKDREKRDSQAII
FT                   DTLRDTLEERNATVESLQNALNKAEMLCSTLKKQMKFLEQRQDETKQAREEAHRLKCKM
FT                   KTMEQIELLLQSQRSEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKATGELA
FT                   DRLKKDLVSSRSKLKTLNTELDQAKLELRSAQKDLQSADQEITSLRKKLMILQGTLSLP
FT                   PATNETVSRLVFESPAPVEMMNPRLHQPPFGDEIDLNTTFDVNTPPTQTSGSQHCLPKK
FT                   LCLERARSPMQNVLKKVHKVSKPESQLSLGGQRCVGELDEELAGAFPLFIRNAVLGQKQ
FT                   PNRTTAESRCSTDVVRIGFDGLGGRTKFIQPRDTTIIRPVPVKSKAKSKQKVRIKTVSS
FT                   ASQPKLDTFLCQ"
FT   gene            18747635..18756187
FT                   /locus_tag="mCG_18845"
FT                   /note="gene_id=mCG18845.3"
FT   mRNA            join(18747635..18747844,18747928..18748096,
FT                   18748186..18748320,18748437..18748543,18748786..18748931,
FT                   18749035..18749170,18749262..18749359,18749460..18749606,
FT                   18749983..18750153,18750340..18750447,18750596..18750676,
FT                   18750757..18750912,18750987..18751152,18751231..18751436,
FT                   18751525..18751589,18751675..18751822,18751894..18751968,
FT                   18752160..18752313,18753006..18753088,18753333..18753425,
FT                   18753519..18753710,18755226..18755318,18755392..18755492,
FT                   18755946..18756187)
FT                   /locus_tag="mCG_18845"
FT                   /product="mCG18845, transcript variant mCT191516"
FT                   /note="gene_id=mCG18845.3 transcript_id=mCT191516.1 created
FT                   on 09-MAR-2004"
FT   mRNA            join(18747635..18747844,18747928..18748096,
FT                   18748186..18748320,18748437..18748543,18748841..18748931,
FT                   18749035..18749170,18749262..18749359,18749460..18749606,
FT                   18749983..18750153,18750340..18750447,18750596..18750676,
FT                   18750757..18750912,18750987..18751152,18751231..18751436,
FT                   18751525..18751589,18751675..18751822,18751894..18751968,
FT                   18752160..18752313,18753006..18753088,18753333..18753425,
FT                   18753519..18753710,18755226..18755318,18755392..18755492,
FT                   18755946..18756187)
FT                   /locus_tag="mCG_18845"
FT                   /product="mCG18845, transcript variant mCT15935"
FT                   /note="gene_id=mCG18845.3 transcript_id=mCT15935.3 created
FT                   on 09-MAR-2004"
FT   mRNA            join(18747635..18747844,18747928..18748096,
FT                   18748186..18748320,18748437..18748543,18748841..18748931,
FT                   18749035..18749170,18749262..18749359,18749460..18749606,
FT                   18749983..18750153,18750340..18750447,18750596..18750676,
FT                   18750757..18750912,18750987..18751152,18751231..18751436,
FT                   18751525..18751589,18751675..18751822,18751894..18751968,
FT                   18752160..18752313,18753006..18753088,18753333..18753425,
FT                   18753647..18753710,18755226..18755318,18755392..18755492,
FT                   18755946..18756187)
FT                   /locus_tag="mCG_18845"
FT                   /product="mCG18845, transcript variant mCT191514"
FT                   /note="gene_id=mCG18845.3 transcript_id=mCT191514.1 created
FT                   on 09-MAR-2004"
FT   mRNA            join(18747635..18747844,18747928..18748096,
FT                   18748186..18748320,18748437..18748543,18748841..18748931,
FT                   18749035..18749170,18749262..18749359,18749460..18749606,
FT                   18749983..18750153,18750340..18750447,18750598..18750676,
FT                   18750757..18750912,18750987..18751152,18751231..18751436,
FT                   18751525..18751589,18751675..18751822,18751894..18751968,
FT                   18752160..18752313,18753006..18753088,18753333..18753425,
FT                   18753519..18753710,18755226..18755318,18755392..18755492,
FT                   18755946..18756187)
FT                   /locus_tag="mCG_18845"
FT                   /product="mCG18845, transcript variant mCT191515"
FT                   /note="gene_id=mCG18845.3 transcript_id=mCT191515.1 created
FT                   on 09-MAR-2004"
FT   CDS             join(18747816..18747844,18747928..18748096,
FT                   18748186..18748320,18748437..18748543,18748841..18748931,
FT                   18749035..18749170,18749262..18749359,18749460..18749606,
FT                   18749983..18750153,18750340..18750447,18750596..18750676,
FT                   18750757..18750912,18750987..18751152,18751231..18751436,
FT                   18751525..18751589,18751675..18751822,18751894..18751968,
FT                   18752160..18752313,18753006..18753088,18753333..18753425,
FT                   18753519..18753710,18755226..18755318,18755392..18755492,
FT                   18755946..18756075)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18845"
FT                   /product="mCG18845, isoform CRA_d"
FT                   /note="gene_id=mCG18845.3 transcript_id=mCT15935.3
FT                   protein_id=mCP21398.3 isoform=CRA_d"
FT                   /db_xref="GOA:Q9DBK7"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018075"
FT                   /db_xref="InterPro:IPR018965"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="InterPro:IPR023280"
FT                   /db_xref="MGI:MGI:1349462"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DBK7"
FT                   /protein_id="EDL21244.1"
FT                   /translation="MDEELYSRQLYVLGLPAMQRIQEAKVLLCGLQGLGAEVAKNLVLT
FT                   GVGSLTLHDPHPTCWADLAAQCFLSEESLGRNRAEASQAQLAQLNEAVQISVHSGDITE
FT                   DLLQGFQVVVLTDSKLEDQLKVGPLCHKHGVRFLMAETRGLVGRLFCDFGEDFTVLDPT
FT                   EVEPMTAAIQDISQGFPGIVTLRGDTKRHSFHDGDLVIFSDIEGMVELNSCSPQSVRVQ
FT                   KDGSLEIGDTTTFSRYLRGGVVTEVKRPKTVRHKPLDIALLQPHVVAQNTQEVQRAHCL
FT                   HQAFHVLHKFQQLHGRLPKPWDPDDAETVVELAQDLEPLKGTEEESLDEALLRTIALSS
FT                   AGTLSPMAAIMGGVAAQEVLKAISRKFMPLDQWLYFDALECLPEDETLLPSPEDCQPRN
FT                   CRYDGQIAVFGTDLQEKLSDQHYLLVGAGAIGCEMLKVFALVGLGVRANGGVTVADMDY
FT                   IERSNLSRQFLFRPKDVRRPKAEVAAAAAHRLNPDLRATPYTCPLDPTTEDIYDDSFFS
FT                   RVNGVVAALDSFQARHYVAARCTHYLKPLLEAGTQGTWGSASVFVPYVTEAYRGPASDA
FT                   ASEDAPYPVCTLRHIPSSMEHSVQWAQDQFEGLFRLSTETINCYQQTCTSLSATDRTET
FT                   LALLQQVMGVLRTRPQTWQDCVVWALGHWQLCFHDKVLEGGTQFSSGSNKCPHPLQFDP
FT                   NHDMHFLYVLAAANLYARMHGLPGSQSQPALRELLTRLLESDSRPQNLFSAEHGQEQLK
FT                   ELQETLDDWRKGPPLKPVLFVKDDDSNFHVDFVVAATDLRCQNYGILPVNHARIKQIVG
FT                   RIIPAIATSTAVVAGLLGLELYKVVSGLRSHGTFRHSYLHLAENHFIRSAPSAPAVQSF
FT                   RDLKWTCWDRLKVPAVQPERTLKSLLAHLQEEHGLKVEMLLHHQALLYSSGWSSEKQAQ
FT                   HLCLRVTELVQHVTGWKPKPGLKVLVFELSCEGEEEEMAFPPLHYEL"
FT   CDS             join(18747816..18747844,18747928..18748096,
FT                   18748186..18748320,18748437..18748543,18748841..18748931,
FT                   18749035..18749170,18749262..18749359,18749460..18749606,
FT                   18749983..18750153,18750340..18750447,18750596..18750676,
FT                   18750757..18750912,18750987..18751152,18751231..18751436,
FT                   18751525..18751589,18751675..18751822,18751894..18751968,
FT                   18752160..18752313,18753006..18753088,18753333..18753425,
FT                   18753647..18753664)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18845"
FT                   /product="mCG18845, isoform CRA_a"
FT                   /note="gene_id=mCG18845.3 transcript_id=mCT191514.1
FT                   protein_id=mCP112486.1 isoform=CRA_a"
FT                   /protein_id="EDL21241.1"
FT                   /translation="MDEELYSRQLYVLGLPAMQRIQEAKVLLCGLQGLGAEVAKNLVLT
FT                   GVGSLTLHDPHPTCWADLAAQCFLSEESLGRNRAEASQAQLAQLNEAVQISVHSGDITE
FT                   DLLQGFQVVVLTDSKLEDQLKVGPLCHKHGVRFLMAETRGLVGRLFCDFGEDFTVLDPT
FT                   EVEPMTAAIQDISQGFPGIVTLRGDTKRHSFHDGDLVIFSDIEGMVELNSCSPQSVRVQ
FT                   KDGSLEIGDTTTFSRYLRGGVVTEVKRPKTVRHKPLDIALLQPHVVAQNTQEVQRAHCL
FT                   HQAFHVLHKFQQLHGRLPKPWDPDDAETVVELAQDLEPLKGTEEESLDEALLRTIALSS
FT                   AGTLSPMAAIMGGVAAQEVLKAISRKFMPLDQWLYFDALECLPEDETLLPSPEDCQPRN
FT                   CRYDGQIAVFGTDLQEKLSDQHYLLVGAGAIGCEMLKVFALVGLGVRANGGVTVADMDY
FT                   IERSNLSRQFLFRPKDVRRPKAEVAAAAAHRLNPDLRATPYTCPLDPTTEDIYDDSFFS
FT                   RVNGVVAALDSFQARHYVAARCTHYLKPLLEAGTQGTWGSASVFVPYVTEAYRGPASDA
FT                   ASEDAPYPVCTLRHIPSSMEHSVQWAQDQFEGLFRLSTETINCYQQTCTSLSATDRTET
FT                   LALLQQVMGVLRTRPQTWQDCVVWALGHWQLCFHDKVLEGGTQFSSGSNKCPHPLQFDP
FT                   NHDMHFLYVLAAANLYARMHGLPGSQSQPALRELLTRLLESDSRPQNLFSAEHGQEQLK
FT                   ELQETLDDWRKGPPLKPVLFVKDDDSNFHVDFVVAATDLRCQNYGILPVNHARLSAPG"
FT   CDS             join(18748902..18748931,18749035..18749170,
FT                   18749262..18749359,18749460..18749606,18749983..18750153,
FT                   18750340..18750447,18750596..18750676,18750757..18750912,
FT                   18750987..18751152,18751231..18751436,18751525..18751589,
FT                   18751675..18751822,18751894..18751968,18752160..18752313,
FT                   18753006..18753088,18753333..18753425,18753519..18753710,
FT                   18755226..18755318,18755392..18755492,18755946..18756075)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18845"
FT                   /product="mCG18845, isoform CRA_c"
FT                   /note="gene_id=mCG18845.3 transcript_id=mCT191516.1
FT                   protein_id=mCP112488.1 isoform=CRA_c"
FT                   /protein_id="EDL21243.1"
FT                   /translation="MTAAIQDISQGFPGIVTLRGDTKRHSFHDGDLVIFSDIEGMVELN
FT                   SCSPQSVRVQKDGSLEIGDTTTFSRYLRGGVVTEVKRPKTVRHKPLDIALLQPHVVAQN
FT                   TQEVQRAHCLHQAFHVLHKFQQLHGRLPKPWDPDDAETVVELAQDLEPLKGTEEESLDE
FT                   ALLRTIALSSAGTLSPMAAIMGGVAAQEVLKAISRKFMPLDQWLYFDALECLPEDETLL
FT                   PSPEDCQPRNCRYDGQIAVFGTDLQEKLSDQHYLLVGAGAIGCEMLKVFALVGLGVRAN
FT                   GGVTVADMDYIERSNLSRQFLFRPKDVRRPKAEVAAAAAHRLNPDLRATPYTCPLDPTT
FT                   EDIYDDSFFSRVNGVVAALDSFQARHYVAARCTHYLKPLLEAGTQGTWGSASVFVPYVT
FT                   EAYRGPASDAASEDAPYPVCTLRHIPSSMEHSVQWAQDQFEGLFRLSTETINCYQQTCT
FT                   SLSATDRTETLALLQQVMGVLRTRPQTWQDCVVWALGHWQLCFHDKVLEGGTQFSSGSN
FT                   KCPHPLQFDPNHDMHFLYVLAAANLYARMHGLPGSQSQPALRELLTRLLESDSRPQNLF
FT                   SAEHGQEQLKELQETLDDWRKGPPLKPVLFVKDDDSNFHVDFVVAATDLRCQNYGILPV
FT                   NHARIKQIVGRIIPAIATSTAVVAGLLGLELYKVVSGLRSHGTFRHSYLHLAENHFIRS
FT                   APSAPAVQSFRDLKWTCWDRLKVPAVQPERTLKSLLAHLQEEHGLKVEMLLHHQALLYS
FT                   SGWSSEKQAQHLCLRVTELVQHVTGWKPKPGLKVLVFELSCEGEEEEMAFPPLHYEL"
FT   CDS             join(18750410..18750447,18750598..18750676,
FT                   18750757..18750912,18750987..18751152,18751231..18751436,
FT                   18751525..18751589,18751675..18751822,18751894..18751968,
FT                   18752160..18752313,18753006..18753088,18753333..18753425,
FT                   18753519..18753710,18755226..18755318,18755392..18755492,
FT                   18755946..18756075)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18845"
FT                   /product="mCG18845, isoform CRA_b"
FT                   /note="gene_id=mCG18845.3 transcript_id=mCT191515.1
FT                   protein_id=mCP112487.1 isoform=CRA_b"
FT                   /protein_id="EDL21242.1"
FT                   /translation="MRRSFPALRIVSQNCRYDGQIAVFGTDLQEKLSDQHYLLVGAGAI
FT                   GCEMLKVFALVGLGVRANGGVTVADMDYIERSNLSRQFLFRPKDVRRPKAEVAAAAAHR
FT                   LNPDLRATPYTCPLDPTTEDIYDDSFFSRVNGVVAALDSFQARHYVAARCTHYLKPLLE
FT                   AGTQGTWGSASVFVPYVTEAYRGPASDAASEDAPYPVCTLRHIPSSMEHSVQWAQDQFE
FT                   GLFRLSTETINCYQQTCTSLSATDRTETLALLQQVMGVLRTRPQTWQDCVVWALGHWQL
FT                   CFHDKVLEGGTQFSSGSNKCPHPLQFDPNHDMHFLYVLAAANLYARMHGLPGSQSQPAL
FT                   RELLTRLLESDSRPQNLFSAEHGQEQLKELQETLDDWRKGPPLKPVLFVKDDDSNFHVD
FT                   FVVAATDLRCQNYGILPVNHARIKQIVGRIIPAIATSTAVVAGLLGLELYKVVSGLRSH
FT                   GTFRHSYLHLAENHFIRSAPSAPAVQSFRDLKWTCWDRLKVPAVQPERTLKSLLAHLQE
FT                   EHGLKVEMLLHHQALLYSSGWSSEKQAQHLCLRVTELVQHVTGWKPKPGLKVLVFELSC
FT                   EGEEEEMAFPPLHYEL"
FT   gene            18755185..18767184
FT                   /locus_tag="mCG_145775"
FT                   /note="gene_id=mCG145775.0"
FT   mRNA            join(18755185..18755318,18755392..18755492,
FT                   18764483..18764582,18765023..18765207,18765310..18765638,
FT                   18766451..18767184)
FT                   /locus_tag="mCG_145775"
FT                   /product="mCG145775, transcript variant mCT191553"
FT                   /note="gene_id=mCG145775.0 transcript_id=mCT191553.1
FT                   created on 09-MAR-2004"
FT   mRNA            join(18755185..18755318,18755392..18755492,
FT                   18764483..18764582,18765023..18765207,18765310..18765472,
FT                   18765553..18765638,18766451..18767184)
FT                   /locus_tag="mCG_145775"
FT                   /product="mCG145775, transcript variant mCT185872"
FT                   /note="gene_id=mCG145775.0 transcript_id=mCT185872.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(18755185..18755318,18755392..18755492,
FT                   18764483..18764582,18765023..18765207,18765310..18765472,
FT                   18765553..18766218)
FT                   /locus_tag="mCG_145775"
FT                   /product="mCG145775, transcript variant mCT191552"
FT                   /note="gene_id=mCG145775.0 transcript_id=mCT191552.1
FT                   created on 09-MAR-2004"
FT   gene            complement(18756352..18758008)
FT                   /gene="6230427J02Rik"
FT                   /locus_tag="mCG_18877"
FT                   /note="gene_id=mCG18877.1"
FT   mRNA            complement(join(18756352..18757193,18757826..18758008))
FT                   /gene="6230427J02Rik"
FT                   /locus_tag="mCG_18877"
FT                   /product="RIKEN cDNA 6230427J02"
FT                   /note="gene_id=mCG18877.1 transcript_id=mCT16204.2 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(18756396..18757193,18757826..18757876))
FT                   /codon_start=1
FT                   /gene="6230427J02Rik"
FT                   /locus_tag="mCG_18877"
FT                   /product="RIKEN cDNA 6230427J02"
FT                   /note="gene_id=mCG18877.1 transcript_id=mCT16204.2
FT                   protein_id=mCP21248.2"
FT                   /protein_id="EDL21248.1"
FT                   /translation="MHSARLDSFLSQLRWELLCARDTGSPPMSGPLQPKPRTDQNVQPK
FT                   RQFRASDVLEEDSVCCVEEEEEEGLVAEDKGLPLGCPREHALDWDSGFSEVSGSTWREE
FT                   EPSVPQRQAPRERPPHSQRFSVSDIPMRSRAAVTNIPPAHRPRPKSTPDACLEHWQGLE
FT                   AEDWTAALLNRGRSRQPLVLGDNCFADLVHNWMELPEATSEGSDGDVPRARARPPQFLL
FT                   GLSEQLRRRLARARRTAMASKRLSCPPRSEPDLPADISRFAALMNCRSRQPIIYNDVSY
FT                   L"
FT   gene            18764673..18822354
FT                   /locus_tag="mCG_145714"
FT                   /note="gene_id=mCG145714.0"
FT   mRNA            join(18764673..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18765638,18766451..18766555,
FT                   18767154..18767257,18767427..18767563,18767760..18767943,
FT                   18768045..18768198,18768415..18768508,18768774..18768977,
FT                   18769058..18769197,18769430..18769580,18769666..18769886,
FT                   18770097..18770239,18771174..18771204,18797737..18798084,
FT                   18805593..18805803,18814502..18814683,18818304..18818479,
FT                   18819041..18822354)
FT                   /locus_tag="mCG_145714"
FT                   /product="mCG145714"
FT                   /note="gene_id=mCG145714.0 transcript_id=mCT185281.0
FT                   created on 09-MAR-2004"
FT   gene            18764673..18771856
FT                   /locus_tag="mCG_18846"
FT                   /note="gene_id=mCG18846.3"
FT   mRNA            join(18764673..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18765638,18766451..18766555,
FT                   18767154..18767257,18767427..18767563,18767760..18767943,
FT                   18768045..18768198,18768415..18768508,18768774..18768977,
FT                   18769058..18769197,18769430..18769580,18769666..18769886,
FT                   18770097..18770239,18770690..18770746,18770879..18770942,
FT                   18771174..18771204,18771707..18771856)
FT                   /locus_tag="mCG_18846"
FT                   /product="mCG18846, transcript variant mCT185282"
FT                   /note="gene_id=mCG18846.3 transcript_id=mCT185282.0 created
FT                   on 18-JUN-2003"
FT   mRNA            join(18764673..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18765638,18766451..18766555,
FT                   18767154..18767257,18767427..18767563,18767760..18767943,
FT                   18768045..18768198,18768415..18768508,18768774..18768977,
FT                   18769058..18769197,18769430..18769580,18769666..18769886,
FT                   18770097..18770239,18770879..18770942,18771174..18771204,
FT                   18771707..18771856)
FT                   /locus_tag="mCG_18846"
FT                   /product="mCG18846, transcript variant mCT185283"
FT                   /note="gene_id=mCG18846.3 transcript_id=mCT185283.0 created
FT                   on 18-JUN-2003"
FT   mRNA            join(18764673..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18765638,18766451..18766555,
FT                   18767154..18767257,18767427..18767563,18767760..18767943,
FT                   18768045..18768198,18768415..18768508,18768774..18768977,
FT                   18769058..18769197,18769430..18769580,18769666..18769886,
FT                   18770097..18770239,18771174..18771204,18771707..18771856)
FT                   /locus_tag="mCG_18846"
FT                   /product="mCG18846, transcript variant mCT185279"
FT                   /note="gene_id=mCG18846.3 transcript_id=mCT185279.0 created
FT                   on 18-JUN-2003"
FT   mRNA            join(18764673..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18765638,18766451..18766555,
FT                   18767154..18767257,18767427..18767563,18767760..18767943,
FT                   18768045..18768198,18768415..18768508,18768774..18768977,
FT                   18769058..18769334)
FT                   /locus_tag="mCG_18846"
FT                   /product="mCG18846, transcript variant mCT170769"
FT                   /note="gene_id=mCG18846.3 transcript_id=mCT170769.1 created
FT                   on 18-JUN-2003"
FT   mRNA            join(18764673..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18765638,18766451..18767184)
FT                   /locus_tag="mCG_18846"
FT                   /product="mCG18846, transcript variant mCT185280"
FT                   /note="gene_id=mCG18846.3 transcript_id=mCT185280.0 created
FT                   on 18-JUN-2003"
FT   mRNA            join(18764673..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18766218)
FT                   /locus_tag="mCG_18846"
FT                   /product="mCG18846, transcript variant mCT15936"
FT                   /note="gene_id=mCG18846.3 transcript_id=mCT15936.3 created
FT                   on 18-JUN-2003"
FT   CDS             join(18764702..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18765638,18766451..18766555,
FT                   18767154..18767257,18767427..18767563,18767760..18767943,
FT                   18768045..18768198,18768415..18768508,18768774..18768977,
FT                   18769058..18769197,18769430..18769580,18769666..18769886,
FT                   18770097..18770239,18771174..18771204,18797737..18797754)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145714"
FT                   /product="mCG145714"
FT                   /note="gene_id=mCG145714.0 transcript_id=mCT185281.0
FT                   protein_id=mCP106540.0"
FT                   /protein_id="EDL21249.1"
FT                   /translation="MALLRLLEFLFALLIPVLYSLPWTMYISENNGPGTVLRPFSFNCS
FT                   SYMPTLELLSVRPPTSFFNKPSMHGDKGVYLVMVSLSSSARLDALAVNQYELQLQYRCG
FT                   NFVVDGSIFVHVQRDPGRIRCTGAFASPAGEFIYVPETITPGALVYTLLLPGVQRAQIN
FT                   ITSAQNPSPGPFSIDEQGLLRAPSQGLRGQAQKTFQLQISVSFEKNQSCRGMLTVKVLP
FT                   APSSQVSFLQKAQSITISEDLVPGSEVVRVQATGFNLLYEIISPRPSLFYSIGQADGVV
FT                   RTTAPLDLARVQGAMVTKLQVRAFERPRPWASAVFDLTVSVRAVNQWPPRCHPALLVTQ
FT                   IPETSLVGTVLDALTCVDPDSAGRPLDYQLRFHSPPDSASLRLRDRILEVNATLDCDTP
FT                   GACFQHSASILVVDGGQPQMTTEIPVLVMVTPVNEFSPACVPRTFRVQEDTGPHTLLGS
FT                   IVGTDMDYPRNSLEYYISGGPSTFAVDRLSGELHLLGPLDYEQQRLYKITILLIDHSQD
FT                   WDLNSHRSGSCTITIEVEDVNDHAPECEPPFQELTIYTPMGHSMEVTKVSCWIPQEPQR
FT                   LTLSYSIVGGNSQSRFRLQGAILVYNDTVLGPPWPEQPCTYELLIHVADVGPSIPHLST
FT                   TTTIIVHLVPWKASTVATSTHQSTVSSTMTPLIVTELEAFWKPEPWFVVVLTATGAVLL
FT                   LALGWLLSRILRGNILMAEPKMSDRTVN"
FT   CDS             join(18764702..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18765638,18766451..18766555,
FT                   18767154..18767257,18767427..18767563,18767760..18767943,
FT                   18768045..18768198,18768415..18768508,18768774..18768977,
FT                   18769058..18769197,18769430..18769580,18769666..18769886,
FT                   18770097..18770239,18771174..18771204,18771707..18771772)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18846"
FT                   /product="mCG18846, isoform CRA_c"
FT                   /note="gene_id=mCG18846.3 transcript_id=mCT185279.0
FT                   protein_id=mCP106541.0 isoform=CRA_c"
FT                   /protein_id="EDL21252.1"
FT                   /translation="MALLRLLEFLFALLIPVLYSLPWTMYISENNGPGTVLRPFSFNCS
FT                   SYMPTLELLSVRPPTSFFNKPSMHGDKGVYLVMVSLSSSARLDALAVNQYELQLQYRCG
FT                   NFVVDGSIFVHVQRDPGRIRCTGAFASPAGEFIYVPETITPGALVYTLLLPGVQRAQIN
FT                   ITSAQNPSPGPFSIDEQGLLRAPSQGLRGQAQKTFQLQISVSFEKNQSCRGMLTVKVLP
FT                   APSSQVSFLQKAQSITISEDLVPGSEVVRVQATGFNLLYEIISPRPSLFYSIGQADGVV
FT                   RTTAPLDLARVQGAMVTKLQVRAFERPRPWASAVFDLTVSVRAVNQWPPRCHPALLVTQ
FT                   IPETSLVGTVLDALTCVDPDSAGRPLDYQLRFHSPPDSASLRLRDRILEVNATLDCDTP
FT                   GACFQHSASILVVDGGQPQMTTEIPVLVMVTPVNEFSPACVPRTFRVQEDTGPHTLLGS
FT                   IVGTDMDYPRNSLEYYISGGPSTFAVDRLSGELHLLGPLDYEQQRLYKITILLIDHSQD
FT                   WDLNSHRSGSCTITIEVEDVNDHAPECEPPFQELTIYTPMGHSMEVTKVSCWIPQEPQR
FT                   LTLSYSIVGGNSQSRFRLQGAILVYNDTVLGPPWPEQPCTYELLIHVADVGPSIPHLST
FT                   TTTIIVHLVPWKASTVATSTHQSTVSSTMTPLIVTELEAFWKPEPWFVVVLTATGAVLL
FT                   LALGWLLSRILRGNILMAEPKMSVWGEITCSTHSREPGVGCEAE"
FT   CDS             join(18764702..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18765638,18766451..18766555,
FT                   18767154..18767257,18767427..18767563,18767760..18767943,
FT                   18768045..18768198,18768415..18768508,18768774..18768977,
FT                   18769058..18769197,18769430..18769580,18769666..18769886,
FT                   18770097..18770239,18770690..18770746,18770879..18770942,
FT                   18771174..18771204,18771707..18771762)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18846"
FT                   /product="mCG18846, isoform CRA_e"
FT                   /note="gene_id=mCG18846.3 transcript_id=mCT185282.0
FT                   protein_id=mCP106539.0 isoform=CRA_e"
FT                   /protein_id="EDL21254.1"
FT                   /translation="MALLRLLEFLFALLIPVLYSLPWTMYISENNGPGTVLRPFSFNCS
FT                   SYMPTLELLSVRPPTSFFNKPSMHGDKGVYLVMVSLSSSARLDALAVNQYELQLQYRCG
FT                   NFVVDGSIFVHVQRDPGRIRCTGAFASPAGEFIYVPETITPGALVYTLLLPGVQRAQIN
FT                   ITSAQNPSPGPFSIDEQGLLRAPSQGLRGQAQKTFQLQISVSFEKNQSCRGMLTVKVLP
FT                   APSSQVSFLQKAQSITISEDLVPGSEVVRVQATGFNLLYEIISPRPSLFYSIGQADGVV
FT                   RTTAPLDLARVQGAMVTKLQVRAFERPRPWASAVFDLTVSVRAVNQWPPRCHPALLVTQ
FT                   IPETSLVGTVLDALTCVDPDSAGRPLDYQLRFHSPPDSASLRLRDRILEVNATLDCDTP
FT                   GACFQHSASILVVDGGQPQMTTEIPVLVMVTPVNEFSPACVPRTFRVQEDTGPHTLLGS
FT                   IVGTDMDYPRNSLEYYISGGPSTFAVDRLSGELHLLGPLDYEQQRLYKITILLIDHSQD
FT                   WDLNSHRSGSCTITIEVEDVNDHAPECEPPFQELTIYTPMGHSMEVTKVSCWIPQEPQR
FT                   LTLSYSIVGGNSQSRFRLQGAILVYNDTVLGPPWPEQPCTYELLIHVADVGPSIPHLST
FT                   TTTIIVHLVPWKASTVATSTHQSTVSSTMTPLIVTELEAFWKPEPWFVVVLTATGAVLL
FT                   LALGWLLSRILRGLAPSLQAPSKPAKAQLLNSIQGNEGPIERQMEAPRIEMSQQHFDGR
FT                   AQDVCMGRDYLFNTLTGARRWL"
FT   CDS             join(18764702..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18765638,18766451..18766555,
FT                   18767154..18767257,18767427..18767563,18767760..18767943,
FT                   18768045..18768198,18768415..18768508,18768774..18768977,
FT                   18769058..18769197,18769430..18769580,18769666..18769886,
FT                   18770097..18770239,18770879..18770942,18771174..18771204,
FT                   18771707..18771762)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18846"
FT                   /product="mCG18846, isoform CRA_f"
FT                   /note="gene_id=mCG18846.3 transcript_id=mCT185283.0
FT                   protein_id=mCP106538.0 isoform=CRA_f"
FT                   /protein_id="EDL21255.1"
FT                   /translation="MALLRLLEFLFALLIPVLYSLPWTMYISENNGPGTVLRPFSFNCS
FT                   SYMPTLELLSVRPPTSFFNKPSMHGDKGVYLVMVSLSSSARLDALAVNQYELQLQYRCG
FT                   NFVVDGSIFVHVQRDPGRIRCTGAFASPAGEFIYVPETITPGALVYTLLLPGVQRAQIN
FT                   ITSAQNPSPGPFSIDEQGLLRAPSQGLRGQAQKTFQLQISVSFEKNQSCRGMLTVKVLP
FT                   APSSQVSFLQKAQSITISEDLVPGSEVVRVQATGFNLLYEIISPRPSLFYSIGQADGVV
FT                   RTTAPLDLARVQGAMVTKLQVRAFERPRPWASAVFDLTVSVRAVNQWPPRCHPALLVTQ
FT                   IPETSLVGTVLDALTCVDPDSAGRPLDYQLRFHSPPDSASLRLRDRILEVNATLDCDTP
FT                   GACFQHSASILVVDGGQPQMTTEIPVLVMVTPVNEFSPACVPRTFRVQEDTGPHTLLGS
FT                   IVGTDMDYPRNSLEYYISGGPSTFAVDRLSGELHLLGPLDYEQQRLYKITILLIDHSQD
FT                   WDLNSHRSGSCTITIEVEDVNDHAPECEPPFQELTIYTPMGHSMEVTKVSCWIPQEPQR
FT                   LTLSYSIVGGNSQSRFRLQGAILVYNDTVLGPPWPEQPCTYELLIHVADVGPSIPHLST
FT                   TTTIIVHLVPWKASTVATSTHQSTVSSTMTPLIVTELEAFWKPEPWFVVVLTATGAVLL
FT                   LALGWLLSRILRGIQGNEGPIERQMEAPRIEMSQQHFDGRAQDVCMGRDYLFNTLTGAR
FT                   RWL"
FT   CDS             join(18764702..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18765638,18766451..18766555,
FT                   18767154..18767257,18767427..18767563,18767760..18767943,
FT                   18768045..18768198,18768415..18768508,18768774..18768977,
FT                   18769058..18769290)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18846"
FT                   /product="mCG18846, isoform CRA_b"
FT                   /note="gene_id=mCG18846.3 transcript_id=mCT170769.1
FT                   protein_id=mCP93687.1 isoform=CRA_b"
FT                   /protein_id="EDL21251.1"
FT                   /translation="MALLRLLEFLFALLIPVLYSLPWTMYISENNGPGTVLRPFSFNCS
FT                   SYMPTLELLSVRPPTSFFNKPSMHGDKGVYLVMVSLSSSARLDALAVNQYELQLQYRCG
FT                   NFVVDGSIFVHVQRDPGRIRCTGAFASPAGEFIYVPETITPGALVYTLLLPGVQRAQIN
FT                   ITSAQNPSPGPFSIDEQGLLRAPSQGLRGQAQKTFQLQISVSFEKNQSCRGMLTVKVLP
FT                   APSSQVSFLQKAQSITISEDLVPGSEVVRVQATGFNLLYEIISPRPSLFYSIGQADGVV
FT                   RTTAPLDLARVQGAMVTKLQVRAFERPRPWASAVFDLTVSVRAVNQWPPRCHPALLVTQ
FT                   IPETSLVGTVLDALTCVDPDSAGRPLDYQLRFHSPPDSASLRLRDRILEVNATLDCDTP
FT                   GACFQHSASILVVDGGQPQMTTEIPVLVMVTPVNEFSPACVPRTFRVQEDTGPHTLLGS
FT                   IVGTDMDYPRNSLEYYISGGPSTFAVDRLSGELHLLGPLDYEQQRLYKITILLIDHSQD
FT                   WDLNSHRSGSCTITIEVEVNDLHGLGKTNFPLAICFFLQKPQFLLGAG"
FT   CDS             join(18764702..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18765638,18766451..18766645)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18846"
FT                   /product="mCG18846, isoform CRA_d"
FT                   /note="gene_id=mCG18846.3 transcript_id=mCT185280.0
FT                   protein_id=mCP106537.0 isoform=CRA_d"
FT                   /protein_id="EDL21253.1"
FT                   /translation="MALLRLLEFLFALLIPVLYSLPWTMYISENNGPGTVLRPFSFNCS
FT                   SYMPTLELLSVRPPTSFFNKPSMHGDKGVYLVMVSLSSSARLDALAVNQYELQLQYRCG
FT                   NFVVDGSIFVHVQRDPGRIRCTGAFASPAGEFIYVPETITPGALVYTLLLPGVQRAQIN
FT                   ITSAQNPSPGPFSIDEQGLLRAPSQGLRGQAQKVNVALDLGMSMDWVEAASCEKLFVFD
FT                   YLD"
FT   CDS             join(18764702..18764750,18765023..18765207,
FT                   18765310..18765472,18765553..18765677)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18846"
FT                   /product="mCG18846, isoform CRA_a"
FT                   /note="gene_id=mCG18846.3 transcript_id=mCT15936.3
FT                   protein_id=mCP21377.2 isoform=CRA_a"
FT                   /protein_id="EDL21250.1"
FT                   /translation="MALLRLLEFLFALLIPVLYSLPWTMYISENNGPGTVLRPFSFNCS
FT                   SYMPTLELLSVRPPTSFFNKPSMHGDKGVYLVMVSLSSSARLDALAVNQYELQLQYRCG
FT                   NFVVDGSIFVHVQRDPGRIRCTGAFASPAGEFIYVPETITPGALVYTLLLPGVQRAQVS
FT                   SGHGAVSDRM"
FT   CDS             join(18765046..18765207,18765310..18765472,
FT                   18765553..18765638,18766451..18766645)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145775"
FT                   /product="mCG145775, isoform CRA_a"
FT                   /note="gene_id=mCG145775.0 transcript_id=mCT185872.0
FT                   protein_id=mCP107130.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q14BY6"
FT                   /db_xref="MGI:MGI:1916648"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BY6"
FT                   /protein_id="EDL21245.1"
FT                   /translation="MYISENNGPGTVLRPFSFNCSSYMPTLELLSVRPPTSFFNKPSMH
FT                   GDKGVYLVMVSLSSSARLDALAVNQYELQLQYRCGNFVVDGSIFVHVQRDPGRIRCTGA
FT                   FASPAGEFIYVPETITPGALVYTLLLPGVQRAQINITSAQNPSPGPFSIDEQGLLRAPS
FT                   QGLRGQAQKVNVALDLGMSMDWVEAASCEKLFVFDYLD"
FT   CDS             join(18765046..18765207,18765310..18765472,
FT                   18765553..18765677)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145775"
FT                   /product="mCG145775, isoform CRA_b"
FT                   /note="gene_id=mCG145775.0 transcript_id=mCT191552.1
FT                   protein_id=mCP112471.1 isoform=CRA_b"
FT                   /protein_id="EDL21246.1"
FT                   /translation="MYISENNGPGTVLRPFSFNCSSYMPTLELLSVRPPTSFFNKPSMH
FT                   GDKGVYLVMVSLSSSARLDALAVNQYELQLQYRCGNFVVDGSIFVHVQRDPGRIRCTGA
FT                   FASPAGEFIYVPETITPGALVYTLLLPGVQRAQVSSGHGAVSDRM"
FT   CDS             join(18765046..18765207,18765310..18765510)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145775"
FT                   /product="mCG145775, isoform CRA_c"
FT                   /note="gene_id=mCG145775.0 transcript_id=mCT191553.1
FT                   protein_id=mCP112472.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q8BLP7"
FT                   /db_xref="MGI:MGI:1916648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BLP7"
FT                   /protein_id="EDL21247.1"
FT                   /translation="MYISENNGPGTVLRPFSFNCSSYMPTLELLSVRPPTSFFNKPSMH
FT                   GDKGVYLVMVSLSSSARLDALAVNQYELQLQYRCGNFVVDGSIFVHVQRDPGRIRCTGA
FT                   FASPGEPRSSGLGEER"
FT   gene            complement(18770293..>18774608)
FT                   /locus_tag="mCG_145985"
FT                   /note="gene_id=mCG145985.0"
FT   mRNA            complement(join(18770293..18770524,18770801..18770898,
FT                   18771522..18771598,18774479..>18774608))
FT                   /locus_tag="mCG_145985"
FT                   /product="mCG145985"
FT                   /note="gene_id=mCG145985.0 transcript_id=mCT186093.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(18770296..>18770502)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145985"
FT                   /product="mCG145985"
FT                   /note="gene_id=mCG145985.0 transcript_id=mCT186093.0
FT                   protein_id=mCP107615.0"
FT                   /protein_id="EDL21256.1"
FT                   /translation="KTGVGNSGKCQTLSQPAMAIQFQDWTPPMMETTPSDPNLNTSGEI
FT                   VAAFLSLFPHLRWQCHPILSKTP"
FT   gene            18774979..18822354
FT                   /locus_tag="mCG_18852"
FT                   /note="gene_id=mCG18852.2"
FT   mRNA            join(18774979..18775025,18797737..18798084,
FT                   18805593..18805803,18814502..18814683,18818304..18818479,
FT                   18819041..18822354)
FT                   /locus_tag="mCG_18852"
FT                   /product="mCG18852"
FT                   /note="gene_id=mCG18852.2 transcript_id=mCT15942.1 created
FT                   on 17-JUL-2002"
FT   gene            18783187..19123664
FT                   /locus_tag="mCG_1051018"
FT                   /note="gene_id=mCG1051018.0"
FT   mRNA            join(18783187..18783904,18789695..18790212,
FT                   19123629..19123664)
FT                   /locus_tag="mCG_1051018"
FT                   /product="mCG1051018"
FT                   /note="gene_id=mCG1051018.0 transcript_id=mCT194807.0
FT                   created on 27-JAN-2005"
FT   CDS             18783229..18783420
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051018"
FT                   /product="mCG1051018"
FT                   /note="gene_id=mCG1051018.0 transcript_id=mCT194807.0
FT                   protein_id=mCP115836.0"
FT                   /protein_id="EDL21258.1"
FT                   /translation="MLFLNRIQSRQFYRGSKTCDFLGLPRVLGYEVTRACLLFLFEISK
FT                   CVKVVVTVACFLDCTKNQ"
FT   CDS             join(18797862..18798084,18805593..18805803,
FT                   18814502..18814683,18818304..18818479,18819041..18819550)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18852"
FT                   /product="mCG18852"
FT                   /note="gene_id=mCG18852.2 transcript_id=mCT15942.1
FT                   protein_id=mCP21314.0"
FT                   /protein_id="EDL21257.1"
FT                   /translation="MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDH
FT                   TVCKPLISREQRFYESLPPEMKEFTPEYKGVVSVCFEGDSDGYINLVAYPYVESETVEQ
FT                   DDTPEREQPRRKHSRRSLHRSGSGSDHKEEKASLSFETSESSQEAKSPKVELHSHSDVP
FT                   FQMLDSNSGLSSEKISYNPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKYPCV
FT                   LDLKMGTRQHGDDASAEKAARQMRKCEQSTSATLGVRVCGMQVYQLDTGHYLCRNKYYG
FT                   RGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYD
FT                   GKECRSELRLKHVDMGLPEVPPPCGPSTSPSSTSLEAGPSSPPKVDVRMIDFAHSTFKG
FT                   FRDDPTVHDGPDRGYVFGLENLISIMEQMRDENQ"
FT   gene            18822864..18825269
FT                   /gene="Gmppb"
FT                   /locus_tag="mCG_18847"
FT                   /note="gene_id=mCG18847.3"
FT   mRNA            join(18822864..18823219,18823335..18823415,
FT                   18823503..18823551,18823689..18823831,18824025..18824183,
FT                   18824268..18824346,18824423..18824550,18824634..18824816,
FT                   18824900..18825269)
FT                   /gene="Gmppb"
FT                   /locus_tag="mCG_18847"
FT                   /product="GDP-mannose pyrophosphorylase B, transcript
FT                   variant mCT15939"
FT                   /note="gene_id=mCG18847.3 transcript_id=mCT15939.3 created
FT                   on 09-MAR-2004"
FT   mRNA            join(18822896..18822994,18823086..18823219,
FT                   18823335..18823415,18823503..18823551,18823689..18823831,
FT                   18824025..18824183,18824268..18824346,18824423..18824550,
FT                   18824634..18824816,18824900..18825269)
FT                   /gene="Gmppb"
FT                   /locus_tag="mCG_18847"
FT                   /product="GDP-mannose pyrophosphorylase B, transcript
FT                   variant mCT191520"
FT                   /note="gene_id=mCG18847.3 transcript_id=mCT191520.1 created
FT                   on 09-MAR-2004"
FT   CDS             join(18823091..18823219,18823335..18823415,
FT                   18823503..18823551,18823689..18823831,18824025..18824183,
FT                   18824268..18824346,18824423..18824550,18824634..18824816,
FT                   18824900..18825031)
FT                   /codon_start=1
FT                   /gene="Gmppb"
FT                   /locus_tag="mCG_18847"
FT                   /product="GDP-mannose pyrophosphorylase B, isoform CRA_a"
FT                   /note="gene_id=mCG18847.3 transcript_id=mCT15939.3
FT                   protein_id=mCP21397.3 isoform=CRA_a"
FT                   /protein_id="EDL21259.1"
FT                   /translation="MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAG
FT                   VDHVILAVSYMSQMLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADPF
FT                   FVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKP
FT                   QVFVSNKINAGMYILSPAVLQRIQLKPTSIEKEIFPVMAKEGQLYAMELQGFWMDIGQP
FT                   KDFLTGMCLFLQSLRQKHPERLYSGPGIVGNVLVDPSARIGQNCSIGPNVSLGPGVVVE
FT                   DGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNG
FT                   ASVLPHKSIGESVPEPRIIM"
FT   CDS             join(18823091..18823219,18823335..18823415,
FT                   18823503..18823551,18823689..18823831,18824025..18824183,
FT                   18824268..18824346,18824423..18824550,18824634..18824816,
FT                   18824900..18825031)
FT                   /codon_start=1
FT                   /gene="Gmppb"
FT                   /locus_tag="mCG_18847"
FT                   /product="GDP-mannose pyrophosphorylase B, isoform CRA_a"
FT                   /note="gene_id=mCG18847.3 transcript_id=mCT191520.1
FT                   protein_id=mCP112489.1 isoform=CRA_a"
FT                   /protein_id="EDL21260.1"
FT                   /translation="MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAG
FT                   VDHVILAVSYMSQMLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADPF
FT                   FVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKP
FT                   QVFVSNKINAGMYILSPAVLQRIQLKPTSIEKEIFPVMAKEGQLYAMELQGFWMDIGQP
FT                   KDFLTGMCLFLQSLRQKHPERLYSGPGIVGNVLVDPSARIGQNCSIGPNVSLGPGVVVE
FT                   DGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNG
FT                   ASVLPHKSIGESVPEPRIIM"
FT   gene            complement(18825108..18856834)
FT                   /gene="Rnf123"
FT                   /locus_tag="mCG_18867"
FT                   /note="gene_id=mCG18867.3"
FT   mRNA            complement(join(18825108..18825528,18825603..18825688,
FT                   18825782..18825876,18826013..18826155,18829605..18829689,
FT                   18829925..18830000,18830089..18830277,18830384..18830523,
FT                   18831731..18831815,18831904..18831991,18832077..18832164,
FT                   18832351..18832425,18833241..18833418,18835333..18835440,
FT                   18836141..18836224,18836450..18836595,18837062..18837260,
FT                   18837500..18837606,18839266..18839367,18839865..18839985,
FT                   18840203..18840274,18840435..18840496,18840675..18840774,
FT                   18840976..18841093,18841702..18841775,18841847..18841939,
FT                   18842056..18842181,18842571..18842675,18842752..18842872,
FT                   18843259..18843381,18843528..18843595,18843797..18843883,
FT                   18844126..18844211,18844307..18844361,18844732..18844826,
FT                   18844959..18845038,18850836..18850920,18851209..18851384,
FT                   18856753..18856834))
FT                   /gene="Rnf123"
FT                   /locus_tag="mCG_18867"
FT                   /product="ring finger protein 123, transcript variant
FT                   mCT191530"
FT                   /note="gene_id=mCG18867.3 transcript_id=mCT191530.1 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(18825108..18825528,18825603..18825688,
FT                   18825782..18825876,18826013..18826155,18829605..18829689,
FT                   18829925..18830000,18830089..18830277,18830384..18830523,
FT                   18831731..18831815,18831904..18831991,18832077..18832164,
FT                   18832351..18832425,18833241..18833418,18835333..18835440,
FT                   18836141..18836224,18836450..18836595,18837062..18837260,
FT                   18837500..18837606,18839266..18839367,18839865..18839985,
FT                   18840203..18840274,18840435..18840496,18840675..18840774,
FT                   18840976..18841093,18841702..18841775,18841847..18841939,
FT                   18842056..18842181,18842571..18842675,18842752..18842872,
FT                   18843259..18843381,18843528..18843595,18843797..18843883,
FT                   18844126..18844211,18844307..18844361,18844732..18844826,
FT                   18844959..18845038,18850836..18850920,18851209..18851384,
FT                   18853177..18853224))
FT                   /gene="Rnf123"
FT                   /locus_tag="mCG_18867"
FT                   /product="ring finger protein 123, transcript variant
FT                   mCT16182"
FT                   /note="gene_id=mCG18867.3 transcript_id=mCT16182.3 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(18825108..18825528,18825603..18825688,
FT                   18825782..18825876,18826013..18826155,18829605..18829689,
FT                   18829925..18830000,18830089..18830277,18830384..18830523,
FT                   18831731..18831815,18831904..18831991,18832077..18832164,
FT                   18832351..18832425,18833241..18833418,18835333..18835440,
FT                   18836141..18836224,18836450..18836595,18837062..18837260,
FT                   18837500..18837606,18839266..18839367,18839865..18839985,
FT                   18840203..18840274,18840435..18840496,18840675..18840774,
FT                   18840976..18841093,18841702..18841775,18841847..18841939,
FT                   18842056..18842181,18842571..18842675,18842752..18842872,
FT                   18843259..18843381,18843528..18843595,18843797..18843883,
FT                   18844126..18844211,18844307..18844361,18844732..18844826,
FT                   18844959..18845038,18850836..18850920,18851209..18851384,
FT                   18852756..18852850))
FT                   /gene="Rnf123"
FT                   /locus_tag="mCG_18867"
FT                   /product="ring finger protein 123, transcript variant
FT                   mCT16195"
FT                   /note="gene_id=mCG18867.3 transcript_id=mCT16195.3 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(18825108..18825528,18825603..18825688,
FT                   18825782..18825876,18826013..18826155,18829605..18829689,
FT                   18829925..18830000,18830089..18830277,18830384..18830523,
FT                   18831731..18831815,18831904..18831991,18832077..18832164,
FT                   18832351..18832425,18833241..18833418,18835333..18835440,
FT                   18836141..18836224,18836450..18836595,18837062..18837260,
FT                   18837482..18837606,18839266..18839367,18839865..18839985,
FT                   18840203..18840274,18840435..18840496,18840675..18840774,
FT                   18840976..18841093,18841702..18841775,18841847..18841939,
FT                   18842056..18842181,18842571..18842675,18842752..18842872,
FT                   18843259..18843381,18843528..18843595,18843797..18843883,
FT                   18844126..18844211,18844307..18844361,18844732..18844826,
FT                   18844959..18845038,18850836..18850920,18851209..18851384,
FT                   18852287..18852788))
FT                   /gene="Rnf123"
FT                   /locus_tag="mCG_18867"
FT                   /product="ring finger protein 123, transcript variant
FT                   mCT191531"
FT                   /note="gene_id=mCG18867.3 transcript_id=mCT191531.1 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(18825408..18825528,18825603..18825688,
FT                   18825782..18825876,18826013..18826155,18829605..18829689,
FT                   18829925..18830000,18830089..18830277,18830384..18830523,
FT                   18831731..18831815,18831904..18831991,18832077..18832164,
FT                   18832351..18832425,18833241..18833418,18835333..18835440,
FT                   18836141..18836224,18836450..18836595,18837062..18837260,
FT                   18837500..18837606,18839266..18839367,18839865..18839985,
FT                   18840203..18840274,18840435..18840496,18840675..18840774,
FT                   18840976..18841093,18841702..18841775,18841847..18841939,
FT                   18842056..18842181,18842571..18842675,18842752..18842872,
FT                   18843259..18843381,18843528..18843595,18843797..18843883,
FT                   18844126..18844211,18844307..18844361,18844732..18844826,
FT                   18844959..18845038,18850836..18850920,18851209..18851290))
FT                   /codon_start=1
FT                   /gene="Rnf123"
FT                   /locus_tag="mCG_18867"
FT                   /product="ring finger protein 123, isoform CRA_a"
FT                   /note="gene_id=mCG18867.3 transcript_id=mCT16182.3
FT                   protein_id=mCP21386.3 isoform=CRA_a"
FT                   /protein_id="EDL21261.1"
FT                   /translation="MASKGTGMSFSRKSYRLTSDAEKSRVTGIVQEKLLSDYLYRIFSP
FT                   PDRGPAAATSRKPLNFHNLPEHVDQLLQVDSEDNESQGQVEGRLGPSTVVLDHTGGFEG
FT                   LLLVDDDLLGVIGHSNFGTIRSTTCVYKGKWVYEVLISSQGLMQIGWCTINCRFNQEEG
FT                   VGDTHNSYAYDGNRVRKWNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAF
FT                   ENLSRGLGMAYFPAISLSFKESVAFNFGSRPFGTYPVAGFRPLQDPPFADLVRAQRLLG
FT                   CFQAVLSVELDPVEGRLVETESSEWQLQGQPTVLLTLAHIFHHFAPLLRKVYLVEAVLM
FT                   SFLLGVVEKGTPEQAQSVVHQILDLLWLFMEDYEVQDCLKQLMMSLLRLYRFSPIVPDL
FT                   GLQIHYLRLTMSILRHEKSRKFLLSNVLFDMLRSVVFFYIKSPLRVEEAGLKELIPTTW
FT                   WPHRSSRESRDGKEAREETTEERQRRRAYERGCQRLKKRIEVVEELQVQILKLLLDNKD
FT                   DNGGEASRYIFLTKFRKFLQENASGRGNTPVLCPPEYMVCFLHRLVSALRFYWDEYKAS
FT                   NPRASFSEEAYIPPQIFYNGKVDYFDLQRLGGLLSHLRKTLKDDLASKANIVIDPLELQ
FT                   AATMDDLDEDEEPAPSAAQRPMQALAIGGALPLPRPGWLSSPTLGRANRFLSTAAVSLM
FT                   TPRRLLSTMEKVKVRSLNVEQRTREDIEGSHWNEGLLLGRPPEEPEQPLTENSLLEVLD
FT                   GTVMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVF
FT                   SEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVA
FT                   INSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADPRIVGTDIRDSLMQALASY
FT                   VCYPHSLRAVERIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPH
FT                   LLKTKPEDANLPSLQKPCPSTLLQQHMADLLRQGSDVAPSFLNSVLNQLNWAFSEFIGM
FT                   IQEIQQAAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWSRPTSEM
FT                   LLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRLLVHGPT
FT                   SETEQATSVLLADPCFQLRSICYLLGQPEPLAPGTTLPAPDRKRFSLQSYTDYISAEEL
FT                   AQVEQMLAHLTAASAQAAAASLPTNEEDLCPICYAHPISAVFQPCGHKSCKACINQHLM
FT                   NNKDCFFCKATIVSVEDWDKAANTSAMSSAA"
FT   CDS             complement(join(18825408..18825528,18825603..18825688,
FT                   18825782..18825876,18826013..18826155,18829605..18829689,
FT                   18829925..18830000,18830089..18830277,18830384..18830523,
FT                   18831731..18831815,18831904..18831991,18832077..18832164,
FT                   18832351..18832425,18833241..18833418,18835333..18835440,
FT                   18836141..18836224,18836450..18836595,18837062..18837260,
FT                   18837500..18837606,18839266..18839367,18839865..18839985,
FT                   18840203..18840274,18840435..18840496,18840675..18840774,
FT                   18840976..18841093,18841702..18841775,18841847..18841939,
FT                   18842056..18842181,18842571..18842675,18842752..18842872,
FT                   18843259..18843381,18843528..18843595,18843797..18843883,
FT                   18844126..18844211,18844307..18844361,18844732..18844826,
FT                   18844959..18845038,18850836..18850920,18851209..18851290))
FT                   /codon_start=1
FT                   /gene="Rnf123"
FT                   /locus_tag="mCG_18867"
FT                   /product="ring finger protein 123, isoform CRA_a"
FT                   /note="gene_id=mCG18867.3 transcript_id=mCT16195.3
FT                   protein_id=mCP21370.3 isoform=CRA_a"
FT                   /protein_id="EDL21262.1"
FT                   /translation="MASKGTGMSFSRKSYRLTSDAEKSRVTGIVQEKLLSDYLYRIFSP
FT                   PDRGPAAATSRKPLNFHNLPEHVDQLLQVDSEDNESQGQVEGRLGPSTVVLDHTGGFEG
FT                   LLLVDDDLLGVIGHSNFGTIRSTTCVYKGKWVYEVLISSQGLMQIGWCTINCRFNQEEG
FT                   VGDTHNSYAYDGNRVRKWNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAF
FT                   ENLSRGLGMAYFPAISLSFKESVAFNFGSRPFGTYPVAGFRPLQDPPFADLVRAQRLLG
FT                   CFQAVLSVELDPVEGRLVETESSEWQLQGQPTVLLTLAHIFHHFAPLLRKVYLVEAVLM
FT                   SFLLGVVEKGTPEQAQSVVHQILDLLWLFMEDYEVQDCLKQLMMSLLRLYRFSPIVPDL
FT                   GLQIHYLRLTMSILRHEKSRKFLLSNVLFDMLRSVVFFYIKSPLRVEEAGLKELIPTTW
FT                   WPHRSSRESRDGKEAREETTEERQRRRAYERGCQRLKKRIEVVEELQVQILKLLLDNKD
FT                   DNGGEASRYIFLTKFRKFLQENASGRGNTPVLCPPEYMVCFLHRLVSALRFYWDEYKAS
FT                   NPRASFSEEAYIPPQIFYNGKVDYFDLQRLGGLLSHLRKTLKDDLASKANIVIDPLELQ
FT                   AATMDDLDEDEEPAPSAAQRPMQALAIGGALPLPRPGWLSSPTLGRANRFLSTAAVSLM
FT                   TPRRLLSTMEKVKVRSLNVEQRTREDIEGSHWNEGLLLGRPPEEPEQPLTENSLLEVLD
FT                   GTVMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVF
FT                   SEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVA
FT                   INSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADPRIVGTDIRDSLMQALASY
FT                   VCYPHSLRAVERIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPH
FT                   LLKTKPEDANLPSLQKPCPSTLLQQHMADLLRQGSDVAPSFLNSVLNQLNWAFSEFIGM
FT                   IQEIQQAAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWSRPTSEM
FT                   LLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRLLVHGPT
FT                   SETEQATSVLLADPCFQLRSICYLLGQPEPLAPGTTLPAPDRKRFSLQSYTDYISAEEL
FT                   AQVEQMLAHLTAASAQAAAASLPTNEEDLCPICYAHPISAVFQPCGHKSCKACINQHLM
FT                   NNKDCFFCKATIVSVEDWDKAANTSAMSSAA"
FT   CDS             complement(join(18825408..18825528,18825603..18825688,
FT                   18825782..18825876,18826013..18826155,18829605..18829689,
FT                   18829925..18830000,18830089..18830277,18830384..18830523,
FT                   18831731..18831815,18831904..18831991,18832077..18832164,
FT                   18832351..18832425,18833241..18833418,18835333..18835440,
FT                   18836141..18836224,18836450..18836595,18837062..18837260,
FT                   18837500..18837606,18839266..18839367,18839865..18839985,
FT                   18840203..18840274,18840435..18840496,18840675..18840774,
FT                   18840976..18841093,18841702..18841775,18841847..18841939,
FT                   18842056..18842181,18842571..18842675,18842752..18842872,
FT                   18843259..18843381,18843528..18843595,18843797..18843883,
FT                   18844126..18844211,18844307..18844361,18844732..18844826,
FT                   18844959..18845038,18850836..18850920,18851209..18851290))
FT                   /codon_start=1
FT                   /gene="Rnf123"
FT                   /locus_tag="mCG_18867"
FT                   /product="ring finger protein 123, isoform CRA_a"
FT                   /note="gene_id=mCG18867.3 transcript_id=mCT191530.1
FT                   protein_id=mCP112503.1 isoform=CRA_a"
FT                   /protein_id="EDL21263.1"
FT                   /translation="MASKGTGMSFSRKSYRLTSDAEKSRVTGIVQEKLLSDYLYRIFSP
FT                   PDRGPAAATSRKPLNFHNLPEHVDQLLQVDSEDNESQGQVEGRLGPSTVVLDHTGGFEG
FT                   LLLVDDDLLGVIGHSNFGTIRSTTCVYKGKWVYEVLISSQGLMQIGWCTINCRFNQEEG
FT                   VGDTHNSYAYDGNRVRKWNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAF
FT                   ENLSRGLGMAYFPAISLSFKESVAFNFGSRPFGTYPVAGFRPLQDPPFADLVRAQRLLG
FT                   CFQAVLSVELDPVEGRLVETESSEWQLQGQPTVLLTLAHIFHHFAPLLRKVYLVEAVLM
FT                   SFLLGVVEKGTPEQAQSVVHQILDLLWLFMEDYEVQDCLKQLMMSLLRLYRFSPIVPDL
FT                   GLQIHYLRLTMSILRHEKSRKFLLSNVLFDMLRSVVFFYIKSPLRVEEAGLKELIPTTW
FT                   WPHRSSRESRDGKEAREETTEERQRRRAYERGCQRLKKRIEVVEELQVQILKLLLDNKD
FT                   DNGGEASRYIFLTKFRKFLQENASGRGNTPVLCPPEYMVCFLHRLVSALRFYWDEYKAS
FT                   NPRASFSEEAYIPPQIFYNGKVDYFDLQRLGGLLSHLRKTLKDDLASKANIVIDPLELQ
FT                   AATMDDLDEDEEPAPSAAQRPMQALAIGGALPLPRPGWLSSPTLGRANRFLSTAAVSLM
FT                   TPRRLLSTMEKVKVRSLNVEQRTREDIEGSHWNEGLLLGRPPEEPEQPLTENSLLEVLD
FT                   GTVMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVF
FT                   SEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVA
FT                   INSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADPRIVGTDIRDSLMQALASY
FT                   VCYPHSLRAVERIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPH
FT                   LLKTKPEDANLPSLQKPCPSTLLQQHMADLLRQGSDVAPSFLNSVLNQLNWAFSEFIGM
FT                   IQEIQQAAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWSRPTSEM
FT                   LLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRLLVHGPT
FT                   SETEQATSVLLADPCFQLRSICYLLGQPEPLAPGTTLPAPDRKRFSLQSYTDYISAEEL
FT                   AQVEQMLAHLTAASAQAAAASLPTNEEDLCPICYAHPISAVFQPCGHKSCKACINQHLM
FT                   NNKDCFFCKATIVSVEDWDKAANTSAMSSAA"
FT   CDS             complement(join(18825408..18825528,18825603..18825688,
FT                   18825782..18825876,18826013..18826155,18829605..18829689,
FT                   18829925..18830000,18830089..18830277,18830384..18830523,
FT                   18831731..18831815,18831904..18831991,18832077..18832164,
FT                   18832351..18832425,18833241..18833418,18835333..18835440,
FT                   18836141..18836224,18836450..18836595,18837062..18837260,
FT                   18837482..18837606,18839266..18839367,18839865..18839985,
FT                   18840203..18840274,18840435..18840496,18840675..18840774,
FT                   18840976..18841093,18841702..18841775,18841847..18841939,
FT                   18842056..18842181,18842571..18842675,18842752..18842872,
FT                   18843259..18843381,18843528..18843595,18843797..18843883,
FT                   18844126..18844211,18844307..18844361,18844732..18844826,
FT                   18844959..18845038,18850836..18850920,18851209..18851290))
FT                   /codon_start=1
FT                   /gene="Rnf123"
FT                   /locus_tag="mCG_18867"
FT                   /product="ring finger protein 123, isoform CRA_b"
FT                   /note="gene_id=mCG18867.3 transcript_id=mCT191531.1
FT                   protein_id=mCP112504.1 isoform=CRA_b"
FT                   /protein_id="EDL21264.1"
FT                   /translation="MASKGTGMSFSRKSYRLTSDAEKSRVTGIVQEKLLSDYLYRIFSP
FT                   PDRGPAAATSRKPLNFHNLPEHVDQLLQVDSEDNESQGQVEGRLGPSTVVLDHTGGFEG
FT                   LLLVDDDLLGVIGHSNFGTIRSTTCVYKGKWVYEVLISSQGLMQIGWCTINCRFNQEEG
FT                   VGDTHNSYAYDGNRVRKWNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAF
FT                   ENLSRGLGMAYFPAISLSFKESVAFNFGSRPFGTYPVAGFRPLQDPPFADLVRAQRLLG
FT                   CFQAVLSVELDPVEGRLVETESSEWQLQGQPTVLLTLAHIFHHFAPLLRKVYLVEAVLM
FT                   SFLLGVVEKGTPEQAQSVVHQILDLLWLFMEDYEVQDCLKQLMMSLLRLYRFSPIVPDL
FT                   GLQIHYLRLTMSILRHEKSRKFLLSNVLFDMLRSVVFFYIKSPLRVEEAGLKELIPTTW
FT                   WPHRSSRESRDGKEAREETTEERQRRRAYERGCQRLKKRIEVVEELQVQILKLLLDNKD
FT                   DNGGEASRYIFLTKFRKFLQENASGRGNTPVLCPPEYMVCFLHRLVSALRFYWDEYKAS
FT                   NPRASFSEEAYIPPQIFYNGKVDYFDLQRLGGLLSHLRKTLKDDLASKANIVIDPLELQ
FT                   AATMDDLDEDEEPAPSAAQVWQEGQRPMQALAIGGALPLPRPGWLSSPTLGRANRFLST
FT                   AAVSLMTPRRLLSTMEKVKVRSLNVEQRTREDIEGSHWNEGLLLGRPPEEPEQPLTENS
FT                   LLEVLDGTVMMYNLSVHQQLGKMVGVSDDVNEYAMALRDTEDKLRRCPKRRKDILAELT
FT                   KSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYWLLRVCLRTIEHGDRTGSLFAFMPE
FT                   FYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLAAILAKHFADPRIVGTDIRDSLM
FT                   QALASYVCYPHSLRAVERIPEEQRIAMVRNLLAPYEQRPWAQTNWILVRLWRGCGFGYR
FT                   YTRLPHLLKTKPEDANLPSLQKPCPSTLLQQHMADLLRQGSDVAPSFLNSVLNQLNWAF
FT                   SEFIGMIQEIQQAAERLERNFVDSRQLKVCATCFDLSVSLLRVLEMTITLVPEIFLDWS
FT                   RPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESVDHYPILVAVTGILVRL
FT                   LVHGPTSETEQATSVLLADPCFQLRSICYLLGQPEPLAPGTTLPAPDRKRFSLQSYTDY
FT                   ISAEELAQVEQMLAHLTAASAQAAAASLPTNEEDLCPICYAHPISAVFQPCGHKSCKAC
FT                   INQHLMNNKDCFFCKATIVSVEDWDKAANTSAMSSAA"
FT   gene            18853923..18858487
FT                   /gene="Mst1"
FT                   /locus_tag="mCG_18850"
FT                   /note="gene_id=mCG18850.2"
FT   mRNA            join(18853923..18854017,18854632..18854779,
FT                   18854872..18854984,18855071..18855185,18855270..18855406,
FT                   18855488..18855608,18855690..18855808,18855952..18856147,
FT                   18856307..18856437,18856516..18856618,18856741..18856877,
FT                   18856966..18857001,18857081..18857189,18857351..18857428,
FT                   18857548..18857694,18857775..18857881,18857980..18858119,
FT                   18858261..18858487)
FT                   /gene="Mst1"
FT                   /locus_tag="mCG_18850"
FT                   /product="macrophage stimulating 1 (hepatocyte growth
FT                   factor-like)"
FT                   /note="gene_id=mCG18850.2 transcript_id=mCT15940.1 created
FT                   on 17-JUL-2002"
FT   CDS             join(18853966..18854017,18854632..18854779,
FT                   18854872..18854984,18855071..18855185,18855270..18855406,
FT                   18855488..18855608,18855690..18855808,18855952..18856147,
FT                   18856307..18856437,18856516..18856618,18856741..18856877,
FT                   18856966..18857001,18857081..18857189,18857351..18857428,
FT                   18857548..18857694,18857775..18857881,18857980..18858119,
FT                   18858261..18858422)
FT                   /codon_start=1
FT                   /gene="Mst1"
FT                   /locus_tag="mCG_18850"
FT                   /product="macrophage stimulating 1 (hepatocyte growth
FT                   factor-like)"
FT                   /note="gene_id=mCG18850.2 transcript_id=mCT15940.1
FT                   protein_id=mCP21300.1"
FT                   /db_xref="GOA:P26928"
FT                   /db_xref="InterPro:IPR000001"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR003014"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR018056"
FT                   /db_xref="InterPro:IPR024174"
FT                   /db_xref="MGI:MGI:96080"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26928"
FT                   /protein_id="EDL21265.1"
FT                   /translation="MGWLPLLLLLVQCSRALGQRSPLNDFQLFRGTELRNLLHTAVPGP
FT                   WQEDVADAEECARRCGPLLDCRAFHYNMSSHGCQLLPWTQHSLHTQLYHSSLCHLFQKK
FT                   DYVRTCIMDNGVSYRGTVARTAGGLPCQAWSRRFPNDHKYTPTPKNGLEENFCRNPDGD
FT                   PRGPWCYTTNRSVRFQSCGIKTCREAVCVLCNGEDYRGEVDVTESGRECQRWDLQHPHS
FT                   HPFQPEKFLDKDLKDNYCRNPDGSERPWCYTTDPNVEREFCDLPSCGPNLPPTVKGSKS
FT                   QRRNKGKALNCFRGKGEDYRGTTNTTSAGVPCQRWDAQSPHQHRFVPEKYACKDLRENF
FT                   CRNPDGSEAPWCFTSRPGLRMAFCHQIPRCTEELVPEGCYHGSGEQYRGSVSKTRKGVQ
FT                   CQHWSSETPHKPQFTPTSAPQAGLEANFCRNPDGDSHGPWCYTLDPDILFDYCALQRCD
FT                   DDQPPSILDPPDQVVFEKCGKRVDKSNKLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLV
FT                   KEQWVLTARQCIWSCHEPLTGYEVWLGTINQNPQPGEANLQRVPVAKAVCGPAGSQLVL
FT                   LKLERPVILNHHVALICLPPEQYVVPPGTKCEIAGWGESIGTSNNTVLHVASMNVISNQ
FT                   ECNTKYRGHIQESEICTQGLVVPVGACEGDYGGPLACYTHDCWVLQGLIIPNRVCARPR
FT                   WPAIFTRVSVFVDWINKVMQLE"
FT   gene            complement(18858900..18868093)
FT                   /gene="Apeh"
FT                   /locus_tag="mCG_18865"
FT                   /note="gene_id=mCG18865.2"
FT   mRNA            complement(join(18858900..18859164,18859248..18859354,
FT                   18859437..18859539,18859626..18859816,18859910..18859998,
FT                   18860510..18860590,18860668..18860751,18861210..18861348,
FT                   18861748..18861836,18863005..18863056,18863576..18863673,
FT                   18864730..18864790,18865255..18865376,18865458..18865498,
FT                   18865575..18865666,18865763..18865900,18866041..18866204,
FT                   18866294..18866369,18866468..18866561,18867109..18867235,
FT                   18867714..18867846,18867922..18868093))
FT                   /gene="Apeh"
FT                   /locus_tag="mCG_18865"
FT                   /product="acylpeptide hydrolase, transcript variant
FT                   mCT16193"
FT                   /note="gene_id=mCG18865.2 transcript_id=mCT16193.2 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(18858900..18859164,18859248..18859354,
FT                   18859437..18859539,18859626..18859816,18859910..18859998,
FT                   18860510..18860545,18860668..18860751,18861210..18861348,
FT                   18861748..18861836,18863005..18863056,18863576..18863673,
FT                   18864730..18864790,18865255..18865376,18865458..18865498,
FT                   18865575..18865666,18865763..18865900,18866041..18866204,
FT                   18866294..18866369,18866468..18866561,18867109..18867235,
FT                   18867714..18867846,18867922..>18867938))
FT                   /gene="Apeh"
FT                   /locus_tag="mCG_18865"
FT                   /product="acylpeptide hydrolase, transcript variant
FT                   mCT191525"
FT                   /note="gene_id=mCG18865.2 transcript_id=mCT191525.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(18858902..18859164,18859248..18859354,
FT                   18859437..18859539,18859626..18859816,18859910..18859998,
FT                   18860510..18860590,18860668..18860751,18861210..18861348,
FT                   18861748..18861836,18863005..18863056,18863576..18863673,
FT                   18864730..18864790,18865255..18865376,18865458..18865498,
FT                   18865575..18865666,18865763..18866204,18866294..18866369,
FT                   18866468..18866561,18867109..18867235,18867714..18867846,
FT                   18867922..>18867953))
FT                   /gene="Apeh"
FT                   /locus_tag="mCG_18865"
FT                   /product="acylpeptide hydrolase, transcript variant
FT                   mCT191523"
FT                   /note="gene_id=mCG18865.2 transcript_id=mCT191523.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(18859059..18859164,18859248..18859354,
FT                   18859437..18859539,18859626..18859816,18859910..18859998,
FT                   18860510..18860545,18860668..18860751,18861210..18861348,
FT                   18861748..18861836,18863005..18863056,18863576..18863673,
FT                   18864730..18864790,18865255..18865376,18865458..18865498,
FT                   18865575..18865666,18865763..18865900,18866041..18866204,
FT                   18866294..18866369,18866468..18866561,18867109..18867235,
FT                   18867714..18867846,18867922..>18867936))
FT                   /codon_start=1
FT                   /gene="Apeh"
FT                   /locus_tag="mCG_18865"
FT                   /product="acylpeptide hydrolase, isoform CRA_d"
FT                   /note="gene_id=mCG18865.2 transcript_id=mCT191525.0
FT                   protein_id=mCP112499.0 isoform=CRA_d"
FT                   /protein_id="EDL21269.1"
FT                   /translation="TMERQVLLSEPQEAAALYRGLSRQPSLSAACLGPEVTTQYGGLYR
FT                   TVHTEWTQRDLDRMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMK
FT                   AVLRKAGGAVSGEEKQFLEVWEKNRKLKSFNLSALEKHGPVYEDDCFGCLSWSHSETHL
FT                   LYVAEKKRPKAESFFQTKALDVSASDEEMARPKKPDQAIKGDQFVFYEDWGETMVSKSI
FT                   PVLCVLDIESGNISVLEGVPENVSPGQAFWAPGDTGVVFVGWWHEPFRLGIRYCTNRRS
FT                   ALYYVDLSGGKCELLSDESLAVCSPRLSPDQCRVVYLQYPSLAPHHQCSQLFLYDWYTK
FT                   VTSLVVDIVPRQLGESFSGIYCSLLPLGCWSADSQRVVFDSVQRSRQDLFAVDTQTGSV
FT                   TSLTAGGSAGSWKLLTIDRDLMVAQFSTPNLPPSLKVGFLPPAGKEQSVSWVSLEEAEP
FT                   IPDIHWGIRVLHPPPDQENVQYADLDFEAILLQPSNSPDKSQVPMVVMPHAMLCKMGFA
FT                   VLLVNYRGSTGFGQDSILSLPGNVGHQDVKDVQFAVQQVLQEEHFDARRVALMGGSHGG
FT                   FLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDWCMVETGFPYSNDYLPDLNVLE
FT                   EMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYPKSTHA
FT                   LSEVEVESDSFMNTVLWLHTHLGS"
FT   CDS             complement(join(18859059..18859164,18859248..18859354,
FT                   18859437..18859539,18859626..18859816,18859910..18859998,
FT                   18860510..18860590,18860668..18860751,18861210..18861348,
FT                   18861748..18861836,18863005..18863056,18863576..18863673,
FT                   18864730..18864790,18865255..18865376,18865458..18865498,
FT                   18865575..18865666,18865763..18865900,18866041..18866204,
FT                   18866294..18866369,18866468..18866561,18867109..18867235,
FT                   18867714..18867846,18867922..18867933))
FT                   /codon_start=1
FT                   /gene="Apeh"
FT                   /locus_tag="mCG_18865"
FT                   /product="acylpeptide hydrolase, isoform CRA_a"
FT                   /note="gene_id=mCG18865.2 transcript_id=mCT16193.2
FT                   protein_id=mCP21312.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8R146"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="MGI:MGI:88041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R146"
FT                   /protein_id="EDL21266.1"
FT                   /translation="MERQVLLSEPQEAAALYRGLSRQPSLSAACLGPEVTTQYGGLYRT
FT                   VHTEWTQRDLDRMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKA
FT                   VLRKAGGAVSGEEKQFLEVWEKNRKLKSFNLSALEKHGPVYEDDCFGCLSWSHSETHLL
FT                   YVAEKKRPKAESFFQTKALDVSASDEEMARPKKPDQAIKGDQFVFYEDWGETMVSKSIP
FT                   VLCVLDIESGNISVLEGVPENVSPGQAFWAPGDTGVVFVGWWHEPFRLGIRYCTNRRSA
FT                   LYYVDLSGGKCELLSDESLAVCSPRLSPDQCRVVYLQYPSLAPHHQCSQLFLYDWYTKV
FT                   TSLVVDIVPRQLGESFSGIYCSLLPLGCWSADSQRVVFDSVQRSRQDLFAVDTQTGSVT
FT                   SLTAGGSAGSWKLLTIDRDLMVAQFSTPNLPPSLKVGFLPPAGKEQSVSWVSLEEAEPI
FT                   PDIHWGIRVLHPPPDQENVQYADLDFEAILLQPSNSPDKSQVPMVVMPHGGPHSSFVTA
FT                   WMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNVGHQDVKDVQFAVQQVLQEEHF
FT                   DARRVALMGGSHGGFLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDWCMVETGF
FT                   PYSNDYLPDLNVLEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARN
FT                   VPVRLLLYPKSTHALSEVEVESDSFMNTVLWLHTHLGS"
FT   CDS             complement(join(18859059..18859164,18859248..18859354,
FT                   18859437..18859539,18859626..18859816,18859910..18859998,
FT                   18860510..18860590,18860668..18860751,18861210..18861348,
FT                   18861748..18861836,18863005..18863056,18863576..18863673,
FT                   18864730..18864790,18865255..18865376,18865458..18865498,
FT                   18865575..18865666,18865763..>18865933))
FT                   /codon_start=1
FT                   /gene="Apeh"
FT                   /locus_tag="mCG_18865"
FT                   /product="acylpeptide hydrolase, isoform CRA_b"
FT                   /note="gene_id=mCG18865.2 transcript_id=mCT191523.0
FT                   protein_id=mCP112497.0 isoform=CRA_b"
FT                   /protein_id="EDL21267.1"
FT                   /translation="APWALSVLCSQGDQFVFYEDWGETMVSKSIPVLCVLDIESGNISV
FT                   LEGVPENVSPGQAFWAPGDTGVVFVGWWHEPFRLGIRYCTNRRSALYYVDLSGGKCELL
FT                   SDESLAVCSPRLSPDQCRVVYLQYPSLAPHHQCSQLFLYDWYTKVTSLVVDIVPRQLGE
FT                   SFSGIYCSLLPLGCWSADSQRVVFDSVQRSRQDLFAVDTQTGSVTSLTAGGSAGSWKLL
FT                   TIDRDLMVAQFSTPNLPPSLKVGFLPPAGKEQSVSWVSLEEAEPIPDIHWGIRVLHPPP
FT                   DQENVQYADLDFEAILLQPSNSPDKSQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFA
FT                   VLLVNYRGSTGFGQDSILSLPGNVGHQDVKDVQFAVQQVLQEEHFDARRVALMGGSHGG
FT                   FLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDWCMVETGFPYSNDYLPDLNVLE
FT                   EMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYPKSTHA
FT                   LSEVEVESDSFMNTVLWLHTHLGS"
FT   mRNA            complement(join(18860263..18860590,18860668..18861401,
FT                   18861748..18863056,18863576..18863673,18864730..18865376,
FT                   18865458..18865666,18865763..18865900,18866041..18866204,
FT                   18866294..18866561,18867109..18867235,18867714..18867846,
FT                   18867922..>18867964))
FT                   /gene="Apeh"
FT                   /locus_tag="mCG_18865"
FT                   /product="acylpeptide hydrolase, transcript variant
FT                   mCT191524"
FT                   /note="gene_id=mCG18865.2 transcript_id=mCT191524.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(18865571..18865666,18865763..18865900,
FT                   18866041..18866204,18866294..18866561,18867109..>18867165))
FT                   /codon_start=1
FT                   /gene="Apeh"
FT                   /locus_tag="mCG_18865"
FT                   /product="acylpeptide hydrolase, isoform CRA_c"
FT                   /note="gene_id=mCG18865.2 transcript_id=mCT191524.0
FT                   protein_id=mCP112498.0 isoform=CRA_c"
FT                   /protein_id="EDL21268.1"
FT                   /translation="WRLGGVCRACGQQCGNPGGAAEQRVSFRHHESSAAQGWRCSLGRG
FT                   KTVLGGEFARMRWQPAGHLVPQVKPCGGASSLMPRYLQVWEKNRKLKSFNLSALEKHGP
FT                   VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDEEMARPKKPDQAIK
FT                   GDQFVFYEDWGETMVSKSIPVLCVLDIESGNISVLEGVPENVSPGQAFWAPGDTGVVFV
FT                   GWWHEPFRLGIRYCTNRR"
FT   gene            complement(18871233..>18962627)
FT                   /gene="Bsn"
FT                   /locus_tag="mCG_18848"
FT                   /note="gene_id=mCG18848.2"
FT   mRNA            complement(join(18871233..18873394,18876773..18876865,
FT                   18877247..18877301,18877527..18877658,18878369..18878471,
FT                   18878583..18879391,18879693..18881769,18883468..18890109,
FT                   18890633..18891142,18899320..18900210,18912589..18912997,
FT                   18962412..>18962627))
FT                   /gene="Bsn"
FT                   /locus_tag="mCG_18848"
FT                   /product="bassoon"
FT                   /note="gene_id=mCG18848.2 transcript_id=mCT15937.2 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(18877261..18877301,18877527..18877658,
FT                   18878369..18878471,18878583..18879391,18879693..18881769,
FT                   18883468..18890109,18890633..18891142,18899320..18900210,
FT                   18912589..18912997,18962412..>18962626))
FT                   /codon_start=1
FT                   /gene="Bsn"
FT                   /locus_tag="mCG_18848"
FT                   /product="bassoon"
FT                   /note="gene_id=mCG18848.2 transcript_id=mCT15937.2
FT                   protein_id=mCP21281.1"
FT                   /protein_id="EDL21270.1"
FT                   /translation="WATRPAWRPARAKGPLPPGGSGLGPGPGAGKPPSALAGGGQLPVA
FT                   GAARAAGPPTPGLGPVPGPGPGPGPGSVPRRLDPKEPLGSQRTTSPTPKQASATAPGRE
FT                   SPRETRAQGPSGQEAESPRRTLQVDSRTQRSGRSPSVSPDRGSTPTSPYSVPQIAPLPS
FT                   STLCPICKTSDLTSTPSQPNFNTCTQCHNKVCNQCGFNPNPHLTQVKEWLCLNCQMQRA
FT                   LGMDMTTAPRSKSQQQLHSPALSPAHSPAKQPLGKPEQERSPRGPGATQSGPRQAEAAR
FT                   ATSVPGPTQATAPPEVGRVSPQPPLSTKPSTAEPRPPAGEAQGKSATTVPSGLGAGEQT
FT                   QEGLTGKLFGLGASLLTQASTLMSVQPEADTQGQPSPSKGQPKIVFSDASKEAGPRPPG
FT                   SGPGPGPTPGAKTEPGARMGPGSGPGALAKTGGTASPKHGRAEHQAASKAAAKPKTMPK
FT                   ERASACPLCQAELNMGSRGPANYNTCTACKLQVCNLCGFNPTPHLVEKTEWLCLNCQTK
FT                   RLLEGSLGEPAPLPLPTPQQPPAGVPHRAAGAAPLKQKGPQGLGQPSGSLPAKASPQAT
FT                   KASPQATKASPQATKASPQTTKASPQAKPLRATEPSKTSSSAQEKKTVTSAKAEPVPKP
FT                   PPETTVPPGTPKAKSGVKRTDPATPVVKPVPEAPKGGEAEEPVPKPYSQDLSRSPQSLS
FT                   DTGYSSDGVSSSQSEITGVVQQEVEQLDSAGVTGPRPPSPSELHKVGSSLRPSLEAQAV
FT                   APSAEWSKPPRSSSSAVEDQKRRPHSLSITPEAFDSDEELGDILEEDDSLAWGRQREQQ
FT                   DTAESSDDFGSQLRHDYVEDSSEGGLSPLPPQPPARADMTDEEFMRRQILEMSAEEDNL
FT                   EEDDTAVSGRGLAKHSAQKASARPRPESSQEPKRRLPHNATTGYEELLSEAGPAEPTDS
FT                   SGALQGGLRRFKTIELNSTGSYGHELDLGQGPDPNLDREPELEMESLTGSPEDRSRGEH
FT                   SSTLPASTPSYTSGTSPTSLSSLEEDSDSSPSRRQRLEEAKQQRKARHRSHGPLLPTIE
FT                   DSSEEEELREEEELLREQEKMREVEQQRIRSTARKTRRDKEELRAQRRRERSKTPPSNL
FT                   SPIEDASPTEELRQAAEMEELHRSSCSEYSPSPSLDSEAETLDGGPTRLYKSGSEYNLP
FT                   AFMSLYSPTETPSGSSTTPSSGRPLKSAEEAYEDMMRKAEMLQRQQGQVAGARGPHGGP
FT                   SQPTGPRSQGSFEYQDTQDHDYGGRASQPVAESTPAGLGAAVYEEILQTSQSIARMRQA
FT                   SSRDLGFTEDKKKEKQFLNAESAYMDPMKQNGGPLTPGTSPTQLAAPVSFSTSTSSDSS
FT                   GGRVIPDVRVTQHFAKEPQDPLKLHSSPVSSTLTSKEVGMTFSQGPGSPATTASPTRGY
FT                   MTPTSPAGSERSPSTSSTIHSYGQPPTTANYGSQTEELPHAPSGPPGSGRAPREKPLSG
FT                   GDSEVGAPQPSRGYSYFTGSSPPLSPSTPSESPTFSPGKLGPRATAEFSTQTPSLTLSS
FT                   DIPRSPGPPSPMVAQGTQTPHRPSTPRLVWQQSSQEAPIMVITLASDASSQTRMVHASA
FT                   STSPLCSPTDSQPTSHSYSQTTPPSASQMPSEPAGPPGFPRAPSAGTDGPLALYGWGAL
FT                   PAENISLCRISSVPGTSRVEPGPRPPGTAVVDLRTAVKPTPIILTDQGMDLTSLAVEAR
FT                   KYGLALDPVSGRQSTAVQPLVINLNAQEQTHTFLATATTVSITMASSVLMAQQKQPVVY
FT                   GDPFQSRLDFGQGSGSPVCLAQVKQVEQAVQTAPYRGGPRGRPREAKFARYNLPNQVTP
FT                   LARRDILITQMGTAQGVGLKPGPVPEPGAEPHRATPAELRSHAPPGTRKPHTVVVQMGE
FT                   GTAGTVTTLLPEEPAGALDLTGMRPESQLACCDMVYKFPFGSSCTGTFHPAPSAPDKSV
FT                   TDTALPGQSSGPFYSPRDPEPPEPLTFRTQGVVGPGPHEEQRPYPQGLPGRLYSSMSDT
FT                   NLAEAGLNYHAQRLGQLFQGPGRDSAVDLSSLKHSYSLGFADGRYLGQGLQYGSFTDLR
FT                   HPTDLLSHPLPLRRYSSVSNIYSDHRYGPRGDAVGFQEASLAQYSATTAREISRMCAAL
FT                   NSMDQYGGRHGSGSGGPDLVQYQPQHGPGLSAPQGLAPLRSGLLGNPTYPEGQPSPGNL
FT                   AQYGPAASQATAVRQLLPSTATVRAADGMIYSTINTPIAATLPITTQPASVLRPMVRGG
FT                   MYRPYVSGGVTAVPLTSLTRVPMIAPRVPLGPAGLYRYPAPRFPIASSVPPAEGPVYLG
FT                   KPAAAKASGAGGPPRPELPAGVAREEPFSTTAPAVIKEAPVAPAPGPAPAPPPGQKPAG
FT                   EAVAGSGSGVLSRPASEKEEASQEDRQRKQQEQLLQLERERVELEKLRQLRLQEELERE
FT                   RVELQRHREEEQLLVQRELQELQTIKQHVLQQQQEERQAQFALQREQLAQQRLQLEQIQ
FT                   QLQQQLQLQLEEQKQRQKAPFPATCEAPSRGPPPAATELAQNGQYWPPLTHAAFIAVAG
FT                   TEGPGQPREPVLHRGLPSSASDMSLQTEEQWEAGRSGIKKRHSMPRLRDACEPESGPDP
FT                   STVRRIADSSVQTDDEEGEGRYLVTRRRRTRRSADCSVQTDDEDNADWEQPVRRRRSRL
FT                   SRHSDSGSDSKHDATASSSTTAAATARAMSSVGIQTISDCSVQTEPEQLPRVSPAIHIT
FT                   AATDPKVEIVRYISAPEKTGRGESLACQTEPDGQAQGVAGPQLIGPTAISPYLPGIQIV
FT                   TPGALGRFEKKKPDPLEIGYQAHLPPESLSQLVSRQPPKSPQVLYSPVSPLSPHRLLDT
FT                   SFASSERLNKAHVSPQKQFIADSTLRQQTLPRPMKTLQRSLSDPKPLSPTAEESAKERF
FT                   SLYQHQGGLGSQVSALPPNGLVRKVKRTLPSPPPEEAHLPLAGQVPSQLYAASLLQRGL
FT                   AGPTTVPATKASLLRELDRDLRLVEHESTKLRKKQAELDEEEKEIDAKLKYLELGITQR
FT                   KESLAKDRGGRDYPPLRGLGEHRDYLSDSELNQLRLQGCTTPAGQYVDYPASAAVPATP
FT                   SGPTAFQQPRFPPAAPQYTAGSSGPTQNGFPAHQAPTYTGPSTYPAPTYPPGTGYPAEP
FT                   GLPSQPAFHPTGHYAAPTPMPTTQSAPFPVQADSRAAHQKPRQTSLADLEQKVPTNYEV
FT                   IGSPAVTMSSAPPETGYSGPAVSGSYEQGKAPEHPRGSDRSSVSQSPAPTYPSDSHYTS
FT                   LEQNVPRNYVMIDDISELTKDSTPTASESQRLEPLGPGGVSGRPGKDPGEPAVLEGPTL
FT                   PCCYGRGEEESEEDSYDPRGKSGHHRSMESNGRPSTHYYGDSDYRHGARADKYGPGPMG
FT                   PKHPSKSLAPAAISSKRSKHRKQGMEQKISKFSPIEEAKDVESDLASYPPPTVSSSLTS
FT                   RGRKFQDEITYGLKKNVYEQQRYYGVSSRDAAEEDERMYGSSSRSRMASAYSGEKLSSH
FT                   DYSSRGKGYERERDTAERLQKAGSKPSSLSMAHGRARPPMRSQASEEESPVSPLGRPRP
FT                   AGGALPPGDTCPQFCSSHSMPDVQEHVKDGPRAHAYKREEGYMLDDSHCVVSDSEAYHL
FT                   GQEETDWFDKPRDARSDRFRHHGGHTVSSSQKRGPARHSYHDYDEPPEEGLWPHDEGGP
FT                   GRHTSAKEHRHHSDHGRHSGRHAGEEPGRRAAKPHARDMGRHEARPHPQASPAPAMQKK
FT                   GQPGYPSSADYSQSSRAPSAYHHASESKKGSRQAHTGPSALQPKADTQAQPQMQGRQAA
FT                   PGPQQSQPPSSRQTPSGTASRQPQTQQQQQQQQQQQGLGQQAPQQAPSQARLQPQSQPT
FT                   TRGTAPAASQPAGKPQPGPTTAPGPQPAGPPRAEQASSSKPPAAKAPQQGRAPQAQTTP
FT                   GPGPAGAKPGARPGGTPGAPASQPGAEGESVFSKILPGGAAEQAGKLTEAVSAFGKKFS
FT                   SFW"
FT   gene            <18910255..18911954
FT                   /locus_tag="mCG_144693"
FT                   /note="gene_id=mCG144693.0"
FT   mRNA            join(<18910255..18910543,18910819..18910968,
FT                   18911066..18911954)
FT                   /locus_tag="mCG_144693"
FT                   /product="mCG144693"
FT                   /note="gene_id=mCG144693.0 transcript_id=mCT184117.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<18910503..18910543,18910819..18910968,
FT                   18911066..18911231)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144693"
FT                   /product="mCG144693"
FT                   /note="gene_id=mCG144693.0 transcript_id=mCT184117.0
FT                   protein_id=mCP105884.0"
FT                   /protein_id="EDL21271.1"
FT                   /translation="LIQPSIGLKYLAKRAAAQESISWSWEPRGFTMRGHPTETWAIHQV
FT                   FLLPGGQELVASQAVGSNRCSNHERARLLRKPPHSRSSSKRTESSPPASASRTYLSQTT
FT                   RPTPTAPHAGIYRP"
FT   gene            18932472..18933645
FT                   /pseudo
FT                   /locus_tag="mCG_133134"
FT                   /note="gene_id=mCG133134.1"
FT   mRNA            18932472..18933645
FT                   /pseudo
FT                   /locus_tag="mCG_133134"
FT                   /note="gene_id=mCG133134.1 transcript_id=mCT134498.1
FT                   created on 17-JUL-2002"
FT   gene            complement(18976977..18990748)
FT                   /gene="Dag1"
FT                   /locus_tag="mCG_140684"
FT                   /note="gene_id=mCG140684.0"
FT   mRNA            complement(join(18976977..18982000,18990351..18990748))
FT                   /gene="Dag1"
FT                   /locus_tag="mCG_140684"
FT                   /product="dystroglycan 1"
FT                   /note="gene_id=mCG140684.0 transcript_id=mCT170735.0
FT                   created on 17-JUL-2002"
FT   CDS             complement(join(18979598..18982000,18990351..18990629))
FT                   /codon_start=1
FT                   /gene="Dag1"
FT                   /locus_tag="mCG_140684"
FT                   /product="dystroglycan 1"
FT                   /note="gene_id=mCG140684.0 transcript_id=mCT170735.0
FT                   protein_id=mCP93653.0"
FT                   /db_xref="GOA:Q544G5"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008465"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR027468"
FT                   /db_xref="MGI:MGI:101864"
FT                   /db_xref="UniProtKB/TrEMBL:Q544G5"
FT                   /protein_id="EDL21272.1"
FT                   /translation="MSVDNWLLHPLWGQTFLLLLSVAVAQAHWPSEPSEAVRDWKNQLE
FT                   ASMHSVLSDFQEAVPTVVGIPDGTAVVGRSFRVSIPTDLIASSGEIIKVSAAGKEALPS
FT                   WLHWDPHSHILEGLPLDTDKGVHYISVSAARLGANGSHVPQTSSVFSIEVYPEDHNEPQ
FT                   SVRAASSDPGEVVPSACAADEPVTVLTVILDADLTKMTPKQRIDLLNRMQSFSEVELHN
FT                   MKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVETPARE
FT                   GAMSAQLGYPVVGWHIANKKPTLPKRLRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTP
FT                   TSPAIAPPTETMAPPVRDPVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQI
FT                   RPTLTIPGYVEPTAVITPPTTTTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVP
FT                   RVTTKAPITRLETASPPTRIRTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIP
FT                   SDTFYDNEDTTTDKLKLTLKLREQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMH
FT                   ATDKGGLSAVDAFEIHVHKRPQGDKAPARFKARLAGDPAPVVNDIHKKIALVKKLAFAF
FT                   GDRNCSSITLQNITRGSIVVEWTNNTLPLEPCPKEQIIGLSRRIADENGKPRPAFSNAL
FT                   EPDFKALSIAVTGSGSCRHLQFIPVAPPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVI
FT                   PAVVVAAILLIAGIIAMICYRKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSS
FT                   MPLILQEEKAPLPPPEYPNQSMPETTPLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPM
FT                   EGKGSRPKNMTPYRSPPPYVPP"
FT   gene            19063203..19069257
FT                   /gene="Nicn1"
FT                   /locus_tag="mCG_13027"
FT                   /note="gene_id=mCG13027.2"
FT   mRNA            join(19063203..19063423,19066096..19066272,
FT                   19066691..19066804,19067206..19067277,19067649..19067753,
FT                   19067828..19069257)
FT                   /gene="Nicn1"
FT                   /locus_tag="mCG_13027"
FT                   /product="nicolin 1, transcript variant mCT13772"
FT                   /note="gene_id=mCG13027.2 transcript_id=mCT13772.1 created
FT                   on 17-JUL-2002"
FT   mRNA            join(<19063226..19063423,19066096..19066272,
FT                   19066691..19066808,19067208..19067277,19067649..19067753,
FT                   19067828..19068453)
FT                   /gene="Nicn1"
FT                   /locus_tag="mCG_13027"
FT                   /product="nicolin 1, transcript variant mCT191539"
FT                   /note="gene_id=mCG13027.2 transcript_id=mCT191539.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<19063265..19063423,19066096..19066272,
FT                   19066691..19066808,19067208..19067277,19067649..19067703)
FT                   /codon_start=1
FT                   /gene="Nicn1"
FT                   /locus_tag="mCG_13027"
FT                   /product="nicolin 1, isoform CRA_a"
FT                   /note="gene_id=mCG13027.2 transcript_id=mCT191539.0
FT                   protein_id=mCP112467.0 isoform=CRA_a"
FT                   /protein_id="EDL21273.1"
FT                   /translation="FCLVVISQIMSRVLVPCHVKSTVALQVGDMRTSQGRPGVLVVDVT
FT                   FPNIAPFELQEIMFKNYYTAFLSIRVRQQSSMHTAAKWVTCLRDYCLMPDPHSEEGAQD
FT                   YVSLFKHQMLCDMNRVLELRLILRQPSPLWLSFTVEELQIYQQGPKATPPWRSPSGFPT
FT                   QCPMSSLLPALRVSQIPAECPLRCSRCGH"
FT   CDS             join(19063292..19063423,19066096..19066272,
FT                   19066691..19066804,19067206..19067277,19067649..19067753,
FT                   19067828..19067869)
FT                   /codon_start=1
FT                   /gene="Nicn1"
FT                   /locus_tag="mCG_13027"
FT                   /product="nicolin 1, isoform CRA_b"
FT                   /note="gene_id=mCG13027.2 transcript_id=mCT13772.1
FT                   protein_id=mCP22538.1 isoform=CRA_b"
FT                   /protein_id="EDL21274.1"
FT                   /translation="MSRVLVPCHVKSTVALQVGDMRTSQGRPGVLVVDVTFPNIAPFEL
FT                   QEIMFKNYYTAFLSIRVRQQSSMHTAAKWVTCLRDYCLMPDPHSEEGAQDYVSLFKHQM
FT                   LCDMNRVLELRLILRQPSPLWLSFTVEELQIYQQGPKSPSLAFPKWLSHPVSNEQPAPR
FT                   LEGLPDPSRVSSEVQQMWALTEMIRASHTSTRIGRFDVDGCYDLNLLSYT"
FT   gene            19069682..19075221
FT                   /gene="Amt"
FT                   /locus_tag="mCG_13019"
FT                   /note="gene_id=mCG13019.2"
FT   mRNA            join(19069682..19069785,19069888..19070055,
FT                   19070472..19070552,19071528..19071659,19072140..19072218,
FT                   19072505..19072650,19073295..19073475,19073834..19073989,
FT                   19074081..19075221)
FT                   /gene="Amt"
FT                   /locus_tag="mCG_13019"
FT                   /product="aminomethyltransferase"
FT                   /note="gene_id=mCG13019.2 transcript_id=mCT13764.2 created
FT                   on 17-JUL-2002"
FT   CDS             join(19069696..19069785,19069888..19070055,
FT                   19070472..19070552,19071528..19071659,19072140..19072218,
FT                   19072505..19072650,19073295..19073475,19073834..19073989,
FT                   19074081..19074259)
FT                   /codon_start=1
FT                   /gene="Amt"
FT                   /locus_tag="mCG_13019"
FT                   /product="aminomethyltransferase"
FT                   /note="gene_id=mCG13019.2 transcript_id=mCT13764.2
FT                   protein_id=mCP22532.1"
FT                   /db_xref="GOA:A2RSW6"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="MGI:MGI:3646700"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSW6"
FT                   /protein_id="EDL21275.1"
FT                   /translation="MHRIVSVVAPLGFRLQAQPLVQSRPLSSVQDVLRRTPLYDFHLAH
FT                   GGKMVAFAGWSLPVQYRDSHVDSHLHTRRHCSLFDVSHMLQTKIFGCDRVKLLESVVVG
FT                   DIAELRPNQGTLSLFTNEAGGILDDLIVSNTSEGHLYVVSNAGCRDKDLALMQDKVKEF
FT                   QNRGLDVGLEVVENALLALQGPTATQVLQAGVTDDMKKLPFMTSAVMEVFGVSGCRVTR
FT                   CGYTGEDGVEISVPATGAVHLATTLLKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHT
FT                   TPVEGSLSWTLGKRRRIAMDFPGAKIIVPQLKGEVQRRRVGLICEGAPVRAHSPILNTE
FT                   GTVIGTVTSGCPSPSLKKNVAMGYVPFKYSRPGTQLLVEVRRKQQMTVVSKMPFVPTNY
FT                   YTLK"
FT   gene            complement(19075456..19078713)
FT                   /gene="Tcta"
FT                   /locus_tag="mCG_13017"
FT                   /note="gene_id=mCG13017.2"
FT   mRNA            complement(join(19075456..19077014,19078088..19078142,
FT                   19078484..19078713))
FT                   /gene="Tcta"
FT                   /locus_tag="mCG_13017"
FT                   /product="T-cell leukemia translocation altered gene,
FT                   transcript variant mCT13762"
FT                   /note="gene_id=mCG13017.2 transcript_id=mCT13762.2 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(19075456..19077014,19078088..19078190,
FT                   19078484..19078713))
FT                   /gene="Tcta"
FT                   /locus_tag="mCG_13017"
FT                   /product="T-cell leukemia translocation altered gene,
FT                   transcript variant mCT170737"
FT                   /note="gene_id=mCG13017.2 transcript_id=mCT170737.0 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(19076972..19077014,19078088..19078142,
FT                   19078484..19078706))
FT                   /codon_start=1
FT                   /gene="Tcta"
FT                   /locus_tag="mCG_13017"
FT                   /product="T-cell leukemia translocation altered gene,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13017.2 transcript_id=mCT13762.2
FT                   protein_id=mCP22520.2 isoform=CRA_a"
FT                   /protein_id="EDL21276.1"
FT                   /translation="MAEPWAGQFLQALPATVLGALGTLGSDFLREWETQDMRVTLFKLL
FT                   LLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFSSWEIAANEALKTH
FT                   RE"
FT   CDS             complement(join(19076972..19077014,19078088..19078190,
FT                   19078484..19078706))
FT                   /codon_start=1
FT                   /gene="Tcta"
FT                   /locus_tag="mCG_13017"
FT                   /product="T-cell leukemia translocation altered gene,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13017.2 transcript_id=mCT170737.0
FT                   protein_id=mCP93655.0 isoform=CRA_b"
FT                   /protein_id="EDL21277.1"
FT                   /translation="MAEPWAGQFLQALPATVLGALGTLGSDFLREWETQDMRVTLFKLL
FT                   LLWLVLSLLGIQLAWGFYGNTVTGLYHRPDPHPQPPAAMGVFLPPGLGGQNGSTPDGST
FT                   HFSSWEIAANEALKTHRE"
FT   gene            19078920..19110754
FT                   /gene="Rhoa"
FT                   /locus_tag="mCG_13026"
FT                   /note="gene_id=mCG13026.2"
FT   mRNA            join(19078920..19079315,19088160..19088234,
FT                   19100401..19100558,19103690..19103810,19107871..19108001,
FT                   19109468..19110754)
FT                   /gene="Rhoa"
FT                   /locus_tag="mCG_13026"
FT                   /product="ras homolog gene family, member A, transcript
FT                   variant mCT13771"
FT                   /note="gene_id=mCG13026.2 transcript_id=mCT13771.2 created
FT                   on 17-JUL-2002"
FT   mRNA            join(19079737..19079929,19088160..19088234,
FT                   19100401..19100558,19103690..19103810,19107871..19108001,
FT                   19109468..19110754)
FT                   /gene="Rhoa"
FT                   /locus_tag="mCG_13026"
FT                   /product="ras homolog gene family, member A, transcript
FT                   variant mCT170739"
FT                   /note="gene_id=mCG13026.2 transcript_id=mCT170739.0 created
FT                   on 17-JUL-2002"
FT   CDS             join(19100403..19100558,19103690..19103810,
FT                   19107871..19108001,19109468..19109641)
FT                   /codon_start=1
FT                   /gene="Rhoa"
FT                   /locus_tag="mCG_13026"
FT                   /product="ras homolog gene family, member A, isoform CRA_a"
FT                   /note="gene_id=mCG13026.2 transcript_id=mCT13771.2
FT                   protein_id=mCP22536.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q4VAE6"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1096342"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VAE6"
FT                   /protein_id="EDL21278.1"
FT                   /translation="MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVAD
FT                   IEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVK
FT                   HFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKT
FT                   KDGVREVFEMATRAALQARRGKKKSGCLIL"
FT   CDS             join(19100403..19100558,19103690..19103810,
FT                   19107871..19108001,19109468..19109641)
FT                   /codon_start=1
FT                   /gene="Rhoa"
FT                   /locus_tag="mCG_13026"
FT                   /product="ras homolog gene family, member A, isoform CRA_a"
FT                   /note="gene_id=mCG13026.2 transcript_id=mCT170739.0
FT                   protein_id=mCP93657.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4VAE6"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1096342"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VAE6"
FT                   /protein_id="EDL21279.1"
FT                   /translation="MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVAD
FT                   IEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVK
FT                   HFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKT
FT                   KDGVREVFEMATRAALQARRGKKKSGCLIL"
FT   gene            19112054..19113236
FT                   /gene="Gpx1"
FT                   /locus_tag="mCG_13024"
FT                   /note="gene_id=mCG13024.1"
FT   mRNA            join(19112054..19112378,19112597..19113236)
FT                   /gene="Gpx1"
FT                   /locus_tag="mCG_13024"
FT                   /product="glutathione peroxidase 1"
FT                   /note="gene_id=mCG13024.1 transcript_id=mCT13769.1 created
FT                   on 17-JUL-2002"
FT   CDS             19112133..19112273
FT                   /codon_start=1
FT                   /gene="Gpx1"
FT                   /locus_tag="mCG_13024"
FT                   /product="glutathione peroxidase 1"
FT                   /note="gene_id=mCG13024.1 transcript_id=mCT13769.1
FT                   protein_id=mCP22534.1"
FT                   /protein_id="EDL21280.1"
FT                   /translation="MCAARLSAAAQSTVYAFSARPLTGGEPVSLGSLRGKVLLIENVAS
FT                   L"
FT   gene            19120803..19165451
FT                   /gene="Usp4"
FT                   /locus_tag="mCG_13020"
FT                   /note="gene_id=mCG13020.1"
FT   mRNA            join(19120803..19120953,19123850..19123977,
FT                   19129351..19129481,19133022..19133148,19135488..19135633,
FT                   19135764..19135825,19138755..19138895,19139686..19139803,
FT                   19140744..19140917,19143826..19143984,19145487..19145711,
FT                   19146532..19146615,19147149..19147243,19151361..19151552,
FT                   19152190..19152278,19154253..19154477,19157010..19157080,
FT                   19157322..19157440,19157732..19157881,19161202..19161305,
FT                   19163905..19163993,19164604..19165451)
FT                   /gene="Usp4"
FT                   /locus_tag="mCG_13020"
FT                   /product="ubiquitin specific peptidase 4 (proto-oncogene),
FT                   transcript variant mCT13766"
FT                   /note="gene_id=mCG13020.1 transcript_id=mCT13766.0 created
FT                   on 17-JUL-2002"
FT   mRNA            join(19120803..19120953,19123850..19123977,
FT                   19129351..19129481,19133022..19133148,19135488..19135633,
FT                   19135764..19135825,19139686..19139803,19140744..19140917,
FT                   19143826..19143984,19145487..19145711,19146532..19146615,
FT                   19147149..19147243,19151361..19151552,19152190..19152278,
FT                   19154253..19154477,19157010..19157080,19157322..19157440,
FT                   19157732..19157881,19161202..19161305,19163905..19163993,
FT                   19164604..19165451)
FT                   /gene="Usp4"
FT                   /locus_tag="mCG_13020"
FT                   /product="ubiquitin specific peptidase 4 (proto-oncogene),
FT                   transcript variant mCT170738"
FT                   /note="gene_id=mCG13020.1 transcript_id=mCT170738.0 created
FT                   on 17-JUL-2002"
FT   CDS             join(19120853..19120953,19123850..19123977,
FT                   19129351..19129481,19133022..19133148,19135488..19135633,
FT                   19135764..19135825,19138755..19138895,19139686..19139803,
FT                   19140744..19140917,19143826..19143984,19145487..19145711,
FT                   19146532..19146615,19147149..19147243,19151361..19151552,
FT                   19152190..19152278,19154253..19154477,19157010..19157080,
FT                   19157322..19157440,19157732..19157881,19161202..19161305,
FT                   19163905..19163993,19164604..19164762)
FT                   /codon_start=1
FT                   /gene="Usp4"
FT                   /locus_tag="mCG_13020"
FT                   /product="ubiquitin specific peptidase 4 (proto-oncogene),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13020.1 transcript_id=mCT13766.0
FT                   protein_id=mCP22529.1 isoform=CRA_b"
FT                   /db_xref="GOA:P35123"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR006615"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028134"
FT                   /db_xref="InterPro:IPR028135"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="MGI:MGI:98905"
FT                   /db_xref="PDB:3JYU"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35123"
FT                   /protein_id="EDL21282.1"
FT                   /translation="MAEGRGSRERPDVETQKTELGALMGTTLQRGAQWYLIDSRWFKQW
FT                   KKYVGFDSWDMYNVGEHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPAEAWNKL
FT                   LNWYGCVEGQQPIVRKVVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIA
FT                   TIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTIQDAGLYQGQVLVIEPQNEDG
FT                   TWPRQSLQSKSSTAPSRNFTTSSKPSASPYCSVSASLIANGDSTNSSGMHSSGVSRGGS
FT                   GFSASYNCQEPPSPHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTEYFLKDEYEAEIN
FT                   RDNPLGMKGEIAEAYAELIKQMWSGRDTHVAPRMFKTQVGRFAPQFSGYQQQDSQELLA
FT                   FILDGLHEDLNRVKKKPYLEPKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKST
FT                   LVCPECAKVSVTFDPFCYLTLPLPLKKDRIMEVFLVPADPQCRPIQYRVTVPLMGAISD
FT                   LCEALSKLSGIAAENMVVTDVYNHRFHKIFQMDEGLSHITPRDDIFVYEVCNTSMDGSE
FT                   CITLPVYFREKKSRPSSASSGAVLYGQPLLVSVPKHKLTLESLYQAVCDRISRYIKQPL
FT                   PDEFLSSPLEPGACNGSRSSYEGDEEEEMDHQEEGKEQLSEVEGSGEDDQGDDHSESAQ
FT                   KVKGQPRHKRLFTFSLVNSCGTADINSLATDGKLLKLNSRSTLAIDWDSETRSLYFDEQ
FT                   ESEACEKHLSMSQPQKKKKAAVALRECIELFTTMETLGEHDPWYCPTCKKHQQATKKFD
FT                   LWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPVRALNMSEFVCDRSARPYVYDLIAVSN
FT                   HYGAMGVGHYTAYAKNRLNGKWYYFDDSSVSLASEDQIVTKAAYVLFYQRRDDECSSTS
FT                   SLGSFPGSDGGVKLSSSHQGMGDEEAYNMDTN"
FT   CDS             join(19120853..19120953,19123850..19123977,
FT                   19129351..19129481,19133022..19133148,19135488..19135633,
FT                   19135764..19135825,19139686..19139803,19140744..19140917,
FT                   19143826..19143984,19145487..19145711,19146532..19146615,
FT                   19147149..19147243,19151361..19151552,19152190..19152278,
FT                   19154253..19154477,19157010..19157080,19157322..19157440,
FT                   19157732..19157881,19161202..19161305,19163905..19163993,
FT                   19164604..19164762)
FT                   /codon_start=1
FT                   /gene="Usp4"
FT                   /locus_tag="mCG_13020"
FT                   /product="ubiquitin specific peptidase 4 (proto-oncogene),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13020.1 transcript_id=mCT170738.0
FT                   protein_id=mCP93656.0 isoform=CRA_a"
FT                   /protein_id="EDL21281.1"
FT                   /translation="MAEGRGSRERPDVETQKTELGALMGTTLQRGAQWYLIDSRWFKQW
FT                   KKYVGFDSWDMYNVGEHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPAEAWNKL
FT                   LNWYGCVEGQQPIVRKVVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIA
FT                   TIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTIQDAGLYQGQVLVIEPQNEDG
FT                   TWPRQSLQSNGSGFSASYNCQEPPSPHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTE
FT                   YFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDTHVAPRMFKTQVGRFAPQFS
FT                   GYQQQDSQELLAFILDGLHEDLNRVKKKPYLEPKDANGRPDAVVAKEAWENHRLRNDSV
FT                   IVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRIMEVFLVPADPQCRPIQY
FT                   RVTVPLMGAISDLCEALSKLSGIAAENMVVTDVYNHRFHKIFQMDEGLSHITPRDDIFV
FT                   YEVCNTSMDGSECITLPVYFREKKSRPSSASSGAVLYGQPLLVSVPKHKLTLESLYQAV
FT                   CDRISRYIKQPLPDEFLSSPLEPGACNGSRSSYEGDEEEEMDHQEEGKEQLSEVEGSGE
FT                   DDQGDDHSESAQKVKGQPRHKRLFTFSLVNSCGTADINSLATDGKLLKLNSRSTLAIDW
FT                   DSETRSLYFDEQESEACEKHLSMSQPQKKKKAAVALRECIELFTTMETLGEHDPWYCPT
FT                   CKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPVRALNMSEFVCDRSA
FT                   RPYVYDLIAVSNHYGAMGVGHYTAYAKNRLNGKWYYFDDSSVSLASEDQIVTKAAYVLF
FT                   YQRRDDECSSTSSLGSFPGSDGGVKLSSSHQGMGDEEAYNMDTN"
FT   gene            complement(19131085..19132024)
FT                   /pseudo
FT                   /locus_tag="mCG_13022"
FT                   /note="gene_id=mCG13022.2"
FT   mRNA            complement(19131085..19132024)
FT                   /pseudo
FT                   /locus_tag="mCG_13022"
FT                   /note="gene_id=mCG13022.2 transcript_id=mCT13767.2 created
FT                   on 17-JUL-2002"
FT   gene            19165759..19170689
FT                   /gene="1700102P08Rik"
FT                   /locus_tag="mCG_13016"
FT                   /note="gene_id=mCG13016.2"
FT   mRNA            join(19165759..19165784,19166160..19166564,
FT                   19168220..19168311,19170119..19170689)
FT                   /gene="1700102P08Rik"
FT                   /locus_tag="mCG_13016"
FT                   /product="RIKEN cDNA 1700102P08"
FT                   /note="gene_id=mCG13016.2 transcript_id=mCT13761.2 created
FT                   on 17-JUL-2002"
FT   CDS             join(19166164..19166564,19168220..19168311,
FT                   19170119..19170384)
FT                   /codon_start=1
FT                   /gene="1700102P08Rik"
FT                   /locus_tag="mCG_13016"
FT                   /product="RIKEN cDNA 1700102P08"
FT                   /note="gene_id=mCG13016.2 transcript_id=mCT13761.2
FT                   protein_id=mCP22539.2"
FT                   /protein_id="EDL21283.1"
FT                   /translation="MSEKLRRCRKELTAAIDRAFEGVRHSQECTAQQRLDAPSLTSQPV
FT                   HRLLCRNPLAACPSAAPYSGASCAPESENPAFGTHHIPVNSKLQQPLYPKRKPLTSKEN
FT                   VLMQSSILARDRQFWRAAGDGEDWRKDSLRKDMERDLKADPNVLLSSSSQEVTKDLLDM
FT                   IDHTSIRTIEELAGKLEFENELNRVCGHCQDSPFKEEAWALLVDESPQKALDADPGSLK
FT                   QALDDQNIVETVLDLEEDYNLMTSFKYQIE"
FT   gene            complement(<19177691..>19201454)
FT                   /locus_tag="mCG_134088"
FT                   /note="gene_id=mCG134088.1"
FT   mRNA            complement(join(<19177691..19178782,19179539..19179642,
FT                   19185488..19185575,19185958..19186006,19190294..19190457,
FT                   19194362..19194533,19201399..>19201454))
FT                   /locus_tag="mCG_134088"
FT                   /product="mCG134088"
FT                   /note="gene_id=mCG134088.1 transcript_id=mCT135466.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(19177691..19178782,19179539..19179642,
FT                   19185488..19185575,19185958..19186006,19190294..19190457,
FT                   19194362..19194533,19201399..19201454))
FT                   /codon_start=1
FT                   /locus_tag="mCG_134088"
FT                   /product="mCG134088"
FT                   /note="gene_id=mCG134088.1 transcript_id=mCT135466.1
FT                   protein_id=mCP68562.1"
FT                   /protein_id="EDL21284.1"
FT                   /translation="MNFNVWNVKEMLSIPSGSGITKPSNWNNNQTDCSLSDSQFLFGSQ
FT                   FCPENSETLLPSLDAGACLRHPKQTQQNSVDSEPSIFIKYQAKPQLLGGDTKDESLFSL
FT                   PLPVGKSKGLSKQFEEKKRRATDQSDSETLHSFVSHFPEVINKLQTSVEKTEENLSSRS
FT                   QSILDSVETIAKTFQETARVQHDLMVESVRDKGSMEQAILEIQRTCAARQAEFMEMKST
FT                   LKNLEVLVVEQTKNLQQFCDNLSQLIVPGILEELKKFTSVPQVAGHLKDSTSQTSPSLT
FT                   QSLHFTRQEKHPSEEPATWQAQEAPAGNPSTSSQRPGECGVWDEGAESGVFQKAALPTD
FT                   GLHRGDGHVKNKTVPTYCKNWVMTTRSVSNHFSNLPSQRAGNGQGLMAQGASQRDVSKF
FT                   EARVKNACPEYGPQSMCSFDSLEQSATEQKGRPCRKRRRGKKQQPQRSKRGGLLDRKQG
FT                   QTSKAACAFIARHHCPQSPVCDPQGPLICWLTPRSSTKSTCHILGGTGETSQTARAAQG
FT                   NLVQHSQRSSTDSSSQGDQQINWFSDLSLENLEPPQCKKGGTNLLCDPDFDSSDDNF"
FT   gene            19209343..>19218988
FT                   /gene="BC048562"
FT                   /locus_tag="mCG_16497"
FT                   /note="gene_id=mCG16497.2"
FT   mRNA            join(19209343..19209439,19211330..19211443,
FT                   19218106..19218162,19218572..>19218988)
FT                   /gene="BC048562"
FT                   /locus_tag="mCG_16497"
FT                   /product="cDNA sequence BC048562"
FT                   /note="gene_id=mCG16497.2 transcript_id=mCT18919.2 created
FT                   on 06-AUG-2002"
FT   CDS             join(19209413..19209439,19211330..19211443,
FT                   19218106..19218162,19218572..19218988)
FT                   /codon_start=1
FT                   /gene="BC048562"
FT                   /locus_tag="mCG_16497"
FT                   /product="cDNA sequence BC048562"
FT                   /note="gene_id=mCG16497.2 transcript_id=mCT18919.2
FT                   protein_id=mCP23353.2"
FT                   /db_xref="GOA:Q80ZQ7"
FT                   /db_xref="InterPro:IPR029369"
FT                   /db_xref="MGI:MGI:3618861"
FT                   /db_xref="UniProtKB/TrEMBL:Q80ZQ7"
FT                   /protein_id="EDL21285.1"
FT                   /translation="MQGALIGSWHNSGFYGHYRGQVKSESAGEYRLAAKPPPPAVFLQR
FT                   CEEPTKQHYFSKHDNRTSFDKGPYCLLQGIGRRKDLERLWKRHTFLRWAPCELELSQQP
FT                   PLESSYQTDFRSGTGLARLPQRLVQFVQVQPSYANTTYQHNFCQPSRGGHCGSAKVRPL
FT                   EPVTETLPDLPGITKPKLLQHYLHAGVSECLNWSQALKRFS"
FT   gene            complement(19220545..>19234480)
FT                   /gene="Klhdc8b"
FT                   /locus_tag="mCG_16484"
FT                   /note="gene_id=mCG16484.2"
FT   mRNA            complement(join(19220545..19221391,19221732..19221833,
FT                   19221965..19222189,19222519..19222683,19223774..19224289,
FT                   19225215..19225637,19227692..19227810,19228293..19228474,
FT                   19231576..19231735,19232124..19232208,19234352..>19234480))
FT                   /gene="Klhdc8b"
FT                   /locus_tag="mCG_16484"
FT                   /product="kelch domain containing 8B, transcript variant
FT                   mCT18910"
FT                   /note="gene_id=mCG16484.2 transcript_id=mCT18910.2 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(19220545..19221391,19221732..19221833,
FT                   19221965..19222189,19222519..19222683,19223774..19224289,
FT                   19225215..19225637,19227692..19227810,19228293..19228474,
FT                   19231576..19231735,19232124..19232208,19233715..19233830))
FT                   /gene="Klhdc8b"
FT                   /locus_tag="mCG_16484"
FT                   /product="kelch domain containing 8B, transcript variant
FT                   mCT171611"
FT                   /note="gene_id=mCG16484.2 transcript_id=mCT171611.0 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(19220545..19221391,19221732..19221833,
FT                   19221965..19222189,19222519..19222683,19223774..19224289,
FT                   19225215..19225637,19227692..19227810,19228293..19228474,
FT                   19231576..19231735,19233710..19233823))
FT                   /gene="Klhdc8b"
FT                   /locus_tag="mCG_16484"
FT                   /product="kelch domain containing 8B, transcript variant
FT                   mCT171610"
FT                   /note="gene_id=mCG16484.2 transcript_id=mCT171610.0 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(19221195..19221391,19221732..19221833,
FT                   19221965..19222189,19222519..19222683,19223774..>19224158))
FT                   /codon_start=1
FT                   /gene="Klhdc8b"
FT                   /locus_tag="mCG_16484"
FT                   /product="kelch domain containing 8B, isoform CRA_b"
FT                   /note="gene_id=mCG16484.2 transcript_id=mCT18910.2
FT                   protein_id=mCP23362.0 isoform=CRA_b"
FT                   /protein_id="EDL21288.1"
FT                   /translation="ASTMAAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRA
FT                   GLPLDTAETLDMGSHTWLALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFL
FT                   ADEGRWERRATLPQAAMGVATVERDGMVYALGGMGPDTAPQAQVLVYEPRRDCWLSLPS
FT                   MPTPCYGASTFLHGNKIYVLGGRQGKLPVTAFEAFDLETRTWTRHPSLPSRRAFAGCAM
FT                   AEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGS
FT                   LGGNIVAIGGLGNQPCPLASVESFSLARRRWEVLPAMPTARCSCSSLQAGPRLFVIGGV
FT                   AQGPSQAVEALCLRDGV"
FT   CDS             complement(join(19221195..19221391,19221732..19221833,
FT                   19221965..19222189,19222519..19222683,19223774..19224149))
FT                   /codon_start=1
FT                   /gene="Klhdc8b"
FT                   /locus_tag="mCG_16484"
FT                   /product="kelch domain containing 8B, isoform CRA_a"
FT                   /note="gene_id=mCG16484.2 transcript_id=mCT171610.0
FT                   protein_id=mCP94529.0 isoform=CRA_a"
FT                   /protein_id="EDL21286.1"
FT                   /translation="MAAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLP
FT                   LDTAETLDMGSHTWLALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLADE
FT                   GRWERRATLPQAAMGVATVERDGMVYALGGMGPDTAPQAQVLVYEPRRDCWLSLPSMPT
FT                   PCYGASTFLHGNKIYVLGGRQGKLPVTAFEAFDLETRTWTRHPSLPSRRAFAGCAMAEG
FT                   SVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGSLGG
FT                   NIVAIGGLGNQPCPLASVESFSLARRRWEVLPAMPTARCSCSSLQAGPRLFVIGGVAQG
FT                   PSQAVEALCLRDGV"
FT   CDS             complement(join(19221195..19221391,19221732..19221833,
FT                   19221965..19222189,19222519..19222683,19223774..19224149))
FT                   /codon_start=1
FT                   /gene="Klhdc8b"
FT                   /locus_tag="mCG_16484"
FT                   /product="kelch domain containing 8B, isoform CRA_a"
FT                   /note="gene_id=mCG16484.2 transcript_id=mCT171611.0
FT                   protein_id=mCP94530.0 isoform=CRA_a"
FT                   /protein_id="EDL21287.1"
FT                   /translation="MAAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLP
FT                   LDTAETLDMGSHTWLALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLADE
FT                   GRWERRATLPQAAMGVATVERDGMVYALGGMGPDTAPQAQVLVYEPRRDCWLSLPSMPT
FT                   PCYGASTFLHGNKIYVLGGRQGKLPVTAFEAFDLETRTWTRHPSLPSRRAFAGCAMAEG
FT                   SVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGSLGG
FT                   NIVAIGGLGNQPCPLASVESFSLARRRWEVLPAMPTARCSCSSLQAGPRLFVIGGVAQG
FT                   PSQAVEALCLRDGV"
FT   gene            19233450..19238842
FT                   /gene="Ccdc71"
FT                   /locus_tag="mCG_16486"
FT                   /note="gene_id=mCG16486.2"
FT   mRNA            join(19233450..19233516,19235837..19238842)
FT                   /gene="Ccdc71"
FT                   /locus_tag="mCG_16486"
FT                   /product="coiled-coil domain containing 71, transcript
FT                   variant mCT18911"
FT                   /note="gene_id=mCG16486.2 transcript_id=mCT18911.2 created
FT                   on 19-JUL-2002"
FT   mRNA            join(19234320..19234493,19235837..19238842)
FT                   /gene="Ccdc71"
FT                   /locus_tag="mCG_16486"
FT                   /product="coiled-coil domain containing 71, transcript
FT                   variant mCT170756"
FT                   /note="gene_id=mCG16486.2 transcript_id=mCT170756.0 created
FT                   on 19-JUL-2002"
FT   CDS             19235889..19237190
FT                   /codon_start=1
FT                   /gene="Ccdc71"
FT                   /locus_tag="mCG_16486"
FT                   /product="coiled-coil domain containing 71, isoform CRA_a"
FT                   /note="gene_id=mCG16486.2 transcript_id=mCT170756.0
FT                   protein_id=mCP93674.0 isoform=CRA_a"
FT                   /protein_id="EDL21289.1"
FT                   /translation="MSMVVQPVEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATE
FT                   AQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTASPPSQTKLQARTINPPATSLPKTAVS
FT                   VPAGRTTLLPVPLSGRLAKGSTAALAKHATTNLLLSSLKQSSASNSSGTTVGFPAHLYP
FT                   GVYPAMRLSVVLEALVPLKTPCLDVKHGAQSLQLSLAKSPLKVRKASGNPKSKAPRKIT
FT                   SKGLKHLTSKGPGAGLRRGAGTQSNGAQRKGCSALGPKTVQAQASQTLIKAARAHASVA
FT                   QTQTKTVRVRAKAKQAKPKAARAKAKAAVVRDKAKDKVIQAKAKAAQTKHKGKPKGSVQ
FT                   TRTGRANRKNSSETVGRKRKKAEETKGLPPKKRARCVPRPPKVWLGPGTAKPRKSQTIK
FT                   VDRKCSDDEVRQCAQQILRVNLSPVVWLQPLLPF"
FT   CDS             19235889..19237190
FT                   /codon_start=1
FT                   /gene="Ccdc71"
FT                   /locus_tag="mCG_16486"
FT                   /product="coiled-coil domain containing 71, isoform CRA_a"
FT                   /note="gene_id=mCG16486.2 transcript_id=mCT18911.2
FT                   protein_id=mCP23380.1 isoform=CRA_a"
FT                   /protein_id="EDL21290.1"
FT                   /translation="MSMVVQPVEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATE
FT                   AQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTASPPSQTKLQARTINPPATSLPKTAVS
FT                   VPAGRTTLLPVPLSGRLAKGSTAALAKHATTNLLLSSLKQSSASNSSGTTVGFPAHLYP
FT                   GVYPAMRLSVVLEALVPLKTPCLDVKHGAQSLQLSLAKSPLKVRKASGNPKSKAPRKIT
FT                   SKGLKHLTSKGPGAGLRRGAGTQSNGAQRKGCSALGPKTVQAQASQTLIKAARAHASVA
FT                   QTQTKTVRVRAKAKQAKPKAARAKAKAAVVRDKAKDKVIQAKAKAAQTKHKGKPKGSVQ
FT                   TRTGRANRKNSSETVGRKRKKAEETKGLPPKKRARCVPRPPKVWLGPGTAKPRKSQTIK
FT                   VDRKCSDDEVRQCAQQILRVNLSPVVWLQPLLPF"
FT   gene            19253014..19263711
FT                   /gene="Lamb2"
FT                   /locus_tag="mCG_16501"
FT                   /note="gene_id=mCG16501.2"
FT   mRNA            join(19253014..19253106,19253195..19253280,
FT                   19253415..19253587,19253675..19253810,19253893..19253966,
FT                   19254371..19254559,19254641..19254704,19254945..19255147,
FT                   19255238..19255358,19255645..19255833,19256018..19256197,
FT                   19256308..19256420,19256667..19256746,19256825..19256957,
FT                   19257148..19257306,19257383..19257510,19258369..19258495,
FT                   19258680..19258872,19258949..19259092,19259297..19259528,
FT                   19259604..19259767,19259846..19260070,19260158..19260375,
FT                   19260475..19260571,19260658..19261030,19261129..19261313,
FT                   19261387..19261628,19261708..19262056,19262349..19262556,
FT                   19262635..19262776,19262959..19263135,19263228..19263387,
FT                   19263466..19263711)
FT                   /gene="Lamb2"
FT                   /locus_tag="mCG_16501"
FT                   /product="laminin, beta 2, transcript variant mCT18926"
FT                   /note="gene_id=mCG16501.2 transcript_id=mCT18926.1 created
FT                   on 17-JUL-2002"
FT   mRNA            join(19253028..19253111,19253195..19253280,
FT                   19253415..19253587,19253675..19253810,19253893..19253966,
FT                   19254371..19254559,19254641..19254704,19254945..19255147,
FT                   19255238..19255358,19255645..19255833,19256018..19256197,
FT                   19256308..19256420,19256667..19256746,19256825..19256957,
FT                   19257148..19257306,19257383..19257510,19258369..19258495,
FT                   19258680..19258872,19258949..19259092,19259297..19259528,
FT                   19259604..19259767,19259846..19260070,19260158..19260375,
FT                   19260475..19260571,19260658..19261030,19261129..19261313,
FT                   19261387..19261628,19261708..19262056,19262349..19262556,
FT                   19262635..19262776,19262959..19263135,19263228..19263387,
FT                   19263466..19263711)
FT                   /gene="Lamb2"
FT                   /locus_tag="mCG_16501"
FT                   /product="laminin, beta 2, transcript variant mCT170763"
FT                   /note="gene_id=mCG16501.2 transcript_id=mCT170763.0 created
FT                   on 17-JUL-2002"
FT   CDS             join(19253196..19253280,19253415..19253587,
FT                   19253675..19253810,19253893..19253966,19254371..19254559,
FT                   19254641..19254704,19254945..19255147,19255238..19255358,
FT                   19255645..19255833,19256018..19256197,19256308..19256420,
FT                   19256667..19256746,19256825..19256957,19257148..19257306,
FT                   19257383..19257510,19258369..19258495,19258680..19258872,
FT                   19258949..19259092,19259297..19259528,19259604..19259767,
FT                   19259846..19260070,19260158..19260375,19260475..19260571,
FT                   19260658..19261030,19261129..19261313,19261387..19261628,
FT                   19261708..19262056,19262349..19262556,19262635..19262776,
FT                   19262959..19263135,19263228..19263387,19263466..19263602)
FT                   /codon_start=1
FT                   /gene="Lamb2"
FT                   /locus_tag="mCG_16501"
FT                   /product="laminin, beta 2, isoform CRA_a"
FT                   /note="gene_id=mCG16501.2 transcript_id=mCT18926.1
FT                   protein_id=mCP23377.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q61292"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="InterPro:IPR008211"
FT                   /db_xref="InterPro:IPR013015"
FT                   /db_xref="MGI:MGI:99916"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61292"
FT                   /protein_id="EDL21291.1"
FT                   /translation="MEWASGEPGRGRQGQPLPWELRLGLLLSVLAATLAQAPSLDVPGC
FT                   SRGSCYPATGDLLVGRADRLTASSTCGLHSPQPYCIVSHLQDEKKCFLCDSRRPFSARD
FT                   NPNSHRIQNVVTSFAPQRRTAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAM
FT                   LVERSADFGRTWHVYRYFSYDCGADFPGIPLAPPRRWDDVVCESRYSEIEPSTEGEVIY
FT                   RVLDPAIPIPDPYSSRIQNLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELV
FT                   IRGNCFCYGHASQCAPAPGAPAHAEGMVHGACICKHNTRGLNCEQCQDFYQDLPWHPAE
FT                   DGHTHACRKCECNGHTHSCHFDMAVYLASGNVSGGVCDGCQHNTAGRHCEFCRPFFYRD
FT                   PTKDMRDPAVCRPCDCDPMGSQDGGRCDSHDDPVLGLVSGQCRCKEHVVGTRCQQCRDG
FT                   FFGLSASDPRGCQRCQCNSRGTVPGSSPCDSSSGTCFCKRLVTGHGCDRCLPGHWGLSH
FT                   DLLGCRPCDCDVGGALDPQCDEATGQCRCRQHMIGRRCEQVQPGYFRPFLDHLTWEAEA
FT                   AQGQGLEVVERLVTNRETPSWTGPGFVRLREGQEVEFLVTSLPRAMDYDLLLRWEPQVP
FT                   EQWAELELMVQRPGPVSAHSPCGHVLPKDDRIQGMLHPNTRFLVFPRPVCLEPGISYKL
FT                   KLKLIGTGGRAQPETSYSGLLIDSLVLQPHVLVLEMFSGGDAAALERRTTFERYRCHEE
FT                   GLMPSKAPLSETCAPLLISVSALIYNGALPCQCDPQGSLSSECSPHGGQCRCKPGVVGR
FT                   RCDVCATGYYGFGPAGCQACQCSPDGALSALCEGTSGQCPCRPGAFGLRCDHCQRGQWG
FT                   FPNCRPCVCNGRADECDTHTGACLGCRDYTGGEHCERCIAGFHGDPRLPYGGQCRPCPC
FT                   PEGPGSQRHFATSCHRDGYSQQIVCQCREGYTGLRCEACAPGHFGDPSKPGGRCQLCEC
FT                   SGNIDPMDPDACDPHTGQCLRCLHNTEGPHCGYCKPGFHGQAARQSCHRCTCNLLGTDP
FT                   RRCPSTDLCHCDPSTGQCPCLPHVQGLNCDHCAPNFWNFTSGRGCQPCACHPSRARGPT
FT                   CNEFTGQCHCHAGFGGRTCSECQELYWGDPGLQCRACDCDPRGIDKPQCHRSTGHCSCR
FT                   PGVSGVRCDQCARGFSGVFPACHPCHACFGDWDRVVQDLAARTRRLEQWAQELQQTGVL
FT                   GAFESSFLNMQGKLGMVQAIMSARNASAASTAKLVEATEGLRHEIGKTTERLTQLEAEL
FT                   TAVQDENFNANHALSGLERDGLALNLTLRQLDQHLEILKHSNFLGAYDSIRHAHSQSTE
FT                   AERRANASTFAVPSPVSNSADTRRRTEVLMGAQKENFNRQHLANQQALGRLSAHAHTLS
FT                   LTGINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGLGCSGAAATADLALGRARHTQ
FT                   AELQRALVEGGGILSRVSETRRQAEEAQQRAQAALDKANASRGQVEQANQELRELIQNV
FT                   KDFLSQEGADPDSIEMVATRVLDISIPASPEQIQRLASEIAERVRSLADVDTILAHTMG
FT                   DVRRAEQLLQDAHRARSRAEGERQKAETVQAALEEAQRAQGAAQGAIWGAVVDTQNTEQ
FT                   TLQRVQERMAGAEKSLNSAGERARQLDALLEALKLKRAGNSLAASTAEETAGSAQSRAR
FT                   EAEKQLREQVGDQYQTVRALAERKAEGVLAAQARAEQLRDEARDLLQAAQDKLQRLQEL
FT                   EGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ"
FT   CDS             join(19253196..19253280,19253415..19253587,
FT                   19253675..19253810,19253893..19253966,19254371..19254559,
FT                   19254641..19254704,19254945..19255147,19255238..19255358,
FT                   19255645..19255833,19256018..19256197,19256308..19256420,
FT                   19256667..19256746,19256825..19256957,19257148..19257306,
FT                   19257383..19257510,19258369..19258495,19258680..19258872,
FT                   19258949..19259092,19259297..19259528,19259604..19259767,
FT                   19259846..19260070,19260158..19260375,19260475..19260571,
FT                   19260658..19261030,19261129..19261313,19261387..19261628,
FT                   19261708..19262056,19262349..19262556,19262635..19262776,
FT                   19262959..19263135,19263228..19263387,19263466..19263602)
FT                   /codon_start=1
FT                   /gene="Lamb2"
FT                   /locus_tag="mCG_16501"
FT                   /product="laminin, beta 2, isoform CRA_a"
FT                   /note="gene_id=mCG16501.2 transcript_id=mCT170763.0
FT                   protein_id=mCP93681.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q61292"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="InterPro:IPR008211"
FT                   /db_xref="InterPro:IPR013015"
FT                   /db_xref="MGI:MGI:99916"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61292"
FT                   /protein_id="EDL21292.1"
FT                   /translation="MEWASGEPGRGRQGQPLPWELRLGLLLSVLAATLAQAPSLDVPGC
FT                   SRGSCYPATGDLLVGRADRLTASSTCGLHSPQPYCIVSHLQDEKKCFLCDSRRPFSARD
FT                   NPNSHRIQNVVTSFAPQRRTAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAM
FT                   LVERSADFGRTWHVYRYFSYDCGADFPGIPLAPPRRWDDVVCESRYSEIEPSTEGEVIY
FT                   RVLDPAIPIPDPYSSRIQNLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELV
FT                   IRGNCFCYGHASQCAPAPGAPAHAEGMVHGACICKHNTRGLNCEQCQDFYQDLPWHPAE
FT                   DGHTHACRKCECNGHTHSCHFDMAVYLASGNVSGGVCDGCQHNTAGRHCEFCRPFFYRD
FT                   PTKDMRDPAVCRPCDCDPMGSQDGGRCDSHDDPVLGLVSGQCRCKEHVVGTRCQQCRDG
FT                   FFGLSASDPRGCQRCQCNSRGTVPGSSPCDSSSGTCFCKRLVTGHGCDRCLPGHWGLSH
FT                   DLLGCRPCDCDVGGALDPQCDEATGQCRCRQHMIGRRCEQVQPGYFRPFLDHLTWEAEA
FT                   AQGQGLEVVERLVTNRETPSWTGPGFVRLREGQEVEFLVTSLPRAMDYDLLLRWEPQVP
FT                   EQWAELELMVQRPGPVSAHSPCGHVLPKDDRIQGMLHPNTRFLVFPRPVCLEPGISYKL
FT                   KLKLIGTGGRAQPETSYSGLLIDSLVLQPHVLVLEMFSGGDAAALERRTTFERYRCHEE
FT                   GLMPSKAPLSETCAPLLISVSALIYNGALPCQCDPQGSLSSECSPHGGQCRCKPGVVGR
FT                   RCDVCATGYYGFGPAGCQACQCSPDGALSALCEGTSGQCPCRPGAFGLRCDHCQRGQWG
FT                   FPNCRPCVCNGRADECDTHTGACLGCRDYTGGEHCERCIAGFHGDPRLPYGGQCRPCPC
FT                   PEGPGSQRHFATSCHRDGYSQQIVCQCREGYTGLRCEACAPGHFGDPSKPGGRCQLCEC
FT                   SGNIDPMDPDACDPHTGQCLRCLHNTEGPHCGYCKPGFHGQAARQSCHRCTCNLLGTDP
FT                   RRCPSTDLCHCDPSTGQCPCLPHVQGLNCDHCAPNFWNFTSGRGCQPCACHPSRARGPT
FT                   CNEFTGQCHCHAGFGGRTCSECQELYWGDPGLQCRACDCDPRGIDKPQCHRSTGHCSCR
FT                   PGVSGVRCDQCARGFSGVFPACHPCHACFGDWDRVVQDLAARTRRLEQWAQELQQTGVL
FT                   GAFESSFLNMQGKLGMVQAIMSARNASAASTAKLVEATEGLRHEIGKTTERLTQLEAEL
FT                   TAVQDENFNANHALSGLERDGLALNLTLRQLDQHLEILKHSNFLGAYDSIRHAHSQSTE
FT                   AERRANASTFAVPSPVSNSADTRRRTEVLMGAQKENFNRQHLANQQALGRLSAHAHTLS
FT                   LTGINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGLGCSGAAATADLALGRARHTQ
FT                   AELQRALVEGGGILSRVSETRRQAEEAQQRAQAALDKANASRGQVEQANQELRELIQNV
FT                   KDFLSQEGADPDSIEMVATRVLDISIPASPEQIQRLASEIAERVRSLADVDTILAHTMG
FT                   DVRRAEQLLQDAHRARSRAEGERQKAETVQAALEEAQRAQGAAQGAIWGAVVDTQNTEQ
FT                   TLQRVQERMAGAEKSLNSAGERARQLDALLEALKLKRAGNSLAASTAEETAGSAQSRAR
FT                   EAEKQLREQVGDQYQTVRALAERKAEGVLAAQARAEQLRDEARDLLQAAQDKLQRLQEL
FT                   EGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ"
FT   gene            19263898..19275485
FT                   /gene="Usp19"
FT                   /locus_tag="mCG_16487"
FT                   /note="gene_id=mCG16487.3"
FT   mRNA            join(19263898..19264077,19265623..19265882,
FT                   19266120..19266152,19266288..19266416,19266502..19266635,
FT                   19266713..19267015,19267167..19267389,19267518..19267674,
FT                   19267778..19267849,19267963..19268078,19268185..19268405,
FT                   19268688..19268883,19268962..19269095,19269220..19269378,
FT                   19269455..19269565,19270002..19270112,19270216..19270317,
FT                   19271046..19271186,19271273..19271391,19271592..19271729,
FT                   19271830..19272143,19272245..19272355,19272444..19272660,
FT                   19272742..19272894,19273000..19273160,19273241..19273419,
FT                   19274990..19275467)
FT                   /gene="Usp19"
FT                   /locus_tag="mCG_16487"
FT                   /product="ubiquitin specific peptidase 19, transcript
FT                   variant mCT170757"
FT                   /note="gene_id=mCG16487.3 transcript_id=mCT170757.0 created
FT                   on 06-AUG-2002"
FT   mRNA            join(19263898..19264077,19265623..19265882,
FT                   19266120..19266152,19266288..19266416,19266502..19266635,
FT                   19266713..19267015,19267167..19267389,19267518..19267674,
FT                   19267778..19267849,19267963..19268078,19268185..19268405,
FT                   19268688..19268883,19268962..19269095,19269220..19269378,
FT                   19269455..19269565,19270002..19270112,19270216..19270317,
FT                   19271046..19271186,19271273..19271391,19271592..19271729,
FT                   19271830..19272143,19272245..19272355,19272444..19272660,
FT                   19272742..19272894,19273000..19273160,19273241..19273419,
FT                   19274344..19274847)
FT                   /gene="Usp19"
FT                   /locus_tag="mCG_16487"
FT                   /product="ubiquitin specific peptidase 19, transcript
FT                   variant mCT18912"
FT                   /note="gene_id=mCG16487.3 transcript_id=mCT18912.2 created
FT                   on 06-AUG-2002"
FT   mRNA            join(<19263930..19264077,19265623..19265882,
FT                   19266120..19266152,19266288..19266416,19266502..19266635,
FT                   19266716..19267015,19267167..19267389,19267518..19267674,
FT                   19267778..19267849,19267963..19268078,19268185..19268405,
FT                   19268688..19268883,19268962..19269095,19269220..19269378,
FT                   19269455..19269565,19270002..19270112,19270216..19270317,
FT                   19271046..19271186,19271273..19271391,19271592..19271729,
FT                   19271830..19272143,19272245..19272355,19272444..19272660,
FT                   19272742..19272894,19273000..19273160,19273241..19273419,
FT                   19274344..19274847)
FT                   /gene="Usp19"
FT                   /locus_tag="mCG_16487"
FT                   /product="ubiquitin specific peptidase 19, transcript
FT                   variant mCT191509"
FT                   /note="gene_id=mCG16487.3 transcript_id=mCT191509.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<19264022..19264077,19265623..19265882,
FT                   19266120..19266152,19266288..19266416,19266502..19266635,
FT                   19266716..19267015,19267167..19267389,19267518..19267674,
FT                   19267963..19268078,19268185..19268405,19268688..19268883,
FT                   19268962..19269095,19269220..19269378,19269455..19269565,
FT                   19270002..19270112,19270216..19270317,19271046..19271186,
FT                   19271273..19271391,19271592..19271729,19271830..19272143,
FT                   19272245..19272355,19272444..19272660,19272742..19272894,
FT                   19273000..19273160,19273241..19273419,19274990..19275485)
FT                   /gene="Usp19"
FT                   /locus_tag="mCG_16487"
FT                   /product="ubiquitin specific peptidase 19, transcript
FT                   variant mCT191510"
FT                   /note="gene_id=mCG16487.3 transcript_id=mCT191510.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<19265642..19265882,19266120..19266152,
FT                   19266288..19266416,19266502..19266635,19266716..19267015,
FT                   19267167..19267389,19267518..19267674,19267963..19268078,
FT                   19268185..19268405,19268688..19268883,19268962..19269095,
FT                   19269220..19269378,19269455..19269565,19270002..19270112,
FT                   19270216..19270317,19271046..19271186,19271273..19271391,
FT                   19271592..19271729,19271830..19272143,19272245..19272355,
FT                   19272444..19272660,19272742..19272894,19273000..19273160,
FT                   19273241..19273419,19274990..19275106)
FT                   /codon_start=1
FT                   /gene="Usp19"
FT                   /locus_tag="mCG_16487"
FT                   /product="ubiquitin specific peptidase 19, isoform CRA_d"
FT                   /note="gene_id=mCG16487.3 transcript_id=mCT191510.0
FT                   protein_id=mCP112483.0 isoform=CRA_d"
FT                   /protein_id="EDL21296.1"
FT                   /translation="RIWPQRVAKIAGPGRKRRSPDPDAVADSGPLWLATKRLKMSAGAS
FT                   ATGPRRGPPGLEEATSKKKQKDRANLESKDGDARRVSLPRKEPTKDELLLDWRQSADEV
FT                   IVKLRVGTGPVRLEDVDAAFTDTDCVVRLPDGRQWGGVFFAEIQSSCTKVQARKGGLLQ
FT                   LVLPKKVPLLTWPSLLKPLGTQELVPGLQCQENGQELSPIALEPGSEPRRAKQEARNQK
FT                   RAQGRGEVGSGAGPGTQAGPSAKRAVHLRRGPEGEGSMDGPGPQGDAPSFLSDSATQVE
FT                   AEEKLCAPPMNTQTSLLSSEKSLALLTVEKTVSPRNDPVAPVMVQDRDPEPEQEDQVKE
FT                   EMALGADPTALVEEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEIRRDSSRVLFREQDF
FT                   TLIFQTRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPATRGAVGGAKVAVPTGP
FT                   TPLDSTPPGGGPHPLTGQEEARAVEKEKPKARSEDSGLDGVVARTPLEHVAPKPDPHLA
FT                   SPKPTCMVPPMPHSPVSGDSVEEDEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSLSNTR
FT                   ELRDFFHDRSFEAEINYNNPLGTGGRLAIGFAVLLRALWKGTHQAFQPSKLKAIVASKA
FT                   SQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDEVVAEEAWQRHKMR
FT                   NDSFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPLPQKQKVLPIFYFAREPHSKP
FT                   IKFLVSVSKENSSASEVLDSLSQSVHVKPENLRLAEVIKNRFHRVFLPSHSLDAVSPTD
FT                   VLLCFELLSPELAKERVVVLEVQQRPQVPSIPISKCAACQRKQQSEEEKLKRCTRCYRV
FT                   GYCNQFCQKTHWPDHKGLCRPENIGYPFLVSVPASRLTYARLAQLLEGYARYSVSVFQP
FT                   PFQPGRMALESQSPGCTTLLSTSSLEAGDSEREPIQPSELQLVTPVAEGDTGAHRVWPP
FT                   ADRGPVPSTSGLSSEMLASGPIEGCPLLAGERVSRPEAAVPGYQHSSESVNTHTPQFFI
FT                   YKIDASNREQRLEDKGETPLELGDDCSLALVWRNNERLQEFVLVASKELECAEDPGSAG
FT                   EAARAGHFTLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKR
FT                   FSFRSFIWRDKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGGHYTA
FT                   CARLPNDRSSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFYRRRNSPVERPPRASHS
FT                   EHHPDLGPAAEAAASQGLGPGQAPEVAPTRTAPERFAPPVDRPAPTYSNMEEVD"
FT   CDS             join(<19265642..19265882,19266120..19266152,
FT                   19266288..19266416,19266502..19266635,19266716..19267015,
FT                   19267167..19267389,19267518..19267674,19267778..19267849,
FT                   19267963..19268078,19268185..19268405,19268688..19268883,
FT                   19268962..19269095,19269220..19269378,19269455..19269565,
FT                   19270002..19270112,19270216..19270317,19271046..19271186,
FT                   19271273..19271391,19271592..19271729,19271830..19272143,
FT                   19272245..19272355,19272444..19272660,19272742..19272894,
FT                   19273000..19273160,19273241..19273419,19274344..19274571)
FT                   /codon_start=1
FT                   /gene="Usp19"
FT                   /locus_tag="mCG_16487"
FT                   /product="ubiquitin specific peptidase 19, isoform CRA_c"
FT                   /note="gene_id=mCG16487.3 transcript_id=mCT191509.0
FT                   protein_id=mCP112482.0 isoform=CRA_c"
FT                   /protein_id="EDL21295.1"
FT                   /translation="RIWPQRVAKIAGPGRKRRSPDPDAVADSGPLWLATKRLKMSAGAS
FT                   ATGPRRGPPGLEEATSKKKQKDRANLESKDGDARRVSLPRKEPTKDELLLDWRQSADEV
FT                   IVKLRVGTGPVRLEDVDAAFTDTDCVVRLPDGRQWGGVFFAEIQSSCTKVQARKGGLLQ
FT                   LVLPKKVPLLTWPSLLKPLGTQELVPGLQCQENGQELSPIALEPGSEPRRAKQEARNQK
FT                   RAQGRGEVGSGAGPGTQAGPSAKRAVHLRRGPEGEGSMDGPGPQGDAPSFLSDSATQVE
FT                   AEEKLCAPPMNTQTSLLSSEKSLALLTVEKTVSPRNDPVAPVMVQDRDPEPEQEDQVKE
FT                   EMALGADPTALVEEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEIRRDSSRVLFREQDF
FT                   TLIFQTRDGNFLRLHPGCGPHTIFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQR
FT                   WGGLEAPATRGAVGGAKVAVPTGPTPLDSTPPGGGPHPLTGQEEARAVEKEKPKARSED
FT                   SGLDGVVARTPLEHVAPKPDPHLASPKPTCMVPPMPHSPVSGDSVEEDEEEEKKVCLPG
FT                   FTGLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFEAEINYNNPLGTGGRLAIGFAVLL
FT                   RALWKGTHQAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYT
FT                   ETVDSDGRPDEVVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYL
FT                   PVPLPQKQKVLPIFYFAREPHSKPIKFLVSVSKENSSASEVLDSLSQSVHVKPENLRLA
FT                   EVIKNRFHRVFLPSHSLDAVSPTDVLLCFELLSPELAKERVVVLEVQQRPQVPSIPISK
FT                   CAACQRKQQSEEEKLKRCTRCYRVGYCNQFCQKTHWPDHKGLCRPENIGYPFLVSVPAS
FT                   RLTYARLAQLLEGYARYSVSVFQPPFQPGRMALESQSPGCTTLLSTSSLEAGDSEREPI
FT                   QPSELQLVTPVAEGDTGAHRVWPPADRGPVPSTSGLSSEMLASGPIEGCPLLAGERVSR
FT                   PEAAVPGYQHSSESVNTHTPQFFIYKIDASNREQRLEDKGETPLELGDDCSLALVWRNN
FT                   ERLQEFVLVASKELECAEDPGSAGEAARAGHFTLDQCLNLFTRPEVLAPEEAWYCPQCK
FT                   QHREASKQLLLWRLPNVLIVQLKRFSFRSFIWRDKINDLVEFPVRNLDLSKFCIGQKEE
FT                   QLPSYDLYAVINHYGGMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDESQVVT
FT                   RYAYVLFYRRRNSPVERPPRASHSEHHPDLGPAAEAAASQASRIWQELEAEEEMVPEGP
FT                   GPLGPWGPQDWVGPPPRGPTTPDEGCLRYFVLGTVAALVALVLNVFYPLVSQSRWR"
FT   CDS             join(19265759..19265882,19266120..19266152,
FT                   19266288..19266416,19266502..19266635,19266713..19267015,
FT                   19267167..19267389,19267518..19267674,19267778..19267849,
FT                   19267963..19268078,19268185..19268405,19268688..19268883,
FT                   19268962..19269095,19269220..19269378,19269455..19269565,
FT                   19270002..19270112,19270216..19270317,19271046..19271186,
FT                   19271273..19271391,19271592..19271729,19271830..19272143,
FT                   19272245..19272355,19272444..19272660,19272742..19272894,
FT                   19273000..19273160,19273241..19273419,19274990..19275106)
FT                   /codon_start=1
FT                   /gene="Usp19"
FT                   /locus_tag="mCG_16487"
FT                   /product="ubiquitin specific peptidase 19, isoform CRA_a"
FT                   /note="gene_id=mCG16487.3 transcript_id=mCT170757.0
FT                   protein_id=mCP93675.0 isoform=CRA_a"
FT                   /db_xref="GOA:J3KMM1"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="MGI:MGI:1918722"
FT                   /db_xref="UniProtKB/TrEMBL:J3KMM1"
FT                   /protein_id="EDL21293.1"
FT                   /translation="MSAGASATGPRRGPPGLEEATSKKKQKDRANLESKDGDARRVSLP
FT                   RKEPTKDELLLDWRQSADEVIVKLRVGTGPVRLEDVDAAFTDTDCVVRLPDGRQWGGVF
FT                   FAEIQSSCTKVQARKGGLLQLVLPKKVPLLTWPSLLKKPLGTQELVPGLQCQENGQELS
FT                   PIALEPGSEPRRAKQEARNQKRAQGRGEVGSGAGPGTQAGPSAKRAVHLRRGPEGEGSM
FT                   DGPGPQGDAPSFLSDSATQVEAEEKLCAPPMNTQTSLLSSEKSLALLTVEKTVSPRNDP
FT                   VAPVMVQDRDPEPEQEDQVKEEMALGADPTALVEEPESMVNLAFVKNDSYEKGPDSVVV
FT                   HVYVKEIRRDSSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTIFRWQVKLRNLIEPEQ
FT                   CTFCFTASRIDICLRKRQSQRWGGLEAPATRGAVGGAKVAVPTGPTPLDSTPPGGGPHP
FT                   LTGQEEARAVEKEKPKARSEDSGLDGVVARTPLEHVAPKPDPHLASPKPTCMVPPMPHS
FT                   PVSGDSVEEDEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFEAE
FT                   INYNNPLGTGGRLAIGFAVLLRALWKGTHQAFQPSKLKAIVASKASQFTGYAQHDAQEF
FT                   MAFLLDGLHEDLNRIQNKPYTETVDSDGRPDEVVAEEAWQRHKMRNDSFIVDLFQGQYK
FT                   SKLVCPVCAKVSITFDPFLYLPVPLPQKQKVLPIFYFAREPHSKPIKFLVSVSKENSSA
FT                   SEVLDSLSQSVHVKPENLRLAEVIKNRFHRVFLPSHSLDAVSPTDVLLCFELLSPELAK
FT                   ERVVVLEVQQRPQVPSIPISKCAACQRKQQSEEEKLKRCTRCYRVGYCNQFCQKTHWPD
FT                   HKGLCRPENIGYPFLVSVPASRLTYARLAQLLEGYARYSVSVFQPPFQPGRMALESQSP
FT                   GCTTLLSTSSLEAGDSEREPIQPSELQLVTPVAEGDTGAHRVWPPADRGPVPSTSGLSS
FT                   EMLASGPIEGCPLLAGERVSRPEAAVPGYQHSSESVNTHTPQFFIYKIDASNREQRLED
FT                   KGETPLELGDDCSLALVWRNNERLQEFVLVASKELECAEDPGSAGEAARAGHFTLDQCL
FT                   NLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWRDKIND
FT                   LVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGGHYTACARLPNDRSSQRSD
FT                   VGWRLFDDSTVTTVDESQVVTRYAYVLFYRRRNSPVERPPRASHSEHHPDLGPAAEAAA
FT                   SQGLGPGQAPEVAPTRTAPERFAPPVDRPAPTYSNMEEVD"
FT   CDS             join(19265759..19265882,19266120..19266152,
FT                   19266288..19266416,19266502..19266635,19266713..19267015,
FT                   19267167..19267389,19267518..19267674,19267778..19267849,
FT                   19267963..19268078,19268185..19268405,19268688..19268883,
FT                   19268962..19269095,19269220..19269378,19269455..19269565,
FT                   19270002..19270112,19270216..19270317,19271046..19271186,
FT                   19271273..19271391,19271592..19271729,19271830..19272143,
FT                   19272245..19272355,19272444..19272660,19272742..19272894,
FT                   19273000..19273160,19273241..19273419,19274344..19274571)
FT                   /codon_start=1
FT                   /gene="Usp19"
FT                   /locus_tag="mCG_16487"
FT                   /product="ubiquitin specific peptidase 19, isoform CRA_b"
FT                   /note="gene_id=mCG16487.3 transcript_id=mCT18912.2
FT                   protein_id=mCP23357.2 isoform=CRA_b"
FT                   /protein_id="EDL21294.1"
FT                   /translation="MSAGASATGPRRGPPGLEEATSKKKQKDRANLESKDGDARRVSLP
FT                   RKEPTKDELLLDWRQSADEVIVKLRVGTGPVRLEDVDAAFTDTDCVVRLPDGRQWGGVF
FT                   FAEIQSSCTKVQARKGGLLQLVLPKKVPLLTWPSLLKKPLGTQELVPGLQCQENGQELS
FT                   PIALEPGSEPRRAKQEARNQKRAQGRGEVGSGAGPGTQAGPSAKRAVHLRRGPEGEGSM
FT                   DGPGPQGDAPSFLSDSATQVEAEEKLCAPPMNTQTSLLSSEKSLALLTVEKTVSPRNDP
FT                   VAPVMVQDRDPEPEQEDQVKEEMALGADPTALVEEPESMVNLAFVKNDSYEKGPDSVVV
FT                   HVYVKEIRRDSSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTIFRWQVKLRNLIEPEQ
FT                   CTFCFTASRIDICLRKRQSQRWGGLEAPATRGAVGGAKVAVPTGPTPLDSTPPGGGPHP
FT                   LTGQEEARAVEKEKPKARSEDSGLDGVVARTPLEHVAPKPDPHLASPKPTCMVPPMPHS
FT                   PVSGDSVEEDEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFEAE
FT                   INYNNPLGTGGRLAIGFAVLLRALWKGTHQAFQPSKLKAIVASKASQFTGYAQHDAQEF
FT                   MAFLLDGLHEDLNRIQNKPYTETVDSDGRPDEVVAEEAWQRHKMRNDSFIVDLFQGQYK
FT                   SKLVCPVCAKVSITFDPFLYLPVPLPQKQKVLPIFYFAREPHSKPIKFLVSVSKENSSA
FT                   SEVLDSLSQSVHVKPENLRLAEVIKNRFHRVFLPSHSLDAVSPTDVLLCFELLSPELAK
FT                   ERVVVLEVQQRPQVPSIPISKCAACQRKQQSEEEKLKRCTRCYRVGYCNQFCQKTHWPD
FT                   HKGLCRPENIGYPFLVSVPASRLTYARLAQLLEGYARYSVSVFQPPFQPGRMALESQSP
FT                   GCTTLLSTSSLEAGDSEREPIQPSELQLVTPVAEGDTGAHRVWPPADRGPVPSTSGLSS
FT                   EMLASGPIEGCPLLAGERVSRPEAAVPGYQHSSESVNTHTPQFFIYKIDASNREQRLED
FT                   KGETPLELGDDCSLALVWRNNERLQEFVLVASKELECAEDPGSAGEAARAGHFTLDQCL
FT                   NLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWRDKIND
FT                   LVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGGHYTACARLPNDRSSQRSD
FT                   VGWRLFDDSTVTTVDESQVVTRYAYVLFYRRRNSPVERPPRASHSEHHPDLGPAAEAAA
FT                   SQASRIWQELEAEEEMVPEGPGPLGPWGPQDWVGPPPRGPTTPDEGCLRYFVLGTVAAL
FT                   VALVLNVFYPLVSQSRWR"
FT   gene            19281470..19289351
FT                   /gene="Qars"
FT                   /locus_tag="mCG_16471"
FT                   /note="gene_id=mCG16471.2"
FT   mRNA            join(19281470..19281614,19281798..19281945,
FT                   19282292..19282401,19282564..19282639,19282856..19282920,
FT                   19283510..19283563,19283703..19283763,19284554..19284625,
FT                   19284746..19284831,19284947..19285033,19285898..19285997,
FT                   19286115..19286193,19286275..19286383,19286481..19286611,
FT                   19286701..19286793,19287084..19287221,19287308..19287395,
FT                   19287480..19287623,19287705..19287809,19287958..19288050,
FT                   19288161..19288288,19288382..19288448,19288522..19288647,
FT                   19289211..19289351)
FT                   /gene="Qars"
FT                   /locus_tag="mCG_16471"
FT                   /product="glutaminyl-tRNA synthetase, transcript variant
FT                   mCT18723"
FT                   /note="gene_id=mCG16471.2 transcript_id=mCT18723.2 created
FT                   on 17-JUL-2002"
FT   mRNA            join(<19281486..19281614,19281798..19281945,
FT                   19282292..19282401,19282564..19282639,19282856..19282920,
FT                   19283510..19283563,19283703..19283763,19284554..19284625,
FT                   19284746..19284831,19284947..19285033,19285898..19285997,
FT                   19286115..19286193,19286275..19286383,19286481..19286611,
FT                   19286701..19286793,19287084..19287221,19287308..19287395,
FT                   19287480..19287623,19287705..19287809,19287958..19288050,
FT                   19288161..19288288,19288382..19289351)
FT                   /gene="Qars"
FT                   /locus_tag="mCG_16471"
FT                   /product="glutaminyl-tRNA synthetase, transcript variant
FT                   mCT191534"
FT                   /note="gene_id=mCG16471.2 transcript_id=mCT191534.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<19281486..19281614,19281798..19281945,
FT                   19282292..19282401,19282564..19282639,19282856..19282920,
FT                   19283510..19283563,19283703..19283763,19284554..19284625,
FT                   19284746..19284831,19284947..19285033,19285898..19285997,
FT                   19286115..19286193,19286275..19286383,19286481..19286611,
FT                   19286701..19286793,19287084..19287221,19287308..19287395,
FT                   19287480..19287623,19287705..19287809,19287958..19288050,
FT                   19288161..19288288,19288382..19288460)
FT                   /codon_start=1
FT                   /gene="Qars"
FT                   /locus_tag="mCG_16471"
FT                   /product="glutaminyl-tRNA synthetase, isoform CRA_b"
FT                   /note="gene_id=mCG16471.2 transcript_id=mCT191534.0
FT                   protein_id=mCP112480.0 isoform=CRA_b"
FT                   /protein_id="EDL21298.1"
FT                   /translation="GVPAMATPDSLALFTGLGLSENKARETLKNEALSTQLREAATQAH
FT                   QILGSTIDKATGVLLYDLVSRLRDTRRRSFLVSYIANKKIHTGLQLSAALEYVRSHPQD
FT                   PIDTKDFEQECGVGVVVTPEQIEEAVESTINKHQLQLLAERYRFNMGLLMGEARAALRW
FT                   ADGKMIKNEVDMQVLHLLGPKMEADLVKKPKVAKARLEETDRKTAKDVVEKGEVAGQTL
FT                   SLMEQLRGEALKFHKPGENYKTPGYVITPYTMDLLKQHLEITGGQVRTRFPPEPNGILH
FT                   IGHAKAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAIYDMVTWLGYTPYKVTYAS
FT                   DYFDQLYAWAVELIHGGLAYVCHQRVEELKGHNPLPSPWRDRPKEESLLLFEAMRKGKF
FT                   AEGEATLRMKLVMEDGKMDPVAYRVKYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHS
FT                   LCTKEFQARRSSYFWLCNALKVYCPVQWEYGRLNLHYAVVSKRKILQLVAAGAVRDWDD
FT                   PRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDVLNDAAPRAMAVL
FT                   EPLQVVITNFPAPKPLDIRVPNFPADETKGFHQVPFASTVFIERSDFKEESEPGYKRLA
FT                   SGQPVGLRHTGYVIELQNIVRGSSGCVERLEVTCRRADAGEKPKAFIHWVSQPLVCEIR
FT                   LYERLFQHKNPEDPVEVPGGFLSDLNPVGS"
FT   CDS             join(19281498..19281614,19281798..19281945,
FT                   19282292..19282401,19282564..19282639,19282856..19282920,
FT                   19283510..19283563,19283703..19283763,19284554..19284625,
FT                   19284746..19284831,19284947..19285033,19285898..19285997,
FT                   19286115..19286193,19286275..19286383,19286481..19286611,
FT                   19286701..19286793,19287084..19287221,19287308..19287395,
FT                   19287480..19287623,19287705..19287809,19287958..19288050,
FT                   19288161..19288288,19288382..19288448,19288522..19288647,
FT                   19289211..19289261)
FT                   /codon_start=1
FT                   /gene="Qars"
FT                   /locus_tag="mCG_16471"
FT                   /product="glutaminyl-tRNA synthetase, isoform CRA_a"
FT                   /note="gene_id=mCG16471.2 transcript_id=mCT18723.2
FT                   protein_id=mCP23336.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BU21"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR007638"
FT                   /db_xref="InterPro:IPR007639"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="MGI:MGI:1915851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BU21"
FT                   /protein_id="EDL21297.1"
FT                   /translation="MATPDSLALFTGLGLSENKARETLKNEALSTQLREAATQAHQILG
FT                   STIDKATGVLLYDLVSRLRDTRRRSFLVSYIANKKIHTGLQLSAALEYVRSHPQDPIDT
FT                   KDFEQECGVGVVVTPEQIEEAVESTINKHQLQLLAERYRFNMGLLMGEARAALRWADGK
FT                   MIKNEVDMQVLHLLGPKMEADLVKKPKVAKARLEETDRKTAKDVVEKGEVAGQTLSLME
FT                   QLRGEALKFHKPGENYKTPGYVITPYTMDLLKQHLEITGGQVRTRFPPEPNGILHIGHA
FT                   KAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAIYDMVTWLGYTPYKVTYASDYFD
FT                   QLYAWAVELIHGGLAYVCHQRVEELKGHNPLPSPWRDRPKEESLLLFEAMRKGKFAEGE
FT                   ATLRMKLVMEDGKMDPVAYRVKYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTK
FT                   EFQARRSSYFWLCNALKVYCPVQWEYGRLNLHYAVVSKRKILQLVAAGAVRDWDDPRLF
FT                   TLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDVLNDAAPRAMAVLEPLQ
FT                   VVITNFPAPKPLDIRVPNFPADETKGFHQVPFASTVFIERSDFKEESEPGYKRLASGQP
FT                   VGLRHTGYVIELQNIVRGSSGCVERLEVTCRRADAGEKPKAFIHWVSQPLVCEIRLYER
FT                   LFQHKNPEDPVEVPGGFLSDLNPASLQVVEGALVDCSVALAKPFDKFQFERLGYFSVDP
FT                   DSHQGQIVFNRTVTLKEDPGKI"
FT   mRNA            join(19282894..19283141,19283510..19283563,
FT                   19283703..19283763,19284554..19284625,19284746..19284831,
FT                   19284947..19285033,19285898..19285997,19286115..19286193,
FT                   19286275..19286383,19286481..19286611,19286701..19286793,
FT                   19287084..19287221,19287308..19287395,19287480..19287623,
FT                   19287705..19287809,19287958..19288050,19288161..19288288,
FT                   19288382..19288448,19288522..19288647,19289211..19289351)
FT                   /gene="Qars"
FT                   /locus_tag="mCG_16471"
FT                   /product="glutaminyl-tRNA synthetase, transcript variant
FT                   mCT170755"
FT                   /note="gene_id=mCG16471.2 transcript_id=mCT170755.0 created
FT                   on 17-JUL-2002"
FT   CDS             join(19283133..19283141,19283510..19283563,
FT                   19283703..19283763,19284554..19284625,19284746..19284831,
FT                   19284947..19285033,19285898..19285997,19286115..19286193,
FT                   19286275..19286383,19286481..19286611,19286701..19286793,
FT                   19287084..19287221,19287308..19287395,19287480..19287623,
FT                   19287705..19287809,19287958..19288050,19288161..19288288,
FT                   19288382..19288448,19288522..19288647,19289211..19289261)
FT                   /codon_start=1
FT                   /gene="Qars"
FT                   /locus_tag="mCG_16471"
FT                   /product="glutaminyl-tRNA synthetase, isoform CRA_c"
FT                   /note="gene_id=mCG16471.2 transcript_id=mCT170755.0
FT                   protein_id=mCP93673.0 isoform=CRA_c"
FT                   /protein_id="EDL21299.1"
FT                   /translation="MTEVLHLLGPKMEADLVKKPKVAKARLEETDRKTAKDVVEKGEVA
FT                   GQTLSLMEQLRGEALKFHKPGENYKTPGYVITPYTMDLLKQHLEITGGQVRTRFPPEPN
FT                   GILHIGHAKAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAIYDMVTWLGYTPYKV
FT                   TYASDYFDQLYAWAVELIHGGLAYVCHQRVEELKGHNPLPSPWRDRPKEESLLLFEAMR
FT                   KGKFAEGEATLRMKLVMEDGKMDPVAYRVKYTPHHRTGDKWCIYPTYDYTHCLCDSIEH
FT                   ITHSLCTKEFQARRSSYFWLCNALKVYCPVQWEYGRLNLHYAVVSKRKILQLVAAGAVR
FT                   DWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDVLNDAAPRA
FT                   MAVLEPLQVVITNFPAPKPLDIRVPNFPADETKGFHQVPFASTVFIERSDFKEESEPGY
FT                   KRLASGQPVGLRHTGYVIELQNIVRGSSGCVERLEVTCRRADAGEKPKAFIHWVSQPLV
FT                   CEIRLYERLFQHKNPEDPVEVPGGFLSDLNPASLQVVEGALVDCSVALAKPFDKFQFER
FT                   LGYFSVDPDSHQGQIVFNRTVTLKEDPGKI"
FT   gene            19290525..19335083
FT                   /gene="2610028H07Rik"
FT                   /locus_tag="mCG_16491"
FT                   /note="gene_id=mCG16491.2"
FT   mRNA            join(19290525..19290655,19302121..19302450,
FT                   19307120..19308151,19315246..19315423,19315990..19316144,
FT                   19318420..19318534,19329517..19329625,19329963..19330114,
FT                   19330513..19330603,19334166..19335083)
FT                   /gene="2610028H07Rik"
FT                   /locus_tag="mCG_16491"
FT                   /product="RIKEN cDNA 2610028H07, transcript variant
FT                   mCT170759"
FT                   /note="gene_id=mCG16491.2 transcript_id=mCT170759.0 created
FT                   on 18-JUL-2002"
FT   mRNA            join(19291192..19291546,19292337..19292396,
FT                   19302121..19302450,19307120..19308151,19315246..19315423,
FT                   19315990..19316144,19318420..19318534,19329517..19329625,
FT                   19329963..19330114,19330513..19330603,19334166..19335083)
FT                   /gene="2610028H07Rik"
FT                   /locus_tag="mCG_16491"
FT                   /product="RIKEN cDNA 2610028H07, transcript variant
FT                   mCT18916"
FT                   /note="gene_id=mCG16491.2 transcript_id=mCT18916.2 created
FT                   on 17-JUL-2002"
FT   CDS             join(19302142..19302450,19307120..19308151,
FT                   19315246..19315423,19315990..19316144,19318420..19318534,
FT                   19329517..19329625,19329963..19330114,19330513..19330603,
FT                   19334166..19334358)
FT                   /codon_start=1
FT                   /gene="2610028H07Rik"
FT                   /locus_tag="mCG_16491"
FT                   /product="RIKEN cDNA 2610028H07, isoform CRA_a"
FT                   /note="gene_id=mCG16491.2 transcript_id=mCT18916.2
FT                   protein_id=mCP23346.2 isoform=CRA_a"
FT                   /db_xref="GOA:G3X8R5"
FT                   /db_xref="InterPro:IPR021893"
FT                   /db_xref="MGI:MGI:1916482"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8R5"
FT                   /protein_id="EDL21300.1"
FT                   /translation="MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEF
FT                   QQTATTTMVYQQGGNCIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQVQQPQQVQV
FT                   QVQVQQSPQQVSAQQLSPQFTVHQPAEQPIQVQVQIQGQAPQSAAPSIQTPSLQSPSPS
FT                   QLQAAQIQVQHVQAAQQIQAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSP
FT                   PPSQQGSPREGERRVGTASVLQPVKKRKVDMPITVSYAISGQPVATVLAIPQGQQQSYV
FT                   SLRPDLLTVDSAHLYSATGTITSPTGETWTIPVYSAQPRGDPQQQSITHIAIPQEAYNA
FT                   VHVSGSPTALAAVKLEDDKEKMVGTTSVVKNSHEEVVQTLANSLFPAQFMNGNIHIPVA
FT                   VQAVAGTYQNTAQTVHIWDPQQQPQQQTAQEQTPPPQQQQQQLQVTCSAQTVQVAEVEP
FT                   QSQPQPSPELLLPNSLKPEEGLEVWKNWAQTKNAELEKDAQNRLAPIGRRQLLRFQEDL
FT                   ISSAVAELNYGLCLMTREARNGEGEPYDPDVLYYIFLCIQKYLFENGRVDDIFSDLYYV
FT                   RFTEWLHEVLKDVQPRVTPLGYVLPSHVTEEMLWECKQLGAHSPSTLLTTLMFFNTKYF
FT                   LLKTVDQHMKLAFSKVLRQTKKSPSNPKDKSTSIRYLKALGIHQTGQKVTDDMYAEQTE
FT                   NPENPLRCPIKLYDFYLFKCPQSVKGRNDTFYLTPEPVVAPNSPIWYSVQPISREQMGQ
FT                   MLTRILVIREIQEAIAVANATTMH"
FT   CDS             join(19302142..19302450,19307120..19308151,
FT                   19315246..19315423,19315990..19316144,19318420..19318534,
FT                   19329517..19329625,19329963..19330114,19330513..19330603,
FT                   19334166..19334358)
FT                   /codon_start=1
FT                   /gene="2610028H07Rik"
FT                   /locus_tag="mCG_16491"
FT                   /product="RIKEN cDNA 2610028H07, isoform CRA_a"
FT                   /note="gene_id=mCG16491.2 transcript_id=mCT170759.0
FT                   protein_id=mCP93677.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X8R5"
FT                   /db_xref="InterPro:IPR021893"
FT                   /db_xref="MGI:MGI:1916482"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8R5"
FT                   /protein_id="EDL21301.1"
FT                   /translation="MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEF
FT                   QQTATTTMVYQQGGNCIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQVQQPQQVQV
FT                   QVQVQQSPQQVSAQQLSPQFTVHQPAEQPIQVQVQIQGQAPQSAAPSIQTPSLQSPSPS
FT                   QLQAAQIQVQHVQAAQQIQAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSP
FT                   PPSQQGSPREGERRVGTASVLQPVKKRKVDMPITVSYAISGQPVATVLAIPQGQQQSYV
FT                   SLRPDLLTVDSAHLYSATGTITSPTGETWTIPVYSAQPRGDPQQQSITHIAIPQEAYNA
FT                   VHVSGSPTALAAVKLEDDKEKMVGTTSVVKNSHEEVVQTLANSLFPAQFMNGNIHIPVA
FT                   VQAVAGTYQNTAQTVHIWDPQQQPQQQTAQEQTPPPQQQQQQLQVTCSAQTVQVAEVEP
FT                   QSQPQPSPELLLPNSLKPEEGLEVWKNWAQTKNAELEKDAQNRLAPIGRRQLLRFQEDL
FT                   ISSAVAELNYGLCLMTREARNGEGEPYDPDVLYYIFLCIQKYLFENGRVDDIFSDLYYV
FT                   RFTEWLHEVLKDVQPRVTPLGYVLPSHVTEEMLWECKQLGAHSPSTLLTTLMFFNTKYF
FT                   LLKTVDQHMKLAFSKVLRQTKKSPSNPKDKSTSIRYLKALGIHQTGQKVTDDMYAEQTE
FT                   NPENPLRCPIKLYDFYLFKCPQSVKGRNDTFYLTPEPVVAPNSPIWYSVQPISREQMGQ
FT                   MLTRILVIREIQEAIAVANATTMH"
FT   gene            19335349..19340531
FT                   /gene="Impdh2"
FT                   /locus_tag="mCG_16503"
FT                   /note="gene_id=mCG16503.2"
FT   mRNA            join(19335349..19335551,19335954..19336002,
FT                   19336517..19336618,19336703..19336777,19337094..19337300,
FT                   19337712..19337799,19338056..19338255,19338341..19338431,
FT                   19338516..19338611,19339594..19339737,19339825..19339969,
FT                   19340061..19340204,19340286..19340369,19340457..19340531)
FT                   /gene="Impdh2"
FT                   /locus_tag="mCG_16503"
FT                   /product="inosine 5'-phosphate dehydrogenase 2"
FT                   /note="gene_id=mCG16503.2 transcript_id=mCT18928.1 created
FT                   on 18-JUL-2002"
FT   CDS             join(19335454..19335551,19335954..19336002,
FT                   19336517..19336618,19336703..19336777,19337094..19337300,
FT                   19337712..19337799,19338056..19338255,19338341..19338431,
FT                   19338516..19338611,19339594..19339737,19339825..19339969,
FT                   19340061..19340204,19340286..19340369,19340457..19340478)
FT                   /codon_start=1
FT                   /gene="Impdh2"
FT                   /locus_tag="mCG_16503"
FT                   /product="inosine 5'-phosphate dehydrogenase 2"
FT                   /note="gene_id=mCG16503.2 transcript_id=mCT18928.1
FT                   protein_id=mCP23338.0"
FT                   /db_xref="GOA:Q3UAT9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="MGI:MGI:109367"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UAT9"
FT                   /protein_id="EDL21302.1"
FT                   /translation="MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFT
FT                   ADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEV
FT                   RKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDI
FT                   DFLKEEEHDRFLEEIMTKREDLVVAPAGVTLKEANEILQRSKKGKLPIVNENDELVAII
FT                   ARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLALAGVDVVVLDSSQGNSI
FT                   FQINMIKYIKEKYPSLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACG
FT                   RPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGE
FT                   YFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVP
FT                   YLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF"
FT   gene            complement(19340496..19342305)
FT                   /gene="4733401H18Rik"
FT                   /locus_tag="mCG_16504"
FT                   /note="gene_id=mCG16504.2"
FT   mRNA            complement(join(19340496..19341034,19341118..19341218,
FT                   19341300..19341366,19341515..19341710,19341810..19342305))
FT                   /gene="4733401H18Rik"
FT                   /locus_tag="mCG_16504"
FT                   /product="RIKEN cDNA 4733401H18"
FT                   /note="gene_id=mCG16504.2 transcript_id=mCT18929.2 created
FT                   on 18-JUL-2002"
FT   CDS             complement(join(19340918..19341034,19341118..19341218,
FT                   19341300..19341366,19341515..19341710,19341810..19341886))
FT                   /codon_start=1
FT                   /gene="4733401H18Rik"
FT                   /locus_tag="mCG_16504"
FT                   /product="RIKEN cDNA 4733401H18"
FT                   /note="gene_id=mCG16504.2 transcript_id=mCT18929.2
FT                   protein_id=mCP23340.1"
FT                   /protein_id="EDL21303.1"
FT                   /translation="MATALGFRCLFRTRPAPLCRHVDRLWRNPRRGHRLSPADDELYQR
FT                   TRISLLQSEFPQAVYIDSYSSRGFTICGNRVFGPCVLLPQTVVQWNVGSHQDITEESFS
FT                   LFWMLEPRIEIVVVGTGNKTERLHPQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRV
FT                   TGAALIPPPGETALASLGQASE"
FT   gene            <19344850..19347733
FT                   /locus_tag="mCG_16494"
FT                   /note="gene_id=mCG16494.3"
FT   mRNA            join(<19344850..19345034,19345109..19345404,
FT                   19345523..19345773,19345851..19345930,19346004..19346132,
FT                   19346395..19346478,19346572..19346633,19346741..19346823,
FT                   19346900..19347076,19347146..19347256,19347352..19347420,
FT                   19347510..19347731)
FT                   /locus_tag="mCG_16494"
FT                   /product="mCG16494, transcript variant mCT191545"
FT                   /note="gene_id=mCG16494.3 transcript_id=mCT191545.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(19344851..19345034,19345109..19345404,
FT                   19345523..19345773,19345851..19345930,19346004..19346132,
FT                   19346405..19346478,19346572..19346633,19346741..19346823,
FT                   19346900..19347076,19347146..19347256,19347352..19347420,
FT                   19347510..19347733)
FT                   /locus_tag="mCG_16494"
FT                   /product="mCG16494, transcript variant mCT18921"
FT                   /note="gene_id=mCG16494.3 transcript_id=mCT18921.2 created
FT                   on 18-JUL-2002"
FT   CDS             join(<19344852..19345034,19345109..19345404,
FT                   19345523..19345773,19345851..19345930,19346004..19346132,
FT                   19346395..19346478,19346572..19346633,19346741..19346756)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16494"
FT                   /product="mCG16494, isoform CRA_b"
FT                   /note="gene_id=mCG16494.3 transcript_id=mCT191545.0
FT                   protein_id=mCP112484.0 isoform=CRA_b"
FT                   /protein_id="EDL21305.1"
FT                   /translation="FSLPVAMATGRLGVGETLEALNAAVGPGSPVWFKETHARHLRVRD
FT                   FLAPRSALQARFRDGQVPECVFRAVSCLQGPGVAPVLRCAPTPAGLSLQLQRPAVFEHV
FT                   LGALASYATPAKPASPGPRVVLHCPALRCNSGTLRLSQLRAVLVADHLVRVLRAHGVRV
FT                   CSVPPVRDPHMSTFLQKLRVEWPTASKSTSTETLRTCVLANLNGSKEATLPPGVLGRLC
FT                   LKELVEQRGTAGYDPSIDHCLVTEDVLSVLSELQEAVRHWPEGGHPGPAGRPDAGVDDC
FT                   VVIHVVSCEEAFQQQKLDLLWQKLDDRAPHKQSFTETPGVWSRENGWCTRHPADCPSVL
FT                   QAQTCSGVRGLSSEARRRPGTRPRLD"
FT   CDS             join(19344870..19345034,19345109..19345404,
FT                   19345523..19345773,19345851..19345930,19346004..19346132,
FT                   19346405..19346478,19346572..19346633,19346741..19346823,
FT                   19346900..19347076,19347146..19347256,19347352..19347420,
FT                   19347510..19347629)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16494"
FT                   /product="mCG16494, isoform CRA_a"
FT                   /note="gene_id=mCG16494.3 transcript_id=mCT18921.2
FT                   protein_id=mCP23379.2 isoform=CRA_a"
FT                   /protein_id="EDL21304.1"
FT                   /translation="MATGRLGVGETLEALNAAVGPGSPVWFKETHARHLRVRDFLAPRS
FT                   ALQARFRDGQVPECVFRAVSCLQGPGVAPVLRCAPTPAGLSLQLQRPAVFEHVLGALAS
FT                   YATPAKPASPGPRVVLHCPALRCNSGTLRLSQLRAVLVADHLVRVLRAHGVRVCSVPPV
FT                   RDPHMSTFLQKLRVEWPTASKSTSTETLRTCVLANLNGSKEATLPPGVLGRLCLKELVE
FT                   QRGTAGYDPSIDHCLVTEDVLSVLSELQEAVRHWPEGGHPGPAGRPDAGVDDCVVIHVV
FT                   SCEEAFQQQKLDLLWQKLDDRAPHKQKHLVCGPVKMAGVPGTQLTAPQYYRLRHAQVCE
FT                   ASALKHGGDLAQDPAWTETFDILSVATIKFEMLSTAPQSQLLLAHSTISTKGTKSGTFV
FT                   MYNCARLATLFEGYKHGTEQGLYPTFPLVSSLDFSLLHDEGEWLLLFNSVLPFLDLLSQ
FT                   TVSLAGTPGLHIPVRTEMVCKFLVQLSMDFSSYYNRVHILGEPRPHLFGQMFARLQLLR
FT                   AVREVFHTGLAMLGLPPLSHI"
FT   gene            complement(19347277..19353694)
FT                   /gene="Wdr6"
FT                   /locus_tag="mCG_16513"
FT                   /note="gene_id=mCG16513.2"
FT   mRNA            complement(join(19347277..19348372,19348448..19348566,
FT                   19348653..19348769,19348864..19348959,19349060..19351541,
FT                   19353449..19353694))
FT                   /gene="Wdr6"
FT                   /locus_tag="mCG_16513"
FT                   /product="WD repeat domain 6"
FT                   /note="gene_id=mCG16513.2 transcript_id=mCT18938.2 created
FT                   on 18-JUL-2002"
FT   CDS             complement(join(19347909..19348372,19348448..19348566,
FT                   19348653..19348769,19348864..19348959,19349060..19351541,
FT                   19353449..19353548))
FT                   /codon_start=1
FT                   /gene="Wdr6"
FT                   /locus_tag="mCG_16513"
FT                   /product="WD repeat domain 6"
FT                   /note="gene_id=mCG16513.2 transcript_id=mCT18938.2
FT                   protein_id=mCP23339.2"
FT                   /db_xref="GOA:Q99ME2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1930140"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99ME2"
FT                   /protein_id="EDL21306.1"
FT                   /translation="MDAFGDYVWPRATSELILLPVTGLECVGDRLLAGEGPDLLVYNLD
FT                   LGGHLRMVKRVQNLLGHFLIHGFRVRPEPKGDLDSEAMIAVFGSKGLKVVKVSWGQSHL
FT                   RELWRSGLWNMSDWIWDVRWIEGNVAVALGHNSVVLYDPVIGCMLQDVPCTDRCTLSSA
FT                   CLVGDTWKELTIVAGAVSNELLIWYPATALTDNKPVAPDRRVSGHVGVIFSMSYLESKG
FT                   LLATASEDRSVRLWKVGDLRVPGGRVQNIGHCFGHSARVWQVKLLENYLISAGEDCVCL
FT                   VWSHEGEILQAFRGHRGRGIRAIATHERQAWVVTGGDDSGIRLWHLAGRGYPGLGVSSL
FT                   SFKSPSRPGALKAVTLAGSWRVLAVTDVGSLYLYDLEVKSWEQLLEDNRFRSYCLLEAA
FT                   PGPEGFGLCALANGEGLVKVVPINTPTAAVEQKLFQGKVHSLSWALRGYEELLLLASGP
FT                   GGVIACLEISAAPTGKAIFVKERCRYLLPPSKQRWHTCSAFLPPGDFLVCGDRRGSVML
FT                   FPVRPCLFKKPGAGSKAITAAEAPGAGSGSGGSESVPTGIGPVSTLHSLHGKQGVTSVT
FT                   CHGGYLYSTGRDSSYFQLFVHGGHLQPVLRQKACRGMNWVAGLRMVPDGSMVILGFHAN
FT                   EFVVWSPRSHEKLHIVNCGGGHRSWAFSDTEAAMAFTYLKDGEVMLYRALGGCIRPNVI
FT                   LREGLHGREITCVKRVGTVTLGPEFEVPNLEHPDSLEPGSEGPGLIDIVITGSEDTTVC
FT                   VLALPTTTGSAHALTSVCNHISSVRALAVWAVGTPGGPQDTRPGLTAQVVSAGGRAEIH
FT                   CFSVMVTPDASTPSRLACHVMHLSSHRLDEYWDRQRNKHKMIKVDPETRYMSLAICELD
FT                   NDRPGLGPGPLVAAACSDGAVRLFLLQDSGRILHLLAESFHHKRCVLKVHSFTHEAPNQ
FT                   RRRLILCSAATDGSLAFWDLTTAMDKGSTTLELPAHPGLPYQMGTPSMTVQAHSCGVNS
FT                   LHTLPTPEGHHLVASGSEDGSLHVFTLAVKMPEPEEADGEAELVPQLCVLEEYSVPCAH
FT                   AAHVTGVKILSPKLMVSASIDQRLTFWRLGQGEPTFMNSTVYHVPDVADMDCWPVSPEF
FT                   GHRCALAGQGLEVYNWYD"
FT   gene            complement(19353781..19372771)
FT                   /gene="4933406E20Rik"
FT                   /locus_tag="mCG_16483"
FT                   /note="gene_id=mCG16483.2"
FT   mRNA            complement(join(19353781..19354263,19354671..19354794,
FT                   19354971..19355061,19355673..19355858,19356978..19357140,
FT                   19357983..19358079,19358778..19358968,19372003..19372084,
FT                   19372312..19372771))
FT                   /gene="4933406E20Rik"
FT                   /locus_tag="mCG_16483"
FT                   /product="RIKEN cDNA 4933406E20"
FT                   /note="gene_id=mCG16483.2 transcript_id=mCT18908.2 created
FT                   on 18-JUL-2002"
FT   CDS             complement(join(19354043..19354263,19354671..19354794,
FT                   19354971..19355061,19355673..19355858,19356978..19357140,
FT                   19357983..19358079,19358778..19358968,19372003..19372084,
FT                   19372312..19372668))
FT                   /codon_start=1
FT                   /gene="4933406E20Rik"
FT                   /locus_tag="mCG_16483"
FT                   /product="RIKEN cDNA 4933406E20"
FT                   /note="gene_id=mCG16483.2 transcript_id=mCT18908.2
FT                   protein_id=mCP23359.1"
FT                   /db_xref="GOA:Q2M2M8"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1921693"
FT                   /db_xref="UniProtKB/TrEMBL:Q2M2M8"
FT                   /protein_id="EDL21307.1"
FT                   /translation="MAAAVATVQRPEAETVEEASNLQWPLPPEHRPSGAATRPGDSEDA
FT                   PVRPLCKPRGICSRAYFLVLMVFVHLYLGNVLALLLFVHYSNGDESTDPGPQRREQSPQ
FT                   PVPTLGPLTRLEGIKVGYERKVQVVAGRDHFIRTLSLKPLLFEIPGFLSDEECRLIIHL
FT                   AQMKGLQRSQILPTEEYEEAMSAMQVSQLDLFQLLDQNHDGRLQLREVLAQTRLGNGRW
FT                   MTPENIQEMYSAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESNELVRNSHHTWL
FT                   HQGEGAHHVMRAIRQRVLRLTRLSPEIVEFSEPLQVVRYGEGGHYHAHVDSGPVYPETI
FT                   CSHTKLVANESVPFETSCRYMTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDDVDLR
FT                   DTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGEVDDYSLHGGCLVTRGTKWIANNW
FT                   INVDPSRARQALFQQEMARLAREGGMDSQPEWALDRAYSDARVEL"
FT   gene            complement(19378051..19428925)
FT                   /gene="Arih2"
FT                   /locus_tag="mCG_16506"
FT                   /note="gene_id=mCG16506.3"
FT   mRNA            complement(join(19378051..19380259,19380440..19380523,
FT                   19382370..19382438,19382991..19383134,19383684..19383835,
FT                   19384860..19384881,19384979..19385029,19386715..19386832,
FT                   19388808..19388917,19390107..19390228,19391760..19391910,
FT                   19392454..19392517,19395143..19395210,19419261..19419603,
FT                   19420168..19420229,19424464..19424620))
FT                   /gene="Arih2"
FT                   /locus_tag="mCG_16506"
FT                   /product="ariadne homolog 2 (Drosophila), transcript
FT                   variant mCT18932"
FT                   /note="gene_id=mCG16506.3 transcript_id=mCT18932.1 created
FT                   on 01-APR-2004"
FT   mRNA            complement(join(19378053..19380259,19380440..19380523,
FT                   19382370..19382438,19382991..19383134,19383684..19383835,
FT                   19384860..19384881,19384979..19385029,19386715..19386832,
FT                   19388808..19388917,19390107..19390228,19391760..19391910,
FT                   19392454..19392517,19395143..19395210,19419261..19419603,
FT                   19420168..19420229,19428816..19428925))
FT                   /gene="Arih2"
FT                   /locus_tag="mCG_16506"
FT                   /product="ariadne homolog 2 (Drosophila), transcript
FT                   variant mCT194266"
FT                   /note="gene_id=mCG16506.3 transcript_id=mCT194266.0 created
FT                   on 01-APR-2004"
FT   CDS             complement(join(19380188..19380259,19380440..19380523,
FT                   19382370..19382438,19382991..19383134,19383684..19383835,
FT                   19384860..19384881,19384979..19385029,19386715..19386832,
FT                   19388808..19388917,19390107..19390228,19391760..19391910,
FT                   19392454..19392517,19395143..19395210,19419261..19419512))
FT                   /codon_start=1
FT                   /gene="Arih2"
FT                   /locus_tag="mCG_16506"
FT                   /product="ariadne homolog 2 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG16506.3 transcript_id=mCT18932.1
FT                   protein_id=mCP23344.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TK92"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1344361"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TK92"
FT                   /protein_id="EDL21308.1"
FT                   /translation="MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDPGDIEDYYVGVASDV
FT                   EQQGADAFDPEEYQFTCLTYKESEGALHEHMTSLASVLKVSHSVAKLILVNFHWQVSEI
FT                   LDRYRSNSAQLLVEARVQPNPSKHVPTAHPPHHCAVCMQFVRKENLLSLACQHQFCRSC
FT                   WEQHCSVLVKDGVGVGISCMAQDCPLRTPEDFVFPLLPNEELRDKYRRYLFRDYVESHF
FT                   QLQLCPGADCPMVIRVQEPRARRVQCNRCSEVFCFKCRQMYHAPTDCATIRKWLTKCAD
FT                   DSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECS
FT                   RYKENPDIVNQSQQAQAREALKKYLFYFERWENHNKSLQLEAQTYERIHEKIQERVMNN
FT                   LGTWIDWQYLQNAAKLLAKCRYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSW
FT                   KVERADSYDRGDLENQMHIAEQRRRTLLKDFHDT"
FT   CDS             complement(join(19380188..19380259,19380440..19380523,
FT                   19382370..19382438,19382991..19383134,19383684..19383835,
FT                   19384860..19384881,19384979..19385029,19386715..19386832,
FT                   19388808..19388917,19390107..19390228,19391760..19391910,
FT                   19392454..19392517,19395143..19395210,19419261..19419512))
FT                   /codon_start=1
FT                   /gene="Arih2"
FT                   /locus_tag="mCG_16506"
FT                   /product="ariadne homolog 2 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG16506.3 transcript_id=mCT194266.0
FT                   protein_id=mCP115295.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TK92"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1344361"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TK92"
FT                   /protein_id="EDL21309.1"
FT                   /translation="MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDPGDIEDYYVGVASDV
FT                   EQQGADAFDPEEYQFTCLTYKESEGALHEHMTSLASVLKVSHSVAKLILVNFHWQVSEI
FT                   LDRYRSNSAQLLVEARVQPNPSKHVPTAHPPHHCAVCMQFVRKENLLSLACQHQFCRSC
FT                   WEQHCSVLVKDGVGVGISCMAQDCPLRTPEDFVFPLLPNEELRDKYRRYLFRDYVESHF
FT                   QLQLCPGADCPMVIRVQEPRARRVQCNRCSEVFCFKCRQMYHAPTDCATIRKWLTKCAD
FT                   DSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECS
FT                   RYKENPDIVNQSQQAQAREALKKYLFYFERWENHNKSLQLEAQTYERIHEKIQERVMNN
FT                   LGTWIDWQYLQNAAKLLAKCRYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSW
FT                   KVERADSYDRGDLENQMHIAEQRRRTLLKDFHDT"
FT   gene            19438749..19455799
FT                   /gene="Slc25a20"
FT                   /locus_tag="mCG_16509"
FT                   /note="gene_id=mCG16509.2"
FT   mRNA            join(19438749..19438845,19443574..19443701,
FT                   19448736..19448826,19451238..19451355,19453123..19453195,
FT                   19453498..19453607,19454200..19454324,19454989..19455799)
FT                   /gene="Slc25a20"
FT                   /locus_tag="mCG_16509"
FT                   /product="solute carrier family 25 (mitochondrial
FT                   carnitine/acylcarnitine translocase), member 20"
FT                   /note="gene_id=mCG16509.2 transcript_id=mCT18930.2 created
FT                   on 18-JUL-2002"
FT   CDS             join(19438798..19438845,19443574..19443701,
FT                   19448736..19448826,19451238..19451355,19453123..19453195,
FT                   19453498..19453607,19454200..19454324,19454989..19455051)
FT                   /codon_start=1
FT                   /gene="Slc25a20"
FT                   /locus_tag="mCG_16509"
FT                   /product="solute carrier family 25 (mitochondrial
FT                   carnitine/acylcarnitine translocase), member 20"
FT                   /note="gene_id=mCG16509.2 transcript_id=mCT18930.2
FT                   protein_id=mCP23360.2"
FT                   /protein_id="EDL21310.1"
FT                   /translation="MYSGTLDCFRKTLMREGITGLYRGMAAPIIGVTPMFAVCFFGFGL
FT                   GKKLQQKSPEDELSYPQLFTAGMLSGVFTTGIMTPGERIKCLLQIQASSGENKYSGTLD
FT                   CAKKLYQEFGIRGFYKGTVLTLMRDVPASGMYFMTYEWLKNLFTPEGKSVSDLSVPRIL
FT                   VAGGFAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIREEGVTSLYKGFNAV
FT                   MIRAFPANAACFLGFEIAMKFLNWIAPNL"
FT   gene            19463516..19521131
FT                   /gene="Prkar2a"
FT                   /locus_tag="mCG_16488"
FT                   /note="gene_id=mCG16488.2"
FT   mRNA            join(19463516..19463881,19485257..19485292,
FT                   19487906..19487958,19490246..19490329,19499007..19499113,
FT                   19503873..19504026,19511183..19511284,19511436..19511510,
FT                   19514978..19515043,19516230..19516371,19517557..19521131)
FT                   /gene="Prkar2a"
FT                   /locus_tag="mCG_16488"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II alpha, transcript variant mCT18913"
FT                   /note="gene_id=mCG16488.2 transcript_id=mCT18913.2 created
FT                   on 18-JUL-2002"
FT   mRNA            join(19463516..19463881,19464206..19464627)
FT                   /gene="Prkar2a"
FT                   /locus_tag="mCG_16488"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II alpha, transcript variant mCT170758"
FT                   /note="gene_id=mCG16488.2 transcript_id=mCT170758.0 created
FT                   on 18-JUL-2002"
FT   CDS             join(19463626..19463881,19485257..19485292,
FT                   19487906..19487958,19490246..19490329,19499007..19499113,
FT                   19503873..19504026,19511183..19511284,19511436..19511510,
FT                   19514978..19515043,19516230..19516371,19517557..19517690)
FT                   /codon_start=1
FT                   /gene="Prkar2a"
FT                   /locus_tag="mCG_16488"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II alpha, isoform CRA_b"
FT                   /note="gene_id=mCG16488.2 transcript_id=mCT18913.2
FT                   protein_id=mCP23381.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q8K1M3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002373"
FT                   /db_xref="InterPro:IPR003117"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="MGI:MGI:108025"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K1M3"
FT                   /protein_id="EDL21312.1"
FT                   /translation="MSHIQIPAGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR
FT                   QESDTFIVSPTTFHTQESSAVPVIEEDGESDSDSEDADLEVPVPSKFTRRVSVCAETFN
FT                   PDEEEEDNDPRVVHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEH
FT                   VIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIIAT
FT                   SEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYK
FT                   DGERIIAQGEKADSFYIIESGEVSILIRSKTKSNKNGGNQEVEIAHCHKGQYFGELALV
FT                   TNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSNLDLMD
FT                   PGQ"
FT   CDS             join(19463626..19463881,19464206..19464354)
FT                   /codon_start=1
FT                   /gene="Prkar2a"
FT                   /locus_tag="mCG_16488"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II alpha, isoform CRA_a"
FT                   /note="gene_id=mCG16488.2 transcript_id=mCT170758.0
FT                   protein_id=mCP93676.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9CYV3"
FT                   /db_xref="InterPro:IPR003117"
FT                   /db_xref="MGI:MGI:108025"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CYV3"
FT                   /protein_id="EDL21311.1"
FT                   /translation="MSHIQIPAGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR
FT                   QESDTFIVSPTTFHTQESSAVPVIEEDGESDSDSEDADLEDPIACLLSEDKSTSTRQLA
FT                   PNKPDDHFICKEFRFGRVIAENCWRRGRSP"
FT   gene            19554559..19577185
FT                   /gene="Ihpk2"
FT                   /locus_tag="mCG_140686"
FT                   /note="gene_id=mCG140686.0"
FT   mRNA            join(19554559..19554633,19566916..19567248,
FT                   19569123..19569345,19570094..19570269,19575406..19575581,
FT                   19576402..19577185)
FT                   /gene="Ihpk2"
FT                   /locus_tag="mCG_140686"
FT                   /product="inositol hexaphosphate kinase 2, transcript
FT                   variant mCT170741"
FT                   /note="gene_id=mCG140686.0 transcript_id=mCT170741.0
FT                   created on 18-JUL-2002"
FT   mRNA            join(19554559..19554633,19566916..19567248,
FT                   19568059..19568841)
FT                   /gene="Ihpk2"
FT                   /locus_tag="mCG_140686"
FT                   /product="inositol hexaphosphate kinase 2, transcript
FT                   variant mCT170742"
FT                   /note="gene_id=mCG140686.0 transcript_id=mCT170742.0
FT                   created on 18-JUL-2002"
FT   CDS             join(19567047..19567248,19569123..19569345,
FT                   19570094..19570269,19575406..19575581,19576402..19576902)
FT                   /codon_start=1
FT                   /gene="Ihpk2"
FT                   /locus_tag="mCG_140686"
FT                   /product="inositol hexaphosphate kinase 2, isoform CRA_a"
FT                   /note="gene_id=mCG140686.0 transcript_id=mCT170741.0
FT                   protein_id=mCP93660.0 isoform=CRA_a partial"
FT                   /protein_id="EDL21313.1"
FT                   /translation="MSPAFRTMDVEPRTKGILLEPFVHQVGGHSCVLRFNETTLCKPLV
FT                   PREHQFYETLPAEMRRFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGTVDIVDNSDC
FT                   EPKSKLLRWTNKKHHALETEKNPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYSVE
FT                   KKGNVSSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKM
FT                   GTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGTGQLMFMNKYHGRKLSV
FT                   QGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKEWP
FT                   EVTLDSDAEDLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDSVVHE
FT                   GQDAGYIFGLQSLIDIVTEISEESGE"
FT   CDS             join(19567047..19567248,19568059..19568153)
FT                   /codon_start=1
FT                   /gene="Ihpk2"
FT                   /locus_tag="mCG_140686"
FT                   /product="inositol hexaphosphate kinase 2, isoform CRA_b"
FT                   /note="gene_id=mCG140686.0 transcript_id=mCT170742.0
FT                   protein_id=mCP93661.0 isoform=CRA_b"
FT                   /protein_id="EDL21314.1"
FT                   /translation="MSPAFRTMDVEPRTKGILLEPFVHQVGGHSCVLRFNETTLCKPLV
FT                   PREHQFYETLPAEMRRFTPQYKGQSQSSLVSWPPLPRFYPFGRSLCPQGSVVP"
FT   gene            19579220..19589323
FT                   /gene="Nckipsd"
FT                   /locus_tag="mCG_16481"
FT                   /note="gene_id=mCG16481.2"
FT   mRNA            join(19579220..19579499,19581891..19582000,
FT                   19582422..19582626,19582752..19582842,19583092..19583582,
FT                   19584822..19584992,19585138..19585224,19585303..19585441,
FT                   19585540..19585620,19585801..19585929,19586035..19586127,
FT                   19586222..19586394,19588416..19589323)
FT                   /gene="Nckipsd"
FT                   /locus_tag="mCG_16481"
FT                   /product="NCK interacting protein with SH3 domain"
FT                   /note="gene_id=mCG16481.2 transcript_id=mCT18907.2 created
FT                   on 18-JUL-2002"
FT   CDS             join(19579329..19579499,19581891..19582000,
FT                   19582422..19582626,19582752..19582842,19583092..19583582,
FT                   19584822..19584992,19585138..19585224,19585303..19585441,
FT                   19585540..19585620,19585801..19585929,19586035..19586127,
FT                   19586222..19586394,19588416..19588619)
FT                   /codon_start=1
FT                   /gene="Nckipsd"
FT                   /locus_tag="mCG_16481"
FT                   /product="NCK interacting protein with SH3 domain"
FT                   /note="gene_id=mCG16481.2 transcript_id=mCT18907.2
FT                   protein_id=mCP23364.2"
FT                   /db_xref="GOA:Q9ESJ4"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR018556"
FT                   /db_xref="MGI:MGI:1931834"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ESJ4"
FT                   /protein_id="EDL21315.1"
FT                   /translation="MYRALYAFRSAEPNAMAFAAGETFLVLERSSTHWWLAARARSGET
FT                   GYVPPAYLHRLQGMEQDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHHRKETL
FT                   SRRGTSASSATVMTPSTSDHHLDAAVSRQPNGVCRTGFERQHSLPSSEHLGTDGALYQV
FT                   PPQPRRAAPTTPPPPVKRRDREALVISGSGGRTAIPSGGSSVSSGSSASSTSMDTLYTG
FT                   SSPSELGPSCSPTPPPVPRRGAHTTVSQPQPSPSKAPSPEPPTEEVAAETNSTPDDLEA
FT                   QDALSPETTEEKAAAETVVPRTIGAELMELVRRNTGLSHELCRVAIGVVVGHIQATVPA
FT                   SSPIMEQVLLSLVEGKDLSTALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDE
FT                   DVIRCYLEELLHILTDADPEVCKKMCKRSDFESVLALVAYYQMEHRASLRLLLLKCFGA
FT                   MCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSALVLAMVFSMGEAVPYAHYEH
FT                   LGTPFAQFLLSIVEDGLPMDTTEQLPDLCMNLLLALNLHLTAPEQNVIMAALSRHTNVK
FT                   IFSEKLLLLLNRGDDPVRIFRHEPQPPHSVLKFLQDVFSSSATAAIFYHTDMMALIDIT
FT                   VRQIADLSPGDKLRMEYLSLMHAVVRSTPYLQHRHRLSDLQATLRRILTEEEASPQCQM
FT                   DRMIVQEMYKEFPDLGEVPS"
FT   gene            <19597205..19623852
FT                   /gene="Celsr3"
FT                   /locus_tag="mCG_140685"
FT                   /note="gene_id=mCG140685.0"
FT   mRNA            join(<19597205..19600925,19602563..19603213,
FT                   19603579..19603798,19604050..19604165,19604538..19604626,
FT                   19604739..19604896,19605434..19605597,19605886..19606011,
FT                   19606106..19606275,19606671..19606856,19607415..19607531,
FT                   19607877..19608048,19608202..19608343,19608440..19608560,
FT                   19608852..19609035,19609349..19609450,19610881..19610975,
FT                   19611173..19611382,19611636..19611831,19612072..19612227,
FT                   19612562..19612733,19613365..19613532,19613746..19613872,
FT                   19613966..19614172,19614416..19614590,19614798..19614910,
FT                   19615335..19615414,19615914..19616040,19616575..19616691,
FT                   19616787..19616935,19617193..19617302,19617581..19617739,
FT                   19618416..19618616,19619501..19620380,19622190..19623852)
FT                   /gene="Celsr3"
FT                   /locus_tag="mCG_140685"
FT                   /product="cadherin EGF LAG seven-pass G-type receptor 3,
FT                   transcript variant mCT170743"
FT                   /note="gene_id=mCG140685.0 transcript_id=mCT170743.0
FT                   created on 18-JUL-2002"
FT   mRNA            join(<19597205..19600925,19602563..19603213,
FT                   19603579..19603798,19604050..19604165,19604538..19604626,
FT                   19604739..19604896,19605434..19605597,19605886..19606011,
FT                   19606106..19606275,19606671..19606856,19607415..19607531,
FT                   19607877..19608048,19608202..19608343,19608440..19608560,
FT                   19608852..19609035,19609349..19609450,19610881..19610975,
FT                   19611173..19611382,19611636..19611831,19612072..19612227,
FT                   19612562..19612733,19613365..19613532,19613746..19613872,
FT                   19613966..19614172,19614416..19614590,19614798..19614910,
FT                   19615335..19615414,19615917..19616040,19616575..19616691,
FT                   19616787..19616935,19617193..19617302,19617581..19617739,
FT                   19618416..19618616,19619501..19620380,19622190..19623852)
FT                   /gene="Celsr3"
FT                   /locus_tag="mCG_140685"
FT                   /product="cadherin EGF LAG seven-pass G-type receptor 3,
FT                   transcript variant mCT191537"
FT                   /note="gene_id=mCG140685.0 transcript_id=mCT191537.0
FT                   created on 09-MAR-2004"
FT   CDS             join(19597205..19600925,19602563..19603213,
FT                   19603579..19603798,19604050..19604165,19604538..19604626,
FT                   19604739..19604896,19605434..19605597,19605886..19606011,
FT                   19606106..19606275,19606671..19606856,19607415..19607531,
FT                   19607877..19608048,19608202..19608343,19608440..19608560,
FT                   19608852..19609035,19609349..19609450,19610881..19610975,
FT                   19611173..19611382,19611636..19611831,19612072..19612227,
FT                   19612562..19612733,19613365..19613532,19613746..19613872,
FT                   19613966..19614172,19614416..19614590,19614798..19614910,
FT                   19615335..19615414,19615914..19616040,19616575..19616691,
FT                   19616787..19616935,19617193..19617302,19617581..19617739,
FT                   19618416..19618616,19619501..19620380,19622190..19622217)
FT                   /codon_start=1
FT                   /gene="Celsr3"
FT                   /locus_tag="mCG_140685"
FT                   /product="cadherin EGF LAG seven-pass G-type receptor 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG140685.0 transcript_id=mCT170743.0
FT                   protein_id=mCP93659.0 isoform=CRA_a"
FT                   /protein_id="EDL21316.1"
FT                   /translation="MARRPLWWGLPGPSTPVLLLLLLSLFPFSREELGGGGDQDWDPGV
FT                   ATTTGPRAQIGSGAVALCPESPGVWEDGDPGLGVREPVFMRLRVGRQNARNGRGAPEQP
FT                   NAEVVVQALGSREQEAGQGPGYLLCWHPEISSCGRTGPLRRGSLPLDALSPGDSDLRNS
FT                   SPHPSELLAQPDGSRPVAFQRNARRSIRKRVETSRCCGKLWEPGHKGQGERSATSTVER
FT                   GPFRRDCLPGSLGSGLGEDSAPRAVRTAPTPGSAPRESRTAPGRMRSRGLFRRRFLFER
FT                   PGPRPPGFPTGPEAKQILSTNQARPRRAANRHPQFPQYNYQTLVPENEAAGTSVLRVVA
FT                   QDPDPGEAGRLIYSLAALMNSRSLELFSIDPQSGLIRTAAALDRESMERHYLRVTAQDH
FT                   GSPRLSATTMVAVTVADRNDHAPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNAN
FT                   LRYRFVGSPAVRTAAAAAFEIDPRSGLISTSGRVDREHMESYELVVEASDQGQEPGPRS
FT                   ATVRVHITVLDENDNAPQFSEKRYVAQVREDVRPHTVVLRVTATDKDKDANGLVHYNII
FT                   SGNSRGHFAIDSLTGEIQVMAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDI
FT                   NDHAPIFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTGVASDTPFVINS
FT                   ATGWVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYH
FT                   LRLNEDAAVGTSVVSVTAVDRDANSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDY
FT                   KQERYFKLVLTASDRALHDHCYVHINITDANTHRPVFQSAHYSVSMNEDRPVGSTVVVI
FT                   SASDDDVGENARITYLLEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIP
FT                   QKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDAHANGRVQY
FT                   TFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPPLRTPVSIQVTV
FT                   QDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDDGPNAHIMYQIVEGNIPELFQ
FT                   MDIFSGELTALIDLDYEARQEYVIVVQATSAPLVSRATVHVRLVDQNDNSPVLNNFQIL
FT                   FNNYVSNRSDTFPSGIIGRIPAYDPDVSDHLFYSFERGNELQLLVVNRTSGELRLSRKL
FT                   DNNRPLVASMLVTVTDGLHSVTAQCVLRVVIITEELLANSLTVRLENMWQERFLSPLLG
FT                   HFLEGVAAVLATPTEDVFIFNIQNDTDVGGTVLNVSFSALAPRGAGAGAAGPWFSSEEL
FT                   QEQLYVRRAALAARSLLDVLPFDDNVCLREPCENYMKCVSVLRFDSSAPFLASTSTLFR
FT                   PIQPIAGLRCRCPPGFTGDFCETELDLCYSNPCRNGGACARREGGYTCVCRPRFTDCEL
FT                   DTEAGRCVPGVCRNGGTCTNAPNGGFRCQCPAGGAFEGPRCEVAARSFPPSSFVMFRGL
FT                   RQRFHLTLSLSFATVQPSGLLFYNGRLNEKHDFLALELVAGQVRLTYSTGESNTVVSPT
FT                   VPGGLSDGQWHTVHLRYYNKPRTDALGGAQGPSKDKVAVLSVDDCNVAVALQFGAEIGN
FT                   YSCAAAGVQTSSKKSLDLTGPLLLGGVPNLPENFPVSHKDFIGCMRDLHIDGRRMDMAA
FT                   FVANNGTMAGCQAKSHFCASGPCKNNGFCSERWGGFSCDCPVGFGGKDCRLTMAHPYHF
FT                   QGNGTLSWDFGNDMAVSVPWYLGLSFRTRATKGILMQVQLGPHSVLLCKLDRGLLSVTL
FT                   NRASGHTVHLLLDQMTVSDGRWHDLRLELQEEPGGRRGHHIFMVSLDFTLFQDTMAMGG
FT                   ELQGLKVKQLHVGGLPPSSKEEGHQGLVGCIQGVWIGFTPFGSSALLPPSHRVNVEPGC
FT                   TVTNPCASGPCPPHADCKDLWQTFSCTCRPGYYGPGCVDACLLNPCQNQGSCRHLQGAP
FT                   HGYTCDCVSGYFGQHCEHRVDQQCPRGWWGSPTCGPCNCDVHKGFDPNCNKTNGQCHCK
FT                   EFHYRPRGSDSCLPCDCYPVGSTSRSCAPHSGQCPCRPGALGRQCNSCDSPFAEVTASG
FT                   CRVLYDACPKSLRSGVWWPQTKFGVLATVPCPRGALGAAVRLCDEDQGWLEPDLFNCTS
FT                   PAFRELSLLLDGLELNKTALDTVEAKKLAQRLREVTGQTDHYFSQDVRVTARLLAYLLA
FT                   FESHQQGFGLTATQDAHFNENLLWAGSALLAPETGHLWAALGQRAPGGSPGSAGLVQHL
FT                   EEYAATLARNMELTYLNPVGLVTPNIMLSIDRMEHPSSTQGARRYPRYHSNLFRGQDAW
FT                   DPHTHVLLPSQASQPSPSEVLPTSSNAENATASSVVSPPAPLEPESEPGISIVILLVYR
FT                   ALGGLLPAQFQAERRGARLPQNPVMNSPVVSVAVFHGRNFLRGVLVSPINLEFRLLQTA
FT                   NRSKAICVQWDPPGPTDQHGMWTARDCELVHRNGSHARCRCSRTGTFGVLMDASPRERL
FT                   EGDLELLAVFTHVVVAVSVTALVLTAAVLLSLRSLKSNVRGIHANVAAALGVAELLFLL
FT                   GIHRTHNQLLCTAVAILLHYFFLSTFAWLLVQGLHLYRMQVEPRNVDRGAMRFYHALGW
FT                   GVPAVLLGLAVGLDPEGYGNPDFCWISIHEPLIWSFAGPIVLVIVMNGTMFLLAARTSC
FT                   STGQREAKKTSVLRTLRSSFLLLLLVSASWLFGLLAVNHSILAFHYLHAGLCGLQGLAV
FT                   LLLFCVLNADARAAWTPACLGKKAAPEETRPAPGPGSGAYNNTALFEESGLIRITLGAS
FT                   TVSSVSSARSGRAQDQDSQRGRSYLRDNVLVRHGSTAEHTERSLQAHAGPTDLDVAMFH
FT                   RDAGADSDSDSDLSLEEERSLSIPSSESEDNGRTRGRFQRPLRRAAQSERLLAHPKDVD
FT                   GNDLLSYWPALGECEAAPCALQAWGSERRLGLDSNKDAANNNQPELALTSGDETSLGRA
FT                   QRQRKGILKNRLQYPLVPQSRGTPELSWCRAATLGHRAVPAASYGRIYAGGGTGSLSQP
FT                   ASRYSSREQLDLLLRRQLSKERLEEVPVPAPVLHPLSRPGSQERLDTAPARLEARDRGS
FT                   TLPRRQPPRDYPGTMAGRFGSRDALDLGAPREWLSTLPPPRRNRDLDPQHPPLPLSPQR
FT                   QLSRDPLLPSRPLDSLSRISNSREGLDQVPSRHPSREALGPAPQLLRAREDPASGPSHG
FT                   PSTEQLDILSSILASFNSSALSSVQSSSTPSGPHTTATASALGPSTPRSATSHSISELS
FT                   PDSEVPRSEGHS"
FT   CDS             join(19597205..19600925,19602563..19603213,
FT                   19603579..19603798,19604050..19604165,19604538..19604626,
FT                   19604739..19604896,19605434..19605597,19605886..19606011,
FT                   19606106..19606275,19606671..19606856,19607415..19607531,
FT                   19607877..19608048,19608202..19608343,19608440..19608560,
FT                   19608852..19609035,19609349..19609450,19610881..19610975,
FT                   19611173..19611382,19611636..19611831,19612072..19612227,
FT                   19612562..19612733,19613365..19613532,19613746..19613872,
FT                   19613966..19614172,19614416..19614590,19614798..19614910,
FT                   19615335..19615414,19615917..19616040,19616575..19616691,
FT                   19616787..19616935,19617193..19617302,19617581..19617739,
FT                   19618416..19618616,19619501..19620380,19622190..19622217)
FT                   /codon_start=1
FT                   /gene="Celsr3"
FT                   /locus_tag="mCG_140685"
FT                   /product="cadherin EGF LAG seven-pass G-type receptor 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG140685.0 transcript_id=mCT191537.0
FT                   protein_id=mCP112468.0 isoform=CRA_b"
FT                   /protein_id="EDL21317.1"
FT                   /translation="MARRPLWWGLPGPSTPVLLLLLLSLFPFSREELGGGGDQDWDPGV
FT                   ATTTGPRAQIGSGAVALCPESPGVWEDGDPGLGVREPVFMRLRVGRQNARNGRGAPEQP
FT                   NAEVVVQALGSREQEAGQGPGYLLCWHPEISSCGRTGPLRRGSLPLDALSPGDSDLRNS
FT                   SPHPSELLAQPDGSRPVAFQRNARRSIRKRVETSRCCGKLWEPGHKGQGERSATSTVER
FT                   GPFRRDCLPGSLGSGLGEDSAPRAVRTAPTPGSAPRESRTAPGRMRSRGLFRRRFLFER
FT                   PGPRPPGFPTGPEAKQILSTNQARPRRAANRHPQFPQYNYQTLVPENEAAGTSVLRVVA
FT                   QDPDPGEAGRLIYSLAALMNSRSLELFSIDPQSGLIRTAAALDRESMERHYLRVTAQDH
FT                   GSPRLSATTMVAVTVADRNDHAPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNAN
FT                   LRYRFVGSPAVRTAAAAAFEIDPRSGLISTSGRVDREHMESYELVVEASDQGQEPGPRS
FT                   ATVRVHITVLDENDNAPQFSEKRYVAQVREDVRPHTVVLRVTATDKDKDANGLVHYNII
FT                   SGNSRGHFAIDSLTGEIQVMAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDI
FT                   NDHAPIFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENSRLEYSLTGVASDTPFVINS
FT                   ATGWVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYH
FT                   LRLNEDAAVGTSVVSVTAVDRDANSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDY
FT                   KQERYFKLVLTASDRALHDHCYVHINITDANTHRPVFQSAHYSVSMNEDRPVGSTVVVI
FT                   SASDDDVGENARITYLLEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIP
FT                   QKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDAHANGRVQY
FT                   TFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPPLRTPVSIQVTV
FT                   QDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDDGPNAHIMYQIVEGNIPELFQ
FT                   MDIFSGELTALIDLDYEARQEYVIVVQATSAPLVSRATVHVRLVDQNDNSPVLNNFQIL
FT                   FNNYVSNRSDTFPSGIIGRIPAYDPDVSDHLFYSFERGNELQLLVVNRTSGELRLSRKL
FT                   DNNRPLVASMLVTVTDGLHSVTAQCVLRVVIITEELLANSLTVRLENMWQERFLSPLLG
FT                   HFLEGVAAVLATPTEDVFIFNIQNDTDVGGTVLNVSFSALAPRGAGAGAAGPWFSSEEL
FT                   QEQLYVRRAALAARSLLDVLPFDDNVCLREPCENYMKCVSVLRFDSSAPFLASTSTLFR
FT                   PIQPIAGLRCRCPPGFTGDFCETELDLCYSNPCRNGGACARREGGYTCVCRPRFTDCEL
FT                   DTEAGRCVPGVCRNGGTCTNAPNGGFRCQCPAGGAFEGPRCEVAARSFPPSSFVMFRGL
FT                   RQRFHLTLSLSFATVQPSGLLFYNGRLNEKHDFLALELVAGQVRLTYSTGESNTVVSPT
FT                   VPGGLSDGQWHTVHLRYYNKPRTDALGGAQGPSKDKVAVLSVDDCNVAVALQFGAEIGN
FT                   YSCAAAGVQTSSKKSLDLTGPLLLGGVPNLPENFPVSHKDFIGCMRDLHIDGRRMDMAA
FT                   FVANNGTMAGCQAKSHFCASGPCKNNGFCSERWGGFSCDCPVGFGGKDCRLTMAHPYHF
FT                   QGNGTLSWDFGNDMAVSVPWYLGLSFRTRATKGILMQVQLGPHSVLLCKLDRGLLSVTL
FT                   NRASGHTVHLLLDQMTVSDGRWHDLRLELQEEPGGRRGHHIFMVSLDFTLFQDTMAMGG
FT                   ELQGLKVKQLHVGGLPPSSKEEGHQGLVGCIQGVWIGFTPFGSSALLPPSHRVNVEPGC
FT                   TVTNPCASGPCPPHADCKDLWQTFSCTCRPGYYGPGCVDACLLNPCQNQGSCRHLQGAP
FT                   HGYTCDCVSGYFGQHCEHRVDQQCPRGWWGSPTCGPCNCDVHKGFDPNCNKTNGQCHCK
FT                   EFHYRPRGSDSCLPCDCYPVGSTSRSCAPHSGQCPCRPGALGRQCNSCDSPFAEVTASG
FT                   CRVLYDACPKSLRSGVWWPQTKFGVLATVPCPRGALGAAVRLCDEDQGWLEPDLFNCTS
FT                   PAFRELSLLLDGLELNKTALDTVEAKKLAQRLREVTGQTDHYFSQDVRVTARLLAYLLA
FT                   FESHQQGFGLTATQDAHFNENLLWAGSALLAPETGHLWAALGQRAPGGSPGSAGLVQHL
FT                   EEYAATLARNMELTYLNPVGLVTPNIMLSIDRMEHPSSTQGARRYPRYHSNLFRGQDAW
FT                   DPHTHVLLPSQASQPSPSEVLPTSSNAENATASSVVSPPAPLEPESEPGISIVILLVYR
FT                   ALGGLLPAQFQAERRGARLPQNPVMNSPVVSVAVFHGRNFLRGVLVSPINLEFRLLQTA
FT                   NRSKAICVQWDPPGPTDQHGMWTARDCELVHRNGSHARCRCSRTGTFGVLMDASPRERL
FT                   EGDLELLAVFTHVVVAVSVTALVLTAAVLLSLRSLKSNVRGIHANVAAALGVAELLFLL
FT                   GIHRTHNQLLCTAVAILLHYFFLSTFAWLLVQGLHLYRMQVEPRNVDRGAMRFYHALGW
FT                   GVPAVLLGLAVGLDPEGYGNPDFCWISIHEPLIWSFAGPIVLVIVMNGTMFLLAARTSC
FT                   STGQREAKKTSVLTLRSSFLLLLLVSASWLFGLLAVNHSILAFHYLHAGLCGLQGLAVL
FT                   LLFCVLNADARAAWTPACLGKKAAPEETRPAPGPGSGAYNNTALFEESGLIRITLGAST
FT                   VSSVSSARSGRAQDQDSQRGRSYLRDNVLVRHGSTAEHTERSLQAHAGPTDLDVAMFHR
FT                   DAGADSDSDSDLSLEEERSLSIPSSESEDNGRTRGRFQRPLRRAAQSERLLAHPKDVDG
FT                   NDLLSYWPALGECEAAPCALQAWGSERRLGLDSNKDAANNNQPELALTSGDETSLGRAQ
FT                   RQRKGILKNRLQYPLVPQSRGTPELSWCRAATLGHRAVPAASYGRIYAGGGTGSLSQPA
FT                   SRYSSREQLDLLLRRQLSKERLEEVPVPAPVLHPLSRPGSQERLDTAPARLEARDRGST
FT                   LPRRQPPRDYPGTMAGRFGSRDALDLGAPREWLSTLPPPRRNRDLDPQHPPLPLSPQRQ
FT                   LSRDPLLPSRPLDSLSRISNSREGLDQVPSRHPSREALGPAPQLLRAREDPASGPSHGP
FT                   STEQLDILSSILASFNSSALSSVQSSSTPSGPHTTATASALGPSTPRSATSHSISELSP
FT                   DSEVPRSEGHS"
FT   gene            <19624947..19634766
FT                   /gene="Slc26a6"
FT                   /locus_tag="mCG_140690"
FT                   /note="gene_id=mCG140690.1"
FT   mRNA            join(<19624947..19626831,19626912..19627051,
FT                   19627221..19627331,19627565..19627713,19627830..19627994,
FT                   19628085..19628233,19628555..19628637,19628714..19628861,
FT                   19629086..19629199,19629320..19629397,19629713..19629808,
FT                   19629890..19629996,19630176..19630245,19631492..19631584,
FT                   19631687..19631791,19632187..19632279,19632971..19633147,
FT                   19633317..19633371,19634134..19634270,19634493..19634766)
FT                   /gene="Slc26a6"
FT                   /locus_tag="mCG_140690"
FT                   /product="solute carrier family 26, member 6, transcript
FT                   variant mCT191558"
FT                   /note="gene_id=mCG140690.1 transcript_id=mCT191558.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<19624960..19626831,19626912..19627051,
FT                   19627221..19627994,19628081..19628233,19628555..19628637,
FT                   19628714..19628861,19629086..19629199,19629320..19629397,
FT                   19629713..19629808,19629890..19629996,19630176..19630245,
FT                   19631492..19631584,19631687..19631791,19632187..19632279,
FT                   19632971..19633147,19633317..19633371,19634134..19634270,
FT                   19634493..19634766)
FT                   /gene="Slc26a6"
FT                   /locus_tag="mCG_140690"
FT                   /product="solute carrier family 26, member 6, transcript
FT                   variant mCT191559"
FT                   /note="gene_id=mCG140690.1 transcript_id=mCT191559.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<19624981..19625074,19626666..19626831,
FT                   19626912..19627051,19627221..19627994,19628081..19628233,
FT                   19628555..19628637,19628714..19628861,19629086..19629199,
FT                   19629320..19629397,19629713..19629808,19629890..19629996,
FT                   19630176..19630245,19631492..19631584,19631687..19631791,
FT                   19632187..19632279,19632971..>19633300)
FT                   /gene="Slc26a6"
FT                   /locus_tag="mCG_140690"
FT                   /product="solute carrier family 26, member 6, transcript
FT                   variant mCT191557"
FT                   /note="gene_id=mCG140690.1 transcript_id=mCT191557.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(19624985..19625074,19626666..19626831,
FT                   19626912..19627051,19627221..19627331,19627565..19627713,
FT                   19627830..19627994,19628081..19628233,19628555..19628637,
FT                   19628714..19628861,19629086..19629199,19629320..19629397,
FT                   19629713..19629808,19629890..19629996,19630176..19630245,
FT                   19631492..19631584,19631687..19631791,19632187..19632279,
FT                   19632971..19633147,19633317..19633371,19634134..19634270,
FT                   19634493..19634766)
FT                   /gene="Slc26a6"
FT                   /locus_tag="mCG_140690"
FT                   /product="solute carrier family 26, member 6, transcript
FT                   variant mCT170761"
FT                   /note="gene_id=mCG140690.1 transcript_id=mCT170761.0
FT                   created on 18-JUL-2002"
FT   CDS             join(19625053..19625074,19626666..19626831,
FT                   19626912..19627051,19627221..19627331,19627565..19627713,
FT                   19627830..19627994,19628081..19628233,19628555..19628637,
FT                   19628714..19628861,19629086..19629199,19629320..19629397,
FT                   19629713..19629808,19629890..19629996,19630176..19630245,
FT                   19631492..19631584,19631687..19631791,19632187..19632279,
FT                   19632971..19633147,19633317..19633371,19634134..19634270,
FT                   19634493..19634507)
FT                   /codon_start=1
FT                   /gene="Slc26a6"
FT                   /locus_tag="mCG_140690"
FT                   /product="solute carrier family 26, member 6, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG140690.1 transcript_id=mCT170761.0
FT                   protein_id=mCP93678.0 isoform=CRA_a"
FT                   /protein_id="EDL21318.1"
FT                   /translation="MGLPDGSDQGTHQTQALLSAAQEMELQRRDYHVERPLLNQEQLED
FT                   LGHWGPAAKTHQWRTWFRCSRARAHSLLLQHVPVLGWLPRYPVREWLLGDLLSGLSVAI
FT                   MQLPQGLAYALLAGLPPMFGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESL
FT                   TADKAFVQGLNATADDARVQVAYTLSFLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTA
FT                   ASVQVLVSQLKYVFGIKLSSHSGPLSVIYTVLEVCAQLPETVPGTVVTAIVAGVALVLV
FT                   KLLNEKLHRRLPLPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTGLIPPVAPKTE
FT                   LFATLVGNAFAIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPV
FT                   SCSMSRSLVQESTGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMM
FT                   KQFSDICSLWKANRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVL
FT                   GQVPDTDIYRDVAEYSGAKEVPGVKVFRSSATLYFANAELYSDSLKEKCGVDVDRLITQ
FT                   KKKRIKKQEMKLKRMKKAKKSQKQDASSKISSVSVNVNTNLEDVKSNDVEGSEAKVHQG
FT                   EELQDVVSSNQEDAKAPTMTSLKSLGLPQPGFHSLILDLSTLSFVDTVCIKSLKNIFRD
FT                   FREIEVEVYIAACYSPVVAQLEAGHFFDESITKQHVFASVHDAVTFALSHRKSVPKSPV
FT                   LATKL"
FT   mRNA            join(19625149..19625722,19626666..19626831,
FT                   19626912..19627051,19627221..19627331,19627565..19627713,
FT                   19627830..19627994,19628081..19628233,19628555..19628637,
FT                   19628714..19628861,19629086..19629199,19629320..19629397,
FT                   19629713..19629808,19629890..19629996,19630176..19630245,
FT                   19631492..19631584,19631687..19631791,19632187..19632279,
FT                   19632971..19633147,19633317..19633371,19634134..19634270,
FT                   19634493..19634766)
FT                   /gene="Slc26a6"
FT                   /locus_tag="mCG_140690"
FT                   /product="solute carrier family 26, member 6, transcript
FT                   variant mCT170762"
FT                   /note="gene_id=mCG140690.1 transcript_id=mCT170762.0
FT                   created on 18-JUL-2002"
FT   CDS             join(19626713..19626831,19626912..19627051,
FT                   19627221..19627331,19627565..19627713,19627830..19627994,
FT                   19628081..19628233,19628555..19628637,19628714..19628861,
FT                   19629086..19629199,19629320..19629397,19629713..19629808,
FT                   19629890..19629996,19630176..19630245,19631492..19631584,
FT                   19631687..19631791,19632187..19632279,19632971..19633147,
FT                   19633317..19633371,19634134..19634270,19634493..19634507)
FT                   /codon_start=1
FT                   /gene="Slc26a6"
FT                   /locus_tag="mCG_140690"
FT                   /product="solute carrier family 26, member 6, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG140690.1 transcript_id=mCT170762.0
FT                   protein_id=mCP93679.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8CIW6"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="MGI:MGI:2159728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CIW6"
FT                   /protein_id="EDL21319.1"
FT                   /translation="MELQRRDYHVERPLLNQEQLEDLGHWGPAAKTHQWRTWFRCSRAR
FT                   AHSLLLQHVPVLGWLPRYPVREWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPMFGLYS
FT                   SFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLTADKAFVQGLNATADDARVQVAY
FT                   TLSFLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVLVSQLKYVFGIKLSSHSG
FT                   PLSVIYTVLEVCAQLPETVPGTVVTAIVAGVALVLVKLLNEKLHRRLPLPIPGELLTLI
FT                   GATGISYGVKLNDRFKVDVVGNITTGLIPPVAPKTELFATLVGNAFAIAVVGFAIAISL
FT                   GKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPVSCSMSRSLVQESTGGNTQVAGAV
FT                   SSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKANRVDLLIWLVT
FT                   FVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQVPDTDIYRDVAEYSGAKEVPG
FT                   VKVFRSSATLYFANAELYSDSLKEKCGVDVDRLITQKKKRIKKQEMKLKRMKKAKKSQK
FT                   QDASSKISSVSVNVNTNLEDVKSNDVEGSEAKVHQGEELQDVVSSNQEDAKAPTMTSLK
FT                   SLGLPQPGFHSLILDLSTLSFVDTVCIKSLKNIFRDFREIEVEVYIAACYSPVVAQLEA
FT                   GHFFDESITKQHVFASVHDAVTFALSHRKSVPKSPVLATKL"
FT   CDS             join(<19627662..19627713,19627830..19627994,
FT                   19628085..19628233,19628555..19628637,19628714..19628861,
FT                   19629086..19629199,19629320..19629397,19629713..19629808,
FT                   19629890..19629996,19630176..19630245,19631492..19631584,
FT                   19631687..19631791,19632187..19632279,19632971..19633147,
FT                   19633317..19633371,19634134..19634270,19634493..19634507)
FT                   /codon_start=1
FT                   /gene="Slc26a6"
FT                   /locus_tag="mCG_140690"
FT                   /product="solute carrier family 26, member 6, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG140690.1 transcript_id=mCT191558.0
FT                   protein_id=mCP112515.0 isoform=CRA_d"
FT                   /protein_id="EDL21321.1"
FT                   /translation="CTRAGGLHTQLPGRPLPGGAGPGTLRLRCHLPVRASGPQLYHGCI
FT                   CASPRLSAQVCVWHQTQQSLWATVRYLLLEVCAQLPETVPGTVVTAIVAGVALVLVKLL
FT                   NEKLHRRLPLPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTGLIPPVAPKTELFA
FT                   TLVGNAFAIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPVSCS
FT                   MSRSLVQESTGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQF
FT                   SDICSLWKANRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQV
FT                   PDTDIYRDVAEYSGAKEVPGVKVFRSSATLYFANAELYSDSLKEKCGVDVDRLITQKKK
FT                   RIKKQEMKLKRMKKAKKSQKQDASSKISSVSVNVNTNLEDVKSNDVEGSEAKVHQGEEL
FT                   QDVVSSNQEDAKAPTMTSLKSLGLPQPGFHSLILDLSTLSFVDTVCIKSLKNIFRDFRE
FT                   IEVEVYIAACYSPVVAQLEAGHFFDESITKQHVFASVHDAVTFALSHRKSVPKSPVLAT
FT                   KL"
FT   CDS             join(<19627809..19627994,19628081..19628233,
FT                   19628555..19628637,19628714..19628861,19629086..19629199,
FT                   19629320..19629397,19629713..19629808,19629890..19629996,
FT                   19630176..19630245,19631492..19631584,19631687..19631791,
FT                   19632187..19632279,19632971..19633147,19633317..19633371,
FT                   19634134..19634270,19634493..19634507)
FT                   /codon_start=1
FT                   /gene="Slc26a6"
FT                   /locus_tag="mCG_140690"
FT                   /product="solute carrier family 26, member 6, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG140690.1 transcript_id=mCT191559.0
FT                   protein_id=mCP112516.0 isoform=CRA_e"
FT                   /protein_id="EDL21322.1"
FT                   /translation="LSPATQQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVLVSQLKY
FT                   VFGIKLSSHSGPLSVIYTVLEVCAQLPETVPGTVVTAIVAGVALVLVKLLNEKLHRRLP
FT                   LPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTGLIPPVAPKTELFATLVGNAFAI
FT                   AVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPVSCSMSRSLVQES
FT                   TGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKA
FT                   NRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQVPDTDIYRDV
FT                   AEYSGAKEVPGVKVFRSSATLYFANAELYSDSLKEKCGVDVDRLITQKKKRIKKQEMKL
FT                   KRMKKAKKSQKQDASSKISSVSVNVNTNLEDVKSNDVEGSEAKVHQGEELQDVVSSNQE
FT                   DAKAPTMTSLKSLGLPQPGFHSLILDLSTLSFVDTVCIKSLKNIFRDFREIEVEVYIAA
FT                   CYSPVVAQLEAGHFFDESITKQHVFASVHDAVTFALSHRKSVPKSPVLATKL"
FT   CDS             join(<19627809..19627994,19628081..19628233,
FT                   19628555..19628637,19628714..19628861,19629086..19629199,
FT                   19629320..19629397,19629713..19629808,19629890..19629996,
FT                   19630176..19630245,19631492..19631584,19631687..19631791,
FT                   19632187..19632279,19632971..>19633300)
FT                   /codon_start=1
FT                   /gene="Slc26a6"
FT                   /locus_tag="mCG_140690"
FT                   /product="solute carrier family 26, member 6, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG140690.1 transcript_id=mCT191557.0
FT                   protein_id=mCP112514.0 isoform=CRA_c"
FT                   /protein_id="EDL21320.1"
FT                   /translation="LSPATQQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVLVSQLKY
FT                   VFGIKLSSHSGPLSVIYTVLEVCAQLPETVPGTVVTAIVAGVALVLVKLLNEKLHRRLP
FT                   LPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTGLIPPVAPKTELFATLVGNAFAI
FT                   AVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPVSCSMSRSLVQES
FT                   TGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKA
FT                   NRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQVPDTDIYRDV
FT                   AEYSGAKEVPGVKVFRSSATLYFANAELYSDSLKEKCGVDVDRLITQKKKRIKKQEMKL
FT                   KRMKKAKKSQKQDASSKISSVSVNVNTNLEDVKSNDVEGSEAKVHQGEELQDVVSSNQE
FT                   DAKAPTMTSLKSLGLPQPGFHSLILDLSTLSFVDTVCIKSLKNVRDCRQARAPQAFMLI
FT                   LPLASHLLATPPPNKPSPLSSPTKPCPIAASLRPA"
FT   gene            19636341..19637289
FT                   /locus_tag="mCG_140689"
FT                   /note="gene_id=mCG140689.0"
FT   mRNA            join(19636341..19636681,19637089..19637289)
FT                   /locus_tag="mCG_140689"
FT                   /product="mCG140689"
FT                   /note="gene_id=mCG140689.0 transcript_id=mCT170760.0
FT                   created on 18-JUL-2002"
FT   CDS             join(19636358..19636681,19637089..19637274)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140689"
FT                   /product="mCG140689"
FT                   /note="gene_id=mCG140689.0 transcript_id=mCT170760.0
FT                   protein_id=mCP93680.0"
FT                   /protein_id="EDL21323.1"
FT                   /translation="MLYTLLLVPSLFLLVMPVPSQGWSRPLWYQVGLDLQPWGCQPNSP
FT                   DIWGCQPNSLDSCKNSLGCPGYWLGLGGNRIYPVAGVTITTTMLLVVSRVIVHRWRAKV
FT                   AKGQLPAVTSSSGKHWKEQPTVSDRTLVLRVLHMLDAILLHIEGHLQGLASQQQIQIKG
FT                   SPPQSG"
FT   gene            19658399..19671317
FT                   /gene="Uqcrc1"
FT                   /locus_tag="mCG_16482"
FT                   /note="gene_id=mCG16482.2"
FT   mRNA            join(19658399..19658538,19658767..19658907,
FT                   19663912..19663998,19665835..19665964,19666481..19666679,
FT                   19667151..19667230,19668616..19668731,19669014..19669157,
FT                   19669276..19669436,19669534..19669619,19670223..19670311,
FT                   19670617..19670692,19671113..19671317)
FT                   /gene="Uqcrc1"
FT                   /locus_tag="mCG_16482"
FT                   /product="ubiquinol-cytochrome c reductase core protein 1"
FT                   /note="gene_id=mCG16482.2 transcript_id=mCT18728.2 created
FT                   on 18-JUL-2002"
FT   CDS             join(19658470..19658538,19658767..19658907,
FT                   19663912..19663998,19665835..19665964,19666481..19666679,
FT                   19667151..19667230,19668616..19668731,19669014..19669157,
FT                   19669276..19669436,19669534..19669619,19670223..19670311,
FT                   19670617..19670692,19671113..19671177)
FT                   /codon_start=1
FT                   /gene="Uqcrc1"
FT                   /locus_tag="mCG_16482"
FT                   /product="ubiquinol-cytochrome c reductase core protein 1"
FT                   /note="gene_id=mCG16482.2 transcript_id=mCT18728.2
FT                   protein_id=mCP23369.2"
FT                   /db_xref="GOA:Q9CZ13"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="MGI:MGI:107876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CZ13"
FT                   /protein_id="EDL21324.1"
FT                   /translation="MAASAVCRAACSGTQVLLRTRRSPALLRLPALRGTATFAQALQSV
FT                   PETQVSILDNGLRVASEQSSHATCTVGVWIDAGSRYETEKNNGAGYFLEHLAFKGTKNR
FT                   PGNALEKEVESIGAHLNAYSTREHTAYLIKALSKDLPKVVELLADIVQNSSLEDSQIEK
FT                   ERDVILREMQENDASMQNVVFDYLHATAFQGTPLAQAVEGPSENVRRLSRTDLTDYLNR
FT                   HYKAPRMVLAAAGGVEHQQLLDLAQKHLSSVSRVYEEDAVPGLTPCRFTGSEIRHRDDA
FT                   LPLAHVAIAVEGPGWANPDNVTLQVANAIIGHYDCTYGGGVHLSSPLASVAVANKLCQS
FT                   FQTFNISYSDTGLLGAHFVCDAMSIDDMVFFLQGQWMRLCTSATESEVTRGKNILRNAL
FT                   VSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIQEVDAQMLRDICSKYFYDQCPAVAG
FT                   YGPIEQLPDYNRIRSGMFWLRF"
FT   gene            <19675423..19706535
FT                   /gene="Col7a1"
FT                   /locus_tag="mCG_134066"
FT                   /note="gene_id=mCG134066.0"
FT   mRNA            join(<19675423..19675510,19676008..19676188,
FT                   19676874..19677033,19677122..19677215,19677308..19677469,
FT                   19677571..19677734,19677809..19677938,19678041..19678157,
FT                   19678240..19678386,19678472..19678588,19678666..19678815,
FT                   19678893..19679021,19679771..19679914,19680003..19680128,
FT                   19680241..19680384,19680912..19681031,19681166..19681309,
FT                   19681611..19681736,19681840..19681986,19682189..19682311,
FT                   19682627..19682773,19683021..19683155,19683230..19683376,
FT                   19683455..19683591,19683832..19683958,19684041..19684187,
FT                   19684275..19684447,19684540..19684575,19684660..19684686,
FT                   19684778..19684822,19684893..19684955,19685543..19685614,
FT                   19685705..19685740,19685876..19685911,19686068..19686139,
FT                   19686242..19686319,19686705..19686731,19686813..19686866,
FT                   19686956..19687018,19687093..19687152,19687234..19687269,
FT                   19687466..19687510,19687582..19687617,19687958..19688002,
FT                   19688091..19688126,19688227..19688259,19688649..19688681,
FT                   19688827..19688880,19688960..19689019,19689113..19689148,
FT                   19689260..19689340,19689426..19689461,19689661..19689705,
FT                   19689959..19690030,19690250..19690294,19690532..19690558,
FT                   19690756..19690785,19690917..19690988,19691081..19691116,
FT                   19691192..19691227,19691317..19691397,19691609..19691644,
FT                   19692013..19692075,19692160..19692204,19693111..19693146,
FT                   19693217..19693252,19693360..19693455,19693570..19693605,
FT                   19693697..19693732,19693849..19693896,19694183..19694218,
FT                   19694346..19694468,19694555..19694755,19694848..19694883,
FT                   19694963..19695016,19695165..19695233,19695308..19695352,
FT                   19695469..19695531,19695721..19695765,19696077..19696112,
FT                   19696229..19696264,19696420..19696464,19696579..19696611,
FT                   19696685..19696747,19696866..19696901,19696982..19697062,
FT                   19697189..19697257,19697379..19697414,19697482..19697523,
FT                   19697693..19697737,19697827..19697871,19698736..19698771,
FT                   19698855..19698914,19699021..19699128,19699299..19699370,
FT                   19699477..19699512,19699609..19699668,19699774..19699818,
FT                   19700006..19700041,19700154..19700189,19700267..19700323,
FT                   19700477..19700548,19700870..19700945,19701155..19701186,
FT                   19701455..19701535,19701863..19701916,19702181..19702234,
FT                   19702312..19702374,19702718..19702780,19702884..19703000,
FT                   19703956..19704033,19704126..19704179,19704330..19704378,
FT                   19704990..19705022,19705175..19705261,19705445..19705573,
FT                   19705674..19705868,19706158..19706535)
FT                   /gene="Col7a1"
FT                   /locus_tag="mCG_134066"
FT                   /product="procollagen, type VII, alpha 1"
FT                   /note="gene_id=mCG134066.0 transcript_id=mCT135444.0
FT                   created on 18-JUL-2002"
FT   CDS             join(19675423..19675510,19676008..19676188,
FT                   19676874..19677033,19677122..19677215,19677308..19677469,
FT                   19677571..19677734,19677809..19677938,19678041..19678157,
FT                   19678240..19678386,19678472..19678588,19678666..19678815,
FT                   19678893..19679021,19679771..19679914,19680003..19680128,
FT                   19680241..19680384,19680912..19681031,19681166..19681309,
FT                   19681611..19681736,19681840..19681986,19682189..19682311,
FT                   19682627..19682773,19683021..19683155,19683230..19683376,
FT                   19683455..19683591,19683832..19683958,19684041..19684187,
FT                   19684275..19684447,19684540..19684575,19684660..19684686,
FT                   19684778..19684822,19684893..19684955,19685543..19685614,
FT                   19685705..19685740,19685876..19685911,19686068..19686139,
FT                   19686242..19686319,19686705..19686731,19686813..19686866,
FT                   19686956..19687018,19687093..19687152,19687234..19687269,
FT                   19687466..19687510,19687582..19687617,19687958..19688002,
FT                   19688091..19688126,19688227..19688259,19688649..19688681,
FT                   19688827..19688880,19688960..19689019,19689113..19689148,
FT                   19689260..19689340,19689426..19689461,19689661..19689705,
FT                   19689959..19690030,19690250..19690294,19690532..19690558,
FT                   19690756..19690785,19690917..19690988,19691081..19691116,
FT                   19691192..19691227,19691317..19691397,19691609..19691644,
FT                   19692013..19692075,19692160..19692204,19693111..19693146,
FT                   19693217..19693252,19693360..19693455,19693570..19693605,
FT                   19693697..19693732,19693849..19693896,19694183..19694218,
FT                   19694346..19694468,19694555..19694755,19694848..19694883,
FT                   19694963..19695016,19695165..19695233,19695308..19695352,
FT                   19695469..19695531,19695721..19695765,19696077..19696112,
FT                   19696229..19696264,19696420..19696464,19696579..19696611,
FT                   19696685..19696747,19696866..19696901,19696982..19697062,
FT                   19697189..19697257,19697379..19697414,19697482..19697523,
FT                   19697693..19697737,19697827..19697871,19698736..19698771,
FT                   19698855..19698914,19699021..19699128,19699299..19699370,
FT                   19699477..19699512,19699609..19699668,19699774..19699818,
FT                   19700006..19700041,19700154..19700189,19700267..19700323,
FT                   19700477..19700548,19700870..19700945,19701155..19701186,
FT                   19701455..19701535,19701863..19701916,19702181..19702234,
FT                   19702312..19702374,19702718..19702780,19702884..19703000,
FT                   19703956..19704033,19704126..19704179,19704330..19704378,
FT                   19704990..19705022,19705175..19705261,19705445..19705573,
FT                   19705674..19705868,19706158..19706168)
FT                   /codon_start=1
FT                   /gene="Col7a1"
FT                   /locus_tag="mCG_134066"
FT                   /product="procollagen, type VII, alpha 1"
FT                   /note="gene_id=mCG134066.0 transcript_id=mCT135444.0
FT                   protein_id=mCP68811.0"
FT                   /protein_id="EDL21325.1"
FT                   /translation="MRLRLLVAALCAAEILMGAPEVWAQPRDRVTCTRLYAADIVFLLD
FT                   GSSSIGRSNFREVRGFLEGLVLPFSGAASAQGVRFATVQYSDDPQTEFGLDTLGSGSDT
FT                   IRAIRELSYKGGNTRTGAALHHVSDRVFLPRLTRPGVPKVCILITDGKSQDLVDTAAQK
FT                   LKGQGVKLFAVGIKNADPEELKRVASQPTSDFFFFVNDFSILRTLLPLISRRVCTTAGG
FT                   VPVTLPSDDTPSGPRDLVLSEPSSQSLRVQWTAASGPVTGYKVQYTPLTGLGQPLPSER
FT                   QEVNIPAGETSTRLQGLRPLTDYQVTVVALYANSIGEAVSGTARTTAKEGLELSLQNIT
FT                   SHSLLVAWRRVPGANGYRVTWRDLSGGPTQQQDLSPGQGSVFLDHLEPGTDYEVTVSAL
FT                   FGHSVGPAASLTARTASSVEQTLHPIILSPTSILLSWNLVPEARGYRLEWRRESGLETP
FT                   QKVELPPDVTRHQLDGLQPGTEYRLTLYTLLEGREVATPATVVPTGLEQLVSPVMNLQA
FT                   IELPGQRVRVSWNPVPGATEYRFTVRTTQGVERTLLLPGSQTTFDLDDVRAGLSYTVRV
FT                   SARVGAQEGDASILTIHRDPEAPLVVPGLRVVASDATRIRVAWGLVPGASGFRISWRTG
FT                   SGPESSRTLTPDSTVTDILGLQPGTSYQVAVSALRGREEGPPVVIVARTDPLGPVRRVH
FT                   LTQAGSSSVSITWTGVPGATGYRVSWHSGHGPEKSLLVSGDATVAEIDGLEPDTEYIVR
FT                   VRTHVAGVDGAPASVVVRTAPEPVGSVSKLQILNASSDVLRVTWVGVPGATSYKLAWGR
FT                   SEGGPMKHRILPGNKESAEIRDLEGGVSYSVRVTALVGDREGAPVSIVITTPPATPALL
FT                   ETLQVVQSGEHSLRLRWEPVPGAPGFRLHWQPEGGQEQSLTLGPESNSYNLVGLEPATK
FT                   YQVWLTVLGQTGEGPPRKVTAYTEPSHIPSTELRVVDTSIDSVTLTWTPVSGASSYILS
FT                   WRPLRGTGQEVPRAPQTLPGTSSSHRVTGLEPGISYVFSLTPIQSGVRGSEISVTQTPA
FT                   CSHGPVDVVFLLHATRDNAHNAEAVRRVLERLVSALGPLGPQAAQVGLLTYSHRPSPLF
FT                   PLNSSHDLGIILRKIRDIPYVDPSGNNLGTAVTTAHRYLLASNAPGRRQQVPGVMVLLV
FT                   DEPLRGDILSPIREAQTSGLKVMALSLVGADPEQLRRLAPGTDPIQNFFAVDNGPGLDR
FT                   AVSDLAVALCQAAVTIEPQTGPCAVHCPKGQKGEPGVTGLQGQAGPPGPPGLPGRTGAP
FT                   GPQGPPGSTQAKGERGFPGPEGPPGSPGLPGVPGSPGIKGSTGRPGPRGEQGERGPQGP
FT                   KGEPGEPGQITGGGGPGFPGKKGDPGPSGPPGSRGPVGDPGPRGPPGLPGISVKGDKGD
FT                   RGERGPPGPGIGASEQGDPGLPGLPGSPGPQGPAGRPGEKGEKGDCEDGGPGLPGQPGP
FT                   PGEPGLRGAPGMTGPKGDRGLTGTPGEPGVKGERGHPGPVGPQGLPGAAGHPGVEGPEG
FT                   PPGPTGRRGEKGEPGRPGDPAVGPGGAGAKGEKGEAGLPGPRGASGSKGEQGAPGLALP
FT                   GDPGPKGDPGDRGPIGLTGRAGPTGDSGPPGEKGEPGRPGSPGPVGPRGRDGEAGEKGD
FT                   EGIPGEPGLPGKAGERGLRGAPGPRGPVGEKGDQGDPGEDGRNGSPGSSGPKGDRGEPG
FT                   PPGPPGRLVDAGIESRDKGEPGQEGPRGPKGDPGPPGVSGERGIDGLRGPPGPQGDPGV
FT                   RGPAGDKGDRGPPGLDGRSGLDGKPGAPGPPGLHGASGKAGDPGRDGLPGLRGEHGPPG
FT                   PPGPPGVPGKAGDDGKPGLNGKNGDPGDPGEDGRKGEKGDSGAPGREGPDGPKGERGAP
FT                   GNPGLQGPPGLPGQVGPPGQGFPGVPGITGPKGDRGETGSKGEQGLPGERGLRGEPGSL
FT                   PNAERLLETAGIKVSALREIVDTWDESSGSFLPVPERRPGPKGDPGDRGPPGKEGLIGF
FT                   PGERGLKGERGDPGPQGPPGLALGERGPPGPPGLAGEPGKPGIPGLPGRAGGSGEAGRP
FT                   GERGERGEKGERGDQGRDGLPGLPGPPGPPGPKVAIEEPGPGLAREQGPPGLKGAKGEP
FT                   GSDGDPGPKGDRGVPGIKGDVGEPGKRGHDGNPGLPGERGVAGPEGKPGLQGPRGTPGP
FT                   VGSHGDPGPPGAPGLAGPAGPQGPSGLKGEPGETGPPGRGLPGPVGAVGLPGPPGPSGL
FT                   VGPQGSPGLPGQVGETGKPGPPGRDGSSGKDGDRGSPGVPGSPGLPGPVGPKGEPGPVG
FT                   APGQVVVGPPGAKGEKGAPGDLAGALLGEPGAKGDRGLPGPRGEKGEAGRAGGPGDPGE
FT                   DGQKGAPGLKGLKGEPGIGVQGPPGPSGPPGMKGDLGPPGAPGAPGVVGFPGQTGPRGE
FT                   TGQPGPVGERGLAGPPGREGAPGPLGPPGPPGSAGAPGASGLKGDKGDPGAGLPGPRGE
FT                   RGEPGVRGEDGHPGQEGPRGLVGPPGSRGEQGEKGAAGAAGLKGDKGDSAVIEGPPGPR
FT                   GAKGDMGERGPRGIDGDKGPRGESGNPGDKGSKGEPGDKGSAGSIGVRGLTGPKAKPGA
FT                   AGIPGEPGAPGKDGIPGFRGDKGDIGFMGPRGLKGEKGIKGTCGRDGERGDKGEAGFPG
FT                   RPGLAGKKGDMGEPGLPGQSGAPGKEGLIGPKGDRGFDGQSGPKGDQGEKGERGPPGVG
FT                   GFPGPRGNDGSSGPPGPPGGVGPKGPEGLQGQKGERGPPGESVVGAPGAPGTPGERGEQ
FT                   GRPGPAGPRGEKGEAALTEDDIRDFVRQEMSQHCACQGQFIASGSRPLPGYAADTAGSQ
FT                   LHHVPVLRVSHVEEEGQVPPEDDDDFSEYSVYSVEDYQEPEVPWDGEAEIKGWDQRGSD
FT                   LCSLPLDEGSCTAYTLRWYHRAVPGGTACHPFVYGGCGGNANRFGTREACERRCPPQGV
FT                   HSQKTGAA"
FT   gene            19707881..19708735
FT                   /locus_tag="mCG_134061"
FT                   /note="gene_id=mCG134061.0"
FT   mRNA            19707881..19708735
FT                   /locus_tag="mCG_134061"
FT                   /product="mCG134061"
FT                   /note="gene_id=mCG134061.0 transcript_id=mCT135439.0
FT                   created on 18-JUL-2002"
FT   CDS             19707882..19708220
FT                   /codon_start=1
FT                   /locus_tag="mCG_134061"
FT                   /product="mCG134061"
FT                   /note="gene_id=mCG134061.0 transcript_id=mCT135439.0
FT                   protein_id=mCP68613.0"
FT                   /protein_id="EDL21326.1"
FT                   /translation="MTRWALVVFVVLMLDRILFVPGTPIPTFQLLPQNSLETTPSSVTS
FT                   ESSSGTTTGPSASWSNSKASPYLDTRVILSLDVPIGLLRILLEQARYKAARNQAATNAQ
FT                   ILAHVGRR"
FT   gene            <19713609..19754692
FT                   /gene="Pfkfb4"
FT                   /locus_tag="mCG_16485"
FT                   /note="gene_id=mCG16485.3"
FT   mRNA            join(<19713609..19713819,19720614..19720682,
FT                   19720821..19720917,19727501..19727567,19729211..19729285,
FT                   19729619..19729675,19730276..19730397,19732376..19732583,
FT                   19733085..19733231,19747543..19747647,19750015..19750144,
FT                   19750240..19750302,19751389..19751453,19752824..19754692)
FT                   /gene="Pfkfb4"
FT                   /locus_tag="mCG_16485"
FT                   /product="6-phosphofructo-2-kinase/fructose-2,
FT                   6-biphosphatase 4, transcript variant mCT191508"
FT                   /note="gene_id=mCG16485.3 transcript_id=mCT191508.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(19713655..19713819,19720566..19720682,
FT                   19720821..19720917,19727501..19727567,19729211..19729285,
FT                   19729619..19729675,19730276..19730397,19732376..19732583,
FT                   19733085..19733231,19747543..19747647,19750015..19750144,
FT                   19750240..19750302,19751389..19751453,19752824..19754675)
FT                   /gene="Pfkfb4"
FT                   /locus_tag="mCG_16485"
FT                   /product="6-phosphofructo-2-kinase/fructose-2,
FT                   6-biphosphatase 4, transcript variant mCT18909"
FT                   /note="gene_id=mCG16485.3 transcript_id=mCT18909.2 created
FT                   on 18-JUL-2002"
FT   CDS             join(<19713693..19713819,19720614..19720682,
FT                   19720821..19720917,19727501..19727567,19729211..19729285,
FT                   19729619..19729675,19730276..19730397,19732376..19732583,
FT                   19733085..19733231,19747543..19747647,19750015..19750144,
FT                   19750240..19750302,19751389..19751453,19752824..19752883)
FT                   /codon_start=1
FT                   /gene="Pfkfb4"
FT                   /locus_tag="mCG_16485"
FT                   /product="6-phosphofructo-2-kinase/fructose-2,
FT                   6-biphosphatase 4, isoform CRA_b"
FT                   /note="gene_id=mCG16485.3 transcript_id=mCT191508.0
FT                   protein_id=mCP112481.0 isoform=CRA_b"
FT                   /protein_id="EDL21328.1"
FT                   /translation="QRSPIHPSPGMASPRELTQNPLKKIWMPYSNGRPALHASQRGARG
FT                   KTYISKKLTRYLNWIGVPTREFNVGQYRRDIVKTYKSFEFFLPDNEEGLKIRKQCALAA
FT                   LSDVRKFLSEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVVAANI
FT                   VQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVN
FT                   RVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFSKHLAQ
FT                   FISDQNIKDLKVWTSQMKRTIQTAEALSVPYEQWKVLNEIDAGVCEEMTYEEIQDHYPL
FT                   EFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDK
FT                   AAEELPYLKCPLHTVLKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPSEEALVT
FT                   VPAHQ"
FT   CDS             join(19713723..19713819,19720566..19720682,
FT                   19720821..19720917,19727501..19727567,19729211..19729285,
FT                   19729619..19729675,19730276..19730397,19732376..19732583,
FT                   19733085..19733231,19747543..19747647,19750015..19750144,
FT                   19750240..19750302,19751389..19751453,19752824..19752883)
FT                   /codon_start=1
FT                   /gene="Pfkfb4"
FT                   /locus_tag="mCG_16485"
FT                   /product="6-phosphofructo-2-kinase/fructose-2,
FT                   6-biphosphatase 4, isoform CRA_a"
FT                   /note="gene_id=mCG16485.3 transcript_id=mCT18909.2
FT                   protein_id=mCP23358.2 isoform=CRA_a"
FT                   /protein_id="EDL21327.1"
FT                   /translation="MASPRELTQNPLKKIWMPYSNGRPALHASQRGVCMTNCPTLIVMV
FT                   GLPARGKTYISKKLTRYLNWIGVPTREFNVGQYRRDIVKTYKSFEFFLPDNEEGLKIRK
FT                   QCALAALSDVRKFLSEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPE
FT                   VVAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVG
FT                   QSYVVNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREF
FT                   SKHLAQFISDQNIKDLKVWTSQMKRTIQTAEALSVPYEQWKVLNEIDAGVCEEMTYEEI
FT                   QDHYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLL
FT                   AYFLDKAAEELPYLKCPLHTVLKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPS
FT                   EEALVTVPAHQ"
FT   gene            19761087..19780286
FT                   /gene="Scotin"
FT                   /locus_tag="mCG_16092"
FT                   /note="gene_id=mCG16092.2"
FT   mRNA            join(19761087..19761260,19763366..19763522,
FT                   19773867..19773953,19778478..19778593,19778787..19779005,
FT                   19779150..19780286)
FT                   /gene="Scotin"
FT                   /locus_tag="mCG_16092"
FT                   /product="scotin gene, transcript variant mCT15615"
FT                   /note="gene_id=mCG16092.2 transcript_id=mCT15615.2 created
FT                   on 18-JUL-2002"
FT   mRNA            join(<19761102..19761260,19763366..19763522,
FT                   19773864..19773953,19778478..19778593,19778787..19779005,
FT                   19779150..19780218)
FT                   /gene="Scotin"
FT                   /locus_tag="mCG_16092"
FT                   /product="scotin gene, transcript variant mCT191529"
FT                   /note="gene_id=mCG16092.2 transcript_id=mCT191529.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<19761107..19761260,19763366..19763522,
FT                   19773864..19773953,19778478..19778593,19778787..19779005,
FT                   19779150..19779208)
FT                   /codon_start=1
FT                   /gene="Scotin"
FT                   /locus_tag="mCG_16092"
FT                   /product="scotin gene, isoform CRA_g"
FT                   /note="gene_id=mCG16092.2 transcript_id=mCT191529.0
FT                   protein_id=mCP112478.0 isoform=CRA_g"
FT                   /protein_id="EDL21337.1"
FT                   /translation="GRAGRGGCGGTVVLGLVRLFVRPLVCPAMAAPAPSLWTLLLLLLL
FT                   LPPPPGAHGELCRPFGEDNSIPVFCPDFCCGSCSNQYCCSDVLRKIQWNEEMCPEPESS
FT                   RFSTPAEETPEHLGSALKFRSSFDSDPMSGFGATVAIGVTIFVVFIATIIICFTCSCCC
FT                   LYKMCCPQRPVVTNTTTTTVVHAPYPQPQPQPVAPSYPGPTYQGYHPMPPQPGMPAAPY
FT                   PTQYPPPYLAQPTGPPPYHESLAGASQPPYNPTYMDSLKTIP"
FT   CDS             join(19761191..19761260,19763366..19763522,
FT                   19773867..19773953,19778478..19778593,19778787..19779005,
FT                   19779150..19779208)
FT                   /codon_start=1
FT                   /gene="Scotin"
FT                   /locus_tag="mCG_16092"
FT                   /product="scotin gene, isoform CRA_a"
FT                   /note="gene_id=mCG16092.2 transcript_id=mCT15615.2
FT                   protein_id=mCP23378.2 isoform=CRA_a"
FT                   /protein_id="EDL21329.1"
FT                   /translation="MAAPAPSLWTLLLLLLLLPPPPGAHGELCRPFGEDNSIPVFCPDF
FT                   CCGSCSNQYCCSDVLRKIQWNEEMCPEPESRFSTPAEETPEHLGSALKFRSSFDSDPMS
FT                   GFGATVAIGVTIFVVFIATIIICFTCSCCCLYKMCCPQRPVVTNTTTTTVVHAPYPQPQ
FT                   PQPVAPSYPGPTYQGYHPMPPQPGMPAAPYPTQYPPPYLAQPTGPPPYHESLAGASQPP
FT                   YNPTYMDSLKTIP"
FT   mRNA            join(19773592..19773635,19773864..19773953,
FT                   19778478..19778593,19778787..19779005,19779150..19780286)
FT                   /gene="Scotin"
FT                   /locus_tag="mCG_16092"
FT                   /product="scotin gene, transcript variant mCT170748"
FT                   /note="gene_id=mCG16092.2 transcript_id=mCT170748.0 created
FT                   on 18-JUL-2002"
FT   mRNA            join(19773655..19773728,19773867..19773953,
FT                   19778478..19778593,19778787..19779005,19779150..19780286)
FT                   /gene="Scotin"
FT                   /locus_tag="mCG_16092"
FT                   /product="scotin gene, transcript variant mCT170747"
FT                   /note="gene_id=mCG16092.2 transcript_id=mCT170747.0 created
FT                   on 18-JUL-2002"
FT   mRNA            join(19773698..19773754,19773867..19773953,
FT                   19778478..19778593,19778787..19779005,19779150..19780286)
FT                   /gene="Scotin"
FT                   /locus_tag="mCG_16092"
FT                   /product="scotin gene, transcript variant mCT170753"
FT                   /note="gene_id=mCG16092.2 transcript_id=mCT170753.0 created
FT                   on 18-JUL-2002"
FT   CDS             join(19773946..19773953,19778478..19778593,
FT                   19778787..19779005,19779150..19779208)
FT                   /codon_start=1
FT                   /gene="Scotin"
FT                   /locus_tag="mCG_1609