Dbfetch

ID   CH466558; SV 1; linear; genomic DNA; CON; MUS; 20632797 BP.
XX
AC   CH466558;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009822206 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-20632797
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-20632797
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; b5e487322062602b973037a00fc0ea94.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000219.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000125; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000142; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001027; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001313; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001493; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001494; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001901; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005043; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006574; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010358; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010841; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015869; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017119; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017132; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017311; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017316; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017466; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017716; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018012; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018362; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018363; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018372; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018411; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018412; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018486; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018634; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018677; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018727; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018858; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020599; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020617; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020681; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020687; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020689; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020708; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020712; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020713; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020717; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020719; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020720; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020722; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020732; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020734; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020752; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020766; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020777; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020780; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020792; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020793; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020804; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020812; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020823; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020923; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020926; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020929; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020941; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020945; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020946; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025127; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025134; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025137; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025140; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025144; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025145; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025150; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025156; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025161; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025162; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025163; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025165; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025170; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025371; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025372; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025375; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025377; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025380; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025386; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025572; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025576; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025577; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025580; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025582; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025583; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033880; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034227; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034255; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034341; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034706; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034936; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034993; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039253; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039337; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039364; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039450; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039670; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039691; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039850; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040373; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041695; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041797; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041920; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044034; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044787; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045532; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045775; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046215; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048217; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048277; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050965; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051497; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055805; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056962; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057322; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059923; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059995; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061111; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062825; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063316; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066878; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075410; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075420; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078627; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000085793; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097487; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001347; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001534; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003351; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006749; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010985; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017276; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017576; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017610; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018506; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018516; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018630; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020920; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020941; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021028; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021056; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021062; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021065; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021097; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021133; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021147; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021306; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021324; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026125; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026133; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026139; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026162; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026434; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026445; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026659; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026662; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026667; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026670; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034913; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036215; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039071; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039146; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039388; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040430; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042970; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043722; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044007; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044105; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044850; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055872; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057054; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057870; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059595; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066587; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068021; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068150; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069325; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069343; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070152; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070575; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070653; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070872; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071555; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074628; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077856; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079589; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080853; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081387; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081499; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082092; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086423; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092445; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092469; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092517; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092557; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093901; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093923; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093933; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097682; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100130; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100332; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103019; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103020; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103023; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103067; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103069; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103071; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103098; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103099; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103102; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106107; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106120; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106188; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106195; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106244; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106245; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106278; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106378; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106381; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106391; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106444; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106497; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106539; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106599; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106602; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106635; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106636; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106674; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106706; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106742; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106796; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106801; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106962; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106971; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106972; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106992; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107013; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107014; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107081; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107115; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107117; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107132; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107218; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107249; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107252; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117731; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120061; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120928; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127381; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129327; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131024; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132676; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132961; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133131; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133426; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000136523; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000137170; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000139934; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142229; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142495; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153476; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153983; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167787; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168459; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168579; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170381; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170556; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172809; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173870; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174302; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177131; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177304; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178798; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178839; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180023; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183610; mus_musculus.
DR   EuropePMC; PMC3226399; 21828285.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..20632797
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(3963..14668)
FT                   /gene="Aarsd1"
FT                   /locus_tag="mCG_141027"
FT                   /note="gene_id=mCG141027.0"
FT   mRNA            complement(join(3963..4311,5418..5512,6916..6970,
FT                   7377..7468,7617..7683,8024..8154,8346..8462,8557..8713,
FT                   9203..9260,11200..11359,14366..14497,14613..14668))
FT                   /gene="Aarsd1"
FT                   /locus_tag="mCG_141027"
FT                   /product="alanyl-tRNA synthetase domain containing 1"
FT                   /note="gene_id=mCG141027.0 transcript_id=mCT172767.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(4176..4311,5418..5512,6916..6970,
FT                   7377..7468,7617..7683,8024..8154,8346..8462,8557..8713,
FT                   9203..9260,11200..11359,14366..14497,14613..14651))
FT                   /codon_start=1
FT                   /gene="Aarsd1"
FT                   /locus_tag="mCG_141027"
FT                   /product="alanyl-tRNA synthetase domain containing 1"
FT                   /note="gene_id=mCG141027.0 transcript_id=mCT172767.0
FT                   protein_id=mCP95686.0"
FT                   /protein_id="EDL34038.1"
FT                   /translation="MAFLCQRDSYAREFTTTVVSCSPAELQTDASGGKKEVLSGFHVVL
FT                   EDTLLFPEGGGQPDDRGTINDISVLRVTRRGAQADHFTESPLSPGSQVQVRVDWERRFD
FT                   HMQQHSGQHLITAVADLLFGLKTTSWELGRLRSVIELDSPSVTAEQVAAIEQSVNQKIR
FT                   DRLPVSVRELSLDDPEVEQVRGRGLPDDHAGPIRVVTIEGVDSNMCCGTHVSNLSDLQV
FT                   IKILGTEKGKKNKSNLIFLAGNRVLKWMERSHGSEKALTSLLKCGVEDHVEAVKKLQNA
FT                   TKLLQKNNLNLLRDLAVHTAHSLRSSPAWGGVVTLHRKEGDSEFMNIIANEIGSEETLL
FT                   FLTVGDEKGAGLFLLAGPAEAVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRAEAQA
FT                   LLQDYVSTQSAEE"
FT   gene            complement(15746..22601)
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /note="gene_id=mCG141026.0"
FT   mRNA            complement(join(15746..16452,19133..19222,21048..21146,
FT                   21245..21311,21423..21536,21884..22601))
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /product="RIKEN cDNA 1700113I22, transcript variant
FT                   mCT172769"
FT                   /note="gene_id=mCG141026.0 transcript_id=mCT172769.0
FT                   created on 04-SEP-2002"
FT   mRNA            complement(join(15746..16452,16941..16994,19133..19222,
FT                   21048..21146,21245..21311,21423..21536,21884..22601))
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /product="RIKEN cDNA 1700113I22, transcript variant
FT                   mCT172768"
FT                   /note="gene_id=mCG141026.0 transcript_id=mCT172768.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(16435..16452,19133..19222,21048..21146,
FT                   21245..21311,21423..21536,21884..21891))
FT                   /codon_start=1
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /product="RIKEN cDNA 1700113I22, isoform CRA_b"
FT                   /note="gene_id=mCG141026.0 transcript_id=mCT172769.0
FT                   protein_id=mCP95688.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D9A7"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="MGI:MGI:1916146"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D9A7"
FT                   /protein_id="EDL34040.1"
FT                   /translation="MERQPARTLWYDRPKYVFMEFCVEDSTDVSVLIEDHRVVFSCRNG
FT                   DGVELYNEIEFYAKVNSKDSQDKRSGRSITCFVRKWKEKVAWPRLTKEDIKPVWLSVDF
FT                   DNWRDWEGDDEVELAQVEHYAEDDSDS"
FT   CDS             complement(join(16435..16452,16941..16994,19133..19222,
FT                   21048..21146,21245..21311,21423..21536,21884..21891))
FT                   /codon_start=1
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /product="RIKEN cDNA 1700113I22, isoform CRA_a"
FT                   /note="gene_id=mCG141026.0 transcript_id=mCT172768.0
FT                   protein_id=mCP95689.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="MGI:MGI:1916146"
FT                   /db_xref="UniProtKB/TrEMBL:A2A4P5"
FT                   /protein_id="EDL34039.1"
FT                   /translation="MERQPARTLWYDRPKYVFMEFCVEDSTDVSVLIEDHRVVFSCRNG
FT                   DGVELYNEIEFYAKVNSKDSQDKRSGRSITCFVRKWKEKVAWPRLTKEDIKPVWLSVDF
FT                   DNWRDWEGDDEVELAQVEHYAELLNKVSTKRPPPAMDDLDDDSDS"
FT   mRNA            complement(join(17512..18460,19133..19222,21048..21146,
FT                   21245..21311,21423..21536,21884..22601))
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /product="RIKEN cDNA 1700113I22, transcript variant
FT                   mCT172770"
FT                   /note="gene_id=mCG141026.0 transcript_id=mCT172770.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(18416..18460,19133..19222,21048..21146,
FT                   21245..21311,21423..21536,21884..21891))
FT                   /codon_start=1
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /product="RIKEN cDNA 1700113I22, isoform CRA_c"
FT                   /note="gene_id=mCG141026.0 transcript_id=mCT172770.0
FT                   protein_id=mCP95687.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9D9A7"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="MGI:MGI:1916146"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D9A7"
FT                   /protein_id="EDL34041.1"
FT                   /translation="MERQPARTLWYDRPKYVFMEFCVEDSTDVSVLIEDHRVVFSCRNG
FT                   DGVELYNEIEFYAKVNSKDSQDKRSGRSITCFVRKWKEKVAWPRLTKEDIKPVWLSVDF
FT                   DNWRDWEGDDEVELAQVEHYAEMHTSHSTHEEIRRL"
FT   gene            22351..32941
FT                   /gene="Rundc1"
FT                   /locus_tag="mCG_1040536"
FT                   /note="gene_id=mCG1040536.3"
FT   mRNA            join(22351..22878,26720..26878,28624..28822,29358..29474,
FT                   30728..32941)
FT                   /gene="Rundc1"
FT                   /locus_tag="mCG_1040536"
FT                   /product="RUN domain containing 1"
FT                   /note="gene_id=mCG1040536.3 transcript_id=mCT124202.2
FT                   created on 16-JUN-2003"
FT   CDS             join(22372..22878,26720..26878,28624..28822,29358..29474,
FT                   30728..31593)
FT                   /codon_start=1
FT                   /gene="Rundc1"
FT                   /locus_tag="mCG_1040536"
FT                   /product="RUN domain containing 1"
FT                   /note="gene_id=mCG1040536.3 transcript_id=mCT124202.2
FT                   protein_id=mCP75000.1"
FT                   /protein_id="EDL34042.1"
FT                   /translation="MATVEVATELGTVVTAVGPKAKDEEEEEEEEESLPPCETVRWAPV
FT                   GAVAEAGPGAATFSEAAAAEEPGAAPGSPSDATVRTLRRLEAERRQLDSALLALSSHFA
FT                   QVQFRLRQVVRGAPAEQQRLLRELEDFAFRGCPHVLGYEGLADPCGGDESDVLPGDRPR
FT                   VRGEDQSEQEERERLETQREKQKELILQLKTQLDDLETFAYQEGSYDSLPQSVVLERQR
FT                   VIIDELIKKLDMNLNEDISSLSTEELRQRVDAAVAQIVNPVRVKEQLVEQLKTQIRDLE
FT                   MFISFIQDEVGSPLQTGGHCECQASGKVGIGSTRVGGSTLPPGPGKAKAEDAKRARETG
FT                   LHLMRRALAVLQIFTVSQLGCATGQIPQTLWQRSQADRDYSHLLKRLEVSVDRVKQLAL
FT                   RHQPHDHVITSANLQDLSLGGKDELTTVVRKELTVAVRDLLAHGLYASSSGMSLVMAPL
FT                   ACLLPVFSSAPETMHPWELFVKYYHAKNGRAYVESPARKLSQSFALPIMGDTAVTPKQS
FT                   LLTAIHLVLTEHDPFKRSADSELKALVCMALNEQRLVSWVNLICKSGSLIEPHYQPWSY
FT                   MAHTGFESALNLLSRLSSLKFSLPVDLAVRQLKNIKDAF"
FT   assembly_gap    27431..27450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            39675..42790
FT                   /locus_tag="mCG_20222"
FT                   /note="gene_id=mCG20222.2"
FT   mRNA            join(39675..39730,39997..40079,40775..40944,42494..42604,
FT                   42713..42790)
FT                   /locus_tag="mCG_20222"
FT                   /product="mCG20222, transcript variant mCT19912"
FT                   /note="gene_id=mCG20222.2 transcript_id=mCT19912.2 created
FT                   on 15-JUL-2002"
FT   mRNA            join(39684..40079,40775..40944,42494..42604,42713..42783)
FT                   /locus_tag="mCG_20222"
FT                   /product="mCG20222, transcript variant mCT170713"
FT                   /note="gene_id=mCG20222.2 transcript_id=mCT170713.0 created
FT                   on 15-JUL-2002"
FT   mRNA            join(39997..40079,40775..40944,41229..41273,42494..42604,
FT                   42713..42790)
FT                   /locus_tag="mCG_20222"
FT                   /product="mCG20222, transcript variant mCT170714"
FT                   /note="gene_id=mCG20222.2 transcript_id=mCT170714.0 created
FT                   on 15-JUL-2002"
FT   CDS             join(39999..40079,40775..40944,41229..41273,42494..42604,
FT                   42713..42761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20222"
FT                   /product="mCG20222, isoform CRA_b"
FT                   /note="gene_id=mCG20222.2 transcript_id=mCT170714.0
FT                   protein_id=mCP93632.0 isoform=CRA_b"
FT                   /protein_id="EDL34045.1"
FT                   /translation="MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAG
FT                   IDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTSTRLSSHSESCVLGFRYSVDI
FT                   PLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKNKWFFQKLRF"
FT   CDS             join(39999..40079,40775..40944,42494..42604,42713..42761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20222"
FT                   /product="mCG20222, isoform CRA_a"
FT                   /note="gene_id=mCG20222.2 transcript_id=mCT170713.0
FT                   protein_id=mCP93631.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5BLJ9"
FT                   /db_xref="InterPro:IPR001141"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018262"
FT                   /db_xref="MGI:MGI:3646174"
FT                   /db_xref="MGI:MGI:98036"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BLJ9"
FT                   /protein_id="EDL34043.1"
FT                   /translation="MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAG
FT                   IDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDP
FT                   ALKRKARREAKVKFEERYKTGKNKWFFQKLRF"
FT   CDS             join(39999..40079,40775..40944,42494..42604,42713..42761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20222"
FT                   /product="mCG20222, isoform CRA_a"
FT                   /note="gene_id=mCG20222.2 transcript_id=mCT19912.2
FT                   protein_id=mCP23612.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q5BLJ9"
FT                   /db_xref="InterPro:IPR001141"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018262"
FT                   /db_xref="MGI:MGI:3646174"
FT                   /db_xref="MGI:MGI:98036"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BLJ9"
FT                   /protein_id="EDL34044.1"
FT                   /translation="MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAG
FT                   IDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDP
FT                   ALKRKARREAKVKFEERYKTGKNKWFFQKLRF"
FT   gene            45680..56762
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /note="gene_id=mCG141023.0"
FT   mRNA            join(45680..45895,53839..53937,54463..54610,54689..54795,
FT                   54893..55079,55164..55270,55474..56762)
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /product="interferon-induced protein 35, transcript variant
FT                   mCT161037"
FT                   /note="gene_id=mCG141023.0 transcript_id=mCT161037.2
FT                   created on 02-APR-2003"
FT   mRNA            join(45756..45895,53839..53942,54689..54795,54893..55079,
FT                   55164..55285)
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /product="interferon-induced protein 35, transcript variant
FT                   mCT181649"
FT                   /note="gene_id=mCG141023.0 transcript_id=mCT181649.0
FT                   created on 02-APR-2003"
FT   mRNA            join(45774..45895,53839..53937,54689..54795,54893..55079,
FT                   55164..55270,55474..55598)
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /product="interferon-induced protein 35, transcript variant
FT                   mCT181650"
FT                   /note="gene_id=mCG141023.0 transcript_id=mCT181650.0
FT                   created on 02-APR-2003"
FT   CDS             join(45875..45895,53839..53937,54463..54610,54689..54795,
FT                   54893..55079,55164..55270,55474..55665)
FT                   /codon_start=1
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /product="interferon-induced protein 35, isoform CRA_a"
FT                   /note="gene_id=mCG141023.0 transcript_id=mCT161037.2
FT                   protein_id=mCP90057.2 isoform=CRA_a"
FT                   /protein_id="EDL34046.1"
FT                   /translation="MSVTLQTVLYSLQEEQARLKMRLQELQQLKRERTGSPGAKIPFSV
FT                   PEVPLVFQGQTKQGRQVPKFVVSNLKVCCPLPEGSALVTFEDPKVVDRLLQQKEHRVNL
FT                   EDCRLRVQVQPLELPVVTNIQVSSQPDNHRVLVSGFPAGLRLSEEELLDKLEIFFGKAK
FT                   NGGGDVETREMLQGTVMLGFADEEVAQHLCQIGQFRVPLDRQQVLLRVSPYVSGEIQKA
FT                   EIKFQQAPHSVLVTNIPDVMDAQELHDILEIHFQKPTRGGGEVEALTVVPSGQQGLAIF
FT                   TSESS"
FT   CDS             join(45875..45895,53839..53937,54689..54733)
FT                   /codon_start=1
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /product="interferon-induced protein 35, isoform CRA_c"
FT                   /note="gene_id=mCG141023.0 transcript_id=mCT181650.0
FT                   protein_id=mCP104572.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR009938"
FT                   /db_xref="MGI:MGI:1917360"
FT                   /db_xref="UniProtKB/TrEMBL:D6RFB1"
FT                   /protein_id="EDL34048.1"
FT                   /translation="MSVTLQTVLYSLQEEQARLKMRLQELQQLKRERTGSPGAKWLIGC
FT                   YNKRNTELT"
FT   CDS             join(45875..45895,53839..53942,54689..54695)
FT                   /codon_start=1
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /product="interferon-induced protein 35, isoform CRA_b"
FT                   /note="gene_id=mCG141023.0 transcript_id=mCT181649.0
FT                   protein_id=mCP104571.0 isoform=CRA_b"
FT                   /protein_id="EDL34047.1"
FT                   /translation="MSVTLQTVLYSLQEEQARLKMRLQELQQLKRERTGSPGAKVSG"
FT   gene            complement(55743..63508)
FT                   /gene="Vat1"
FT                   /locus_tag="mCG_20223"
FT                   /note="gene_id=mCG20223.1"
FT   mRNA            complement(join(55743..57549,57650..57891,59489..59578,
FT                   59681..59851,60200..60407,62999..63508))
FT                   /gene="Vat1"
FT                   /locus_tag="mCG_20223"
FT                   /product="vesicle amine transport protein 1 homolog (T
FT                   californica)"
FT                   /note="gene_id=mCG20223.1 transcript_id=mCT19913.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(57466..57549,57650..57891,59489..59578,
FT                   59681..59851,60200..60407,62999..63424))
FT                   /codon_start=1
FT                   /gene="Vat1"
FT                   /locus_tag="mCG_20223"
FT                   /product="vesicle amine transport protein 1 homolog (T
FT                   californica)"
FT                   /note="gene_id=mCG20223.1 transcript_id=mCT19913.2
FT                   protein_id=mCP23560.2"
FT                   /db_xref="GOA:Q499X4"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="MGI:MGI:1349450"
FT                   /db_xref="UniProtKB/TrEMBL:Q499X4"
FT                   /protein_id="EDL34049.1"
FT                   /translation="MSAEREAAEAATVAAATEAGAETGTGAGEGAPSQPPTVEVASDPQ
FT                   PPPAPEASASASAPPLRCLVLTGFGGYDKVKLQSRPAVPPAPGPGQLTLRVRACGLNFA
FT                   DLMGRQGLYDRLPPLPVTPGMEGAGVVVAVGEGVGDRKAGDRVMVLNRSGMWQEEVTVP
FT                   SAQTFLMPEAMTFEEAAALLVNYITAYMVLFDFGNLRPGHSVLVHMAAGGVGMAALQLC
FT                   RTVENVTVFGTASASKHEVLKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSD
FT                   TAKGYHLLKPMGKVVTYGMANLLTGPKRNLMAMARTWWNQFSVTALQLLQANRAVCGFH
FT                   LGYLDGEVELVNSVVTRLVALYNQGHIKPRIDSVWPFEKVADAMKQMQEKKNIGKVLLV
FT                   PGPEKET"
FT   gene            <62330..68920
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /note="gene_id=mCG20232.2"
FT   mRNA            join(<62330..62435,62922..63224,66224..66311,67081..67190,
FT                   67786..67920,68126..68915)
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /product="Rho family GTPase 2, transcript variant
FT                   mCT170716"
FT                   /note="gene_id=mCG20232.2 transcript_id=mCT170716.0 created
FT                   on 15-JUL-2002"
FT   mRNA            join(<62775..63224,66224..66311,67081..67190,67786..67920,
FT                   68126..68915)
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /product="Rho family GTPase 2, transcript variant
FT                   mCT170715"
FT                   /note="gene_id=mCG20232.2 transcript_id=mCT170715.0 created
FT                   on 15-JUL-2002"
FT   CDS             join(<63213..63224,66224..66311,67081..67190,67786..67920,
FT                   68126..68374)
FT                   /codon_start=1
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /product="Rho family GTPase 2, isoform CRA_a"
FT                   /note="gene_id=mCG20232.2 transcript_id=mCT170715.0
FT                   protein_id=mCP93633.0 isoform=CRA_a"
FT                   /protein_id="EDL34050.1"
FT                   /translation="PPKPSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDNVRPLA
FT                   YPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELS
FT                   KQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTD
FT                   SRRGLQRSTQLSGRPDRGNEGEMHKDRAKSCNLM"
FT   CDS             join(<63213..63224,66224..66311,67081..67190,67786..67920,
FT                   68126..68374)
FT                   /codon_start=1
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /product="Rho family GTPase 2, isoform CRA_a"
FT                   /note="gene_id=mCG20232.2 transcript_id=mCT170716.0
FT                   protein_id=mCP93634.0 isoform=CRA_a"
FT                   /protein_id="EDL34051.1"
FT                   /translation="PPKPSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDNVRPLA
FT                   YPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELS
FT                   KQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTD
FT                   SRRGLQRSTQLSGRPDRGNEGEMHKDRAKSCNLM"
FT   mRNA            join(65508..65730,66224..66311,67081..67190,67786..67920,
FT                   68126..68920)
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /product="Rho family GTPase 2, transcript variant mCT19974"
FT                   /note="gene_id=mCG20232.2 transcript_id=mCT19974.2 created
FT                   on 15-JUL-2002"
FT   CDS             join(65629..65730,66224..66311,67081..67190,67786..67920,
FT                   68126..68374)
FT                   /codon_start=1
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /product="Rho family GTPase 2, isoform CRA_b"
FT                   /note="gene_id=mCG20232.2 transcript_id=mCT19974.2
FT                   protein_id=mCP23511.2 isoform=CRA_b"
FT                   /db_xref="GOA:A2A4Q3"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1338755"
FT                   /db_xref="UniProtKB/TrEMBL:A2A4Q3"
FT                   /protein_id="EDL34052.1"
FT                   /translation="MEGQSGRCKIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYT
FT                   ASFEIDKRRIELNMWDTSGSSYYDNVRPLAYPDSDAVLICFDISRPETLDSVLKKWQGE
FT                   TQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSS
FT                   RSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGLQRSTQLSGRPDRGNEGEMHKDRAK
FT                   SCNLM"
FT   gene            complement(85828..149012)
FT                   /gene="Brca1"
FT                   /locus_tag="mCG_20241"
FT                   /note="gene_id=mCG20241.2"
FT   mRNA            complement(join(85828..86976,88923..88983,89245..89318,
FT                   90616..90670,94998..95078,99056..99096,99545..99622,
FT                   102381..102468,105014..105294,106985..107163,
FT                   109772..109901,114323..114494,119485..119555,
FT                   120378..123692,125054..125130,126844..126889,
FT                   128045..128147,129073..129212,130992..131080,
FT                   132581..132658,137034..137087,146070..146168,
FT                   148824..149012))
FT                   /gene="Brca1"
FT                   /locus_tag="mCG_20241"
FT                   /product="breast cancer 1"
FT                   /note="gene_id=mCG20241.2 transcript_id=mCT19983.3 created
FT                   on 02-JUL-2003"
FT   CDS             complement(join(86831..86976,88923..88983,89245..89318,
FT                   90616..90670,94998..95078,99056..99096,99545..99622,
FT                   102381..102468,105014..105294,106985..107163,
FT                   109772..109901,114323..114494,119485..119555,
FT                   120378..123692,125054..125130,126844..126889,
FT                   128045..128147,129073..129212,130992..131080,
FT                   132581..132658,137034..137087,146070..146149))
FT                   /codon_start=1
FT                   /gene="Brca1"
FT                   /locus_tag="mCG_20241"
FT                   /product="breast cancer 1"
FT                   /note="gene_id=mCG20241.2 transcript_id=mCT19983.3
FT                   protein_id=mCP23423.2"
FT                   /protein_id="EDL34053.1"
FT                   /translation="MDLSAVQIQEVQNVLHAMQKILECPICLELIKEPVSTKCDHIFCK
FT                   FCMLKLLNQKKGPSQCPLCKNEITKRSLQGSTRFSQLAEELLRIMAAFELDTGMQLTNG
FT                   FSFSKKRNNSCERLNEEASIIQSVGYRNRVRRLPQVEPGNATLKDSLGVQLSNLGIVRS
FT                   VKKNRQTQPRKKSVYIELDSDSSEETVTKPGDCSVRDQELLQTAPQEAGDEGKLHSAEE
FT                   AACEFSEGIRNIEHHQCSDDLNPTENHATERHPEKCQSISISNVCVEPCGTDAHASSLQ
FT                   PETSSLLLIEDRMNAEKAEFCNKSKQPGIAVSQQSRWAASKGTCNDRQVPSTGEKVGPN
FT                   ADSLSDREKWTHPQSLCPENSGATTDVPWITLNSSVQKVNEWFSRTGEMLTSDSASARR
FT                   HESNAEAAVVLEVSNEVDGGFSSSRKTDLVTPDPHHTLMCKSGRDFSKPVEDNISDKIF
FT                   GKSYQRKGSRPHLNHVTEIIGTFITEPQITQEQPFTNKLKRKRSTSLQPEDFIKKADSA
FT                   GVQRTPDNINQGTDLMEPNEQAVSTTSNCQENKIAGSNLQKEKSAHPTESLRKEPASTA
FT                   GAKSISNSVSDLEVELNVHSSKAPKKNRLRRKSSIRCALPLEPISRNPSPPTCAELQID
FT                   SCGSSEETKKNHSNQQPAGHLREPQLIEDTEPAADAKKNEPNEHIRKRRASDAFPEEKL
FT                   MNKAGLLTSCSSPRKSQGPVNPSPQRTGTEQLETRQMSDSAKELGDRVLGGEPSGKTTD
FT                   RSEESTSVSLVSDTDYDTQNSVSVLDAHTVRYARTGSAQCMTQFVASENPKELVHGSNN
FT                   AGSGTEGLKPPLRHALNLSQEKVEMEDSELDTQYLQNTFQVSKRQSFALFSKPRSPQKD
FT                   CAHSVPSKELSPKVTAKGKQKERQGQEEFEISHVQAVAATVGLPVPCQEGKLAADTMCD
FT                   RGSRLCPSSHYRSGENGLSATGKSGISQNSHFKQSVSPIRSSIKTDNRKPLTEGRFERH
FT                   TSSTEMAVGNENILQSTVHTVSLNNRGNACQEAGSGSIHEVCSTGDSFPGQLGRNRGPK
FT                   VNTVPPLDSMQPGVCQQSVPVSDKYLEIKKQEGEAVCADFSPCLFSDHLEQSMSGKVFQ
FT                   VCSETPDDLLDDVEIQGHTSFGEGDIMERSAVFNGSILRRESSRSPSPVTHASKSQSLH
FT                   RASRKLESSEESDSTEDEDLPCFQHLLSRISNTPELTRCSSAVTQRMPEKAEGTQAPWK
FT                   GSSSDCNNEVIMIEASQEHQFSEDPRCSGSMFSSQHSAAQGSTANANSQDSNFIPPSKQ
FT                   RSHQCGNEEAFLSDKELISDNEEMATCLEEDNDQEEDSIIPDSEASGYESETNLSEDCS
FT                   QSDILTTQQRATMKYNLIKLQQEMAHLEAVLEQRGNQPSGHSPSLLADPCALEDLPDLE
FT                   PNMSGAAILTSKNINENPVSQNLKSACDDKFQLQHLEGPTSGDDESGMGRPSPFKSPLA
FT                   GSRGSAHGCSRHLQKRNSPSQEELLQPAGSEASSEPHNSTGQSCLPRRELEGTPYLGSG
FT                   ISLFSSRDPESESPKEPAHIGTTPASTSALKIPQGQVAFRSAAAAGADKAVVGIVSKIK
FT                   PELTSSEERADRDISMVVSGLTPKEVMTVQKFAEKYRLTLTDAITEETTHVIIKTDAEF
FT                   VCERTLKYFLGIAGGKWIVSYSWVVRSIQERRLLNVHEFEVKGDVVTGRNHQGPRRSRE
FT                   SREKLFKGLQVYCCEPFTNMPKDELERMLQLCGASVVKELPSLTHDTGAHLVVIVQPSA
FT                   WTEDSNCPDIGQLCKARLVMWDWVLDSLSSYRCRDLDAYLVQNITCDSSEPQDSND"
FT   gene            <149209..179008
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /note="gene_id=mCG20206.3"
FT   mRNA            join(<149209..149639,151042..151152,152864..152929,
FT                   153229..153345,156573..156635,157487..157505,
FT                   159351..159373,161683..161880,162758..162835,
FT                   163250..163464,164149..164316,165454..165663,
FT                   166311..166470,166553..166843,168339..168488,
FT                   168957..169032,169517..169627,169863..170027,
FT                   170158..170232,172054..172471,173358..173464,
FT                   174249..174306,174987..175092,177640..177849)
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, transcript variant
FT                   mCT193189"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193189.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(149794..150009,151042..151152,152864..152929,
FT                   153229..153345,156573..156635,157487..157505,
FT                   159351..159373,161683..161880,162758..162835,
FT                   163250..163464,164149..164316,165454..165663,
FT                   166311..166470,166553..166843,168339..168488,
FT                   168957..169032,169517..169627,169863..170027,
FT                   170158..170232,172054..172471,173358..173464,
FT                   174249..174306,174987..175092,177640..179000)
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, transcript variant
FT                   mCT19895"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT19895.2 created
FT                   on 15-JUL-2002"
FT   mRNA            join(<149916..150009,151042..151152,152864..152929,
FT                   153229..153345,156573..156635,157487..157505,
FT                   159351..159373,161683..161880,162758..162835,
FT                   163250..163464,164149..164316,165454..165663,
FT                   166311..166470,166553..166843,168339..168488,
FT                   168957..169032,169863..170027,170158..170232,
FT                   172054..172471,173358..173464,174249..174306,
FT                   174987..175092,177640..178999)
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, transcript variant
FT                   mCT193190"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193190.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<149918..150009,151042..151152,152864..152929,
FT                   153229..153345,156573..156635,157487..157505,
FT                   159351..159373,161683..161880,162758..162835,
FT                   163250..163464,164149..164316,165454..165663,
FT                   166311..166470,166553..166843,168339..168488,
FT                   168957..169032,169517..169627,169863..170027,
FT                   170158..170232,172054..172471,173358..173464,
FT                   174987..175092,177640..178999)
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, transcript variant
FT                   mCT193192"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193192.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<149938..150009,151042..151152,152864..152929,
FT                   153229..153345,156573..156635,157487..157505,
FT                   159351..159373,161683..161880,162758..162835,
FT                   163250..163464,164149..164316,165454..165663,
FT                   166311..166470,166553..166843,168339..168488,
FT                   168957..169032,169517..169627,169863..170027,
FT                   170158..170232,172054..172471,173358..173464,
FT                   174249..174306,177640..179008)
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, transcript variant
FT                   mCT193191"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193191.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<152918..152929,153229..153345,156573..156635,
FT                   157487..157505,159351..159373,161683..161880,
FT                   162758..162835,163250..163464,164149..164316,
FT                   165454..165663,166311..166470,166553..166843,
FT                   168339..168488,168957..169032,169517..169627,
FT                   169863..170027,170158..170232,172054..172471,
FT                   173358..173464,174249..174306,174987..175092,
FT                   177640..177813)
FT                   /codon_start=1
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, isoform CRA_a"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193189.0
FT                   protein_id=mCP114160.0 isoform=CRA_a"
FT                   /protein_id="EDL34054.1"
FT                   /translation="LGLQLQPDSMEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVK
FT                   VSFDLNTIQIKYLDEENEEISINSQGEYEEALKMANIKQGNQLQMQVHEGYHVVDEALP
FT                   KNVVENQAAARTGKKPLAHYSSLVRVLGSDMKTTEEPAPEQCSSAPCDTDQPQDKPPDW
FT                   FTSYLEMFREQVVKETVEKLEQRLQEKLVLQKPLLSSSPTEVSMPISEETLFLPENQFS
FT                   WHIACSHCQKRIVGVRYQCSLCPSYNICEDCEAGPYTHDTNHVLLKLRRPVVISSEPFF
FT                   YSKYSAPRLPAALEQVRLQKQVDKNFVKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIH
FT                   LWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCAPVMPTLSAAFVDENLPDGTHLQPG
FT                   TKFIKHWRMKNTGNVKWNTDTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIA
FT                   PTLEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSSESPDNVEGDRISSSKADDFSCEQ
FT                   EEAFLLAEEEIPLGEVTKQTEGTGASASQKTRRAASERELYIPSVDLLTAQDLLSFELL
FT                   DINIVQELERVPHNTPVDMTPCMSPLPHDSPLIEKPGLGQIQEESEGAGFKAPPDSTVS
FT                   AKRKAETPASVEETEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQRSPQRELQLYSTE
FT                   GQQPLVLPGFCRKDSSLKFALPEEGPRGDEREEIVHIVEEEVVEEEEEVQDEEVQSQSS
FT                   ASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGEPGIESGLEPTEARERLPE
FT                   RESQPQEQSISDILTTSQPLDTVPLVPEVAGLPAALSRSAPCGQCESSGVDSPGVDSPA
FT                   TMHEVPPAPDDIRGEPRGSTGLANSRQRSCDHSRHHNGSSIAGGLVKGALSVAASAYKA
FT                   LFSGPPVTAQPIVSEDQTTALMAHLFEMGFCDRQLNLRLLRKHNYNILQVVTELLQVNN
FT                   NDWYSHRY"
FT   CDS             join(<152918..152929,153229..153345,156573..156635,
FT                   157487..157505,159351..159373,161683..161880,
FT                   162758..162835,163250..163464,164149..164316,
FT                   165454..165663,166311..166470,166553..166843,
FT                   168339..168488,168957..169032,169863..170027,
FT                   170158..170232,172054..172471,173358..173464,
FT                   174249..174306,174987..175092,177640..177813)
FT                   /codon_start=1
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, isoform CRA_b"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193190.0
FT                   protein_id=mCP114161.0 isoform=CRA_b"
FT                   /protein_id="EDL34055.1"
FT                   /translation="LGLQLQPDSMEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVK
FT                   VSFDLNTIQIKYLDEENEEISINSQGEYEEALKMANIKQGNQLQMQVHEGYHVVDEALP
FT                   KNVVENQAAARTGKKPLAHYSSLVRVLGSDMKTTEEPAPEQCSSAPCDTDQPQDKPPDW
FT                   FTSYLEMFREQVVKETVEKLEQRLQEKLVLQKPLLSSSPTEVSMPISEETLFLPENQFS
FT                   WHIACSHCQKRIVGVRYQCSLCPSYNICEDCEAGPYTHDTNHVLLKLRRPVVISSEPFF
FT                   YSKYSAPRLPAALEQVRLQKQVDKNFVKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIH
FT                   LWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCAPVMPTLSAAFVDENLPDGTHLQPG
FT                   TKFIKHWRMKNTGNVKWNTDTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIA
FT                   PTLEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSSESPDNVEGDRISSSKADDFSCEQ
FT                   EEAFLLAEEEIPLGEVTKQTEGTGASASQKTRRAASERELYIPSVDLLTAQDLLSFELL
FT                   DINIVQELERVPHNTPVDSTVSAKRKAETPASVEETEEDLSGTQFVCETVIRSLTLDAA
FT                   PDHNPPCRQRSPQRELQLYSTEGQQPLVLPGFCRKDSSLKFALPEEGPRGDEREEIVHI
FT                   VEEEVVEEEEEVQDEEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERG
FT                   AEGEPGIESGLEPTEARERLPERESQPQEQSISDILTTSQPLDTVPLVPEVAGLPAALS
FT                   RSAPCGQCESSGVDSPGVDSPATMHEVPPAPDDIRGEPRGSTGLANSRQRSCDHSRHHN
FT                   GSSIAGGLVKGALSVAASAYKALFSGPPVTAQPIVSEDQTTALMAHLFEMGFCDRQLNL
FT                   RLLRKHNYNILQVVTELLQVNNNDWYSHRY"
FT   CDS             join(<152918..152929,153229..153345,156573..156635,
FT                   157487..157505,159351..159373,161683..161880,
FT                   162758..162835,163250..163464,164149..164316,
FT                   165454..165663,166311..166470,166553..166843,
FT                   168339..168488,168957..169032,169517..169627,
FT                   169863..170027,170158..170232,172054..172471,
FT                   173358..173464,174249..174306,177640..177673)
FT                   /codon_start=1
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, isoform CRA_c"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193191.0
FT                   protein_id=mCP114162.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q6ZQK3"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR032350"
FT                   /db_xref="MGI:MGI:108498"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZQK3"
FT                   /protein_id="EDL34056.1"
FT                   /translation="LGLQLQPDSMEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVK
FT                   VSFDLNTIQIKYLDEENEEISINSQGEYEEALKMANIKQGNQLQMQVHEGYHVVDEALP
FT                   KNVVENQAAARTGKKPLAHYSSLVRVLGSDMKTTEEPAPEQCSSAPCDTDQPQDKPPDW
FT                   FTSYLEMFREQVVKETVEKLEQRLQEKLVLQKPLLSSSPTEVSMPISEETLFLPENQFS
FT                   WHIACSHCQKRIVGVRYQCSLCPSYNICEDCEAGPYTHDTNHVLLKLRRPVVISSEPFF
FT                   YSKYSAPRLPAALEQVRLQKQVDKNFVKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIH
FT                   LWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCAPVMPTLSAAFVDENLPDGTHLQPG
FT                   TKFIKHWRMKNTGNVKWNTDTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIA
FT                   PTLEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSSESPDNVEGDRISSSKADDFSCEQ
FT                   EEAFLLAEEEIPLGEVTKQTEGTGASASQKTRRAASERELYIPSVDLLTAQDLLSFELL
FT                   DINIVQELERVPHNTPVDMTPCMSPLPHDSPLIEKPGLGQIQEESEGAGFKAPPDSTVS
FT                   AKRKAETPASVEETEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQRSPQRELQLYSTE
FT                   GQQPLVLPGFCRKDSSLKFALPEEGPRGDEREEIVHIVEEEVVEEEEEVQDEEVQSQSS
FT                   ASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGEPGIESGLEPTEARERLPE
FT                   RESQPQEQSISDILTTSQPLDTVPLVPEVAGLPAALSRSAPCGQCESSGVDSPGVDSPA
FT                   TMHEVPPAPDDIRGEPRGSTGLANSRQRSCDHSSPSFLKIRPQP"
FT   CDS             join(<152918..152929,153229..153345,156573..156635,
FT                   157487..157505,159351..159373,161683..161880,
FT                   162758..162835,163250..163464,164149..164316,
FT                   165454..165663,166311..166470,166553..166843,
FT                   168339..168488,168957..169032,169517..169627,
FT                   169863..170027,170158..170232,172054..172471,
FT                   173358..173464,174987..175024)
FT                   /codon_start=1
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, isoform CRA_d"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193192.0
FT                   protein_id=mCP114163.0 isoform=CRA_d"
FT                   /protein_id="EDL34057.1"
FT                   /translation="LGLQLQPDSMEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVK
FT                   VSFDLNTIQIKYLDEENEEISINSQGEYEEALKMANIKQGNQLQMQVHEGYHVVDEALP
FT                   KNVVENQAAARTGKKPLAHYSSLVRVLGSDMKTTEEPAPEQCSSAPCDTDQPQDKPPDW
FT                   FTSYLEMFREQVVKETVEKLEQRLQEKLVLQKPLLSSSPTEVSMPISEETLFLPENQFS
FT                   WHIACSHCQKRIVGVRYQCSLCPSYNICEDCEAGPYTHDTNHVLLKLRRPVVISSEPFF
FT                   YSKYSAPRLPAALEQVRLQKQVDKNFVKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIH
FT                   LWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCAPVMPTLSAAFVDENLPDGTHLQPG
FT                   TKFIKHWRMKNTGNVKWNTDTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIA
FT                   PTLEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSSESPDNVEGDRISSSKADDFSCEQ
FT                   EEAFLLAEEEIPLGEVTKQTEGTGASASQKTRRAASERELYIPSVDLLTAQDLLSFELL
FT                   DINIVQELERVPHNTPVDMTPCMSPLPHDSPLIEKPGLGQIQEESEGAGFKAPPDSTVS
FT                   AKRKAETPASVEETEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQRSPQRELQLYSTE
FT                   GQQPLVLPGFCRKDSSLKFALPEEGPRGDEREEIVHIVEEEVVEEEEEVQDEEVQSQSS
FT                   ASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGEPGIESGLEPTEARERLPE
FT                   RESQPQEQSISDILTTSQPLDTVPLVPEVAGLPAALSRSAPCGQCESSGVDSPGVDSPA
FT                   TMHEVPPAPDDIRGGTTMGAALLEDW"
FT   CDS             join(153244..153345,156573..156635,157487..157505,
FT                   159351..159373,161683..161880,162758..162835,
FT                   163250..163464,164149..164316,165454..165663,
FT                   166311..166470,166553..166843,168339..168488,
FT                   168957..169032,169517..169627,169863..170027,
FT                   170158..170232,172054..172471,173358..173464,
FT                   174249..174306,174987..175092,177640..177813)
FT                   /codon_start=1
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, isoform CRA_e"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT19895.2
FT                   protein_id=mCP23593.2 isoform=CRA_e"
FT                   /db_xref="GOA:A1L329"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR032350"
FT                   /db_xref="MGI:MGI:108498"
FT                   /db_xref="UniProtKB/TrEMBL:A1L329"
FT                   /protein_id="EDL34058.1"
FT                   /translation="MEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVKVSFDLNTIQ
FT                   IKYLDEENEEISINSQGEYEEALKMANIKQGNQLQMQVHEGYHVVDEALPKNVVENQAA
FT                   ARTGKKPLAHYSSLVRVLGSDMKTTEEPAPEQCSSAPCDTDQPQDKPPDWFTSYLEMFR
FT                   EQVVKETVEKLEQRLQEKLVLQKPLLSSSPTEVSMPISEETLFLPENQFSWHIACSHCQ
FT                   KRIVGVRYQCSLCPSYNICEDCEAGPYTHDTNHVLLKLRRPVVISSEPFFYSKYSAPRL
FT                   PAALEQVRLQKQVDKNFVKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQ
FT                   SPKSPLGRPESLLQSNTLMLPLQPCAPVMPTLSAAFVDENLPDGTHLQPGTKFIKHWRM
FT                   KNTGNVKWNTDTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIAPTLEGTYTS
FT                   HWRLSHKGQQFGPRVWCSIIVDPFPSSESPDNVEGDRISSSKADDFSCEQEEAFLLAEE
FT                   EIPLGEVTKQTEGTGASASQKTRRAASERELYIPSVDLLTAQDLLSFELLDINIVQELE
FT                   RVPHNTPVDMTPCMSPLPHDSPLIEKPGLGQIQEESEGAGFKAPPDSTVSAKRKAETPA
FT                   SVEETEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQRSPQRELQLYSTEGQQPLVLPG
FT                   FCRKDSSLKFALPEEGPRGDEREEIVHIVEEEVVEEEEEVQDEEVQSQSSASSEDYIII
FT                   LPECFDTSRPLGDSMYSSALSQPGLERGAEGEPGIESGLEPTEARERLPERESQPQEQS
FT                   ISDILTTSQPLDTVPLVPEVAGLPAALSRSAPCGQCESSGVDSPGVDSPATMHEVPPAP
FT                   DDIRGEPRGSTGLANSRQRSCDHSRHHNGSSIAGGLVKGALSVAASAYKALFSGPPVTA
FT                   QPIVSEDQTTALMAHLFEMGFCDRQLNLRLLRKHNYNILQVVTELLQVNNNDWYSHRY"
FT   gene            179296..188839
FT                   /gene="Tmem106a"
FT                   /locus_tag="mCG_20225"
FT                   /note="gene_id=mCG20225.2"
FT   mRNA            join(179296..179380,179680..179759,180613..180839,
FT                   181501..181564,183294..183447,185906..186046,
FT                   186151..186194,186988..187041,187386..188838)
FT                   /gene="Tmem106a"
FT                   /locus_tag="mCG_20225"
FT                   /product="transmembrane protein 106A, transcript variant
FT                   mCT19967"
FT                   /note="gene_id=mCG20225.2 transcript_id=mCT19967.2 created
FT                   on 05-SEP-2002"
FT   mRNA            join(179360..179759,180613..180839,181501..181564,
FT                   183294..183447,185906..186046,186151..186194,
FT                   186988..187041,187386..188839)
FT                   /gene="Tmem106a"
FT                   /locus_tag="mCG_20225"
FT                   /product="transmembrane protein 106A, transcript variant
FT                   mCT172766"
FT                   /note="gene_id=mCG20225.2 transcript_id=mCT172766.0 created
FT                   on 05-SEP-2002"
FT   CDS             join(180632..180839,181501..181564,183294..183447,
FT                   185906..186046,186151..186194,186988..187041,
FT                   187386..187506)
FT                   /codon_start=1
FT                   /gene="Tmem106a"
FT                   /locus_tag="mCG_20225"
FT                   /product="transmembrane protein 106A, isoform CRA_a"
FT                   /note="gene_id=mCG20225.2 transcript_id=mCT172766.0
FT                   protein_id=mCP95685.0 isoform=CRA_a"
FT                   /protein_id="EDL34059.1"
FT                   /translation="MGKAVSQLTSRKDEDKPILPDNPAMASQAANYFSTGSSKPAHSCM
FT                   PYEKAASSSFVTCPTCQGNGEIPQEQEKQLVALIPYGDQRLKPRRTKLFVFLSVAICLL
FT                   IFSLTIFFLYPRPIAVRPVGLNSSTVTFEDAHVQLNTTNVLNIFNSNFYPITVTQLTAE
FT                   VLHQASVVGQVTSSLRLHIGPLASEQMPYEVASRILDENTYKICTWPKIRVHHILLNIQ
FT                   GSLTCSFLSHPQQLPFESFEYVDCRENMSLPHLELPRPA"
FT   CDS             join(180632..180839,181501..181564,183294..183447,
FT                   185906..186046,186151..186194,186988..187041,
FT                   187386..187506)
FT                   /codon_start=1
FT                   /gene="Tmem106a"
FT                   /locus_tag="mCG_20225"
FT                   /product="transmembrane protein 106A, isoform CRA_a"
FT                   /note="gene_id=mCG20225.2 transcript_id=mCT19967.2
FT                   protein_id=mCP23599.1 isoform=CRA_a"
FT                   /protein_id="EDL34060.1"
FT                   /translation="MGKAVSQLTSRKDEDKPILPDNPAMASQAANYFSTGSSKPAHSCM
FT                   PYEKAASSSFVTCPTCQGNGEIPQEQEKQLVALIPYGDQRLKPRRTKLFVFLSVAICLL
FT                   IFSLTIFFLYPRPIAVRPVGLNSSTVTFEDAHVQLNTTNVLNIFNSNFYPITVTQLTAE
FT                   VLHQASVVGQVTSSLRLHIGPLASEQMPYEVASRILDENTYKICTWPKIRVHHILLNIQ
FT                   GSLTCSFLSHPQQLPFESFEYVDCRENMSLPHLELPRPA"
FT   assembly_gap    204230..207400
FT                   /estimated_length=3171
FT                   /gap_type="unknown"
FT   assembly_gap    208437..215262
FT                   /estimated_length=6826
FT                   /gap_type="unknown"
FT   assembly_gap    219094..219113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <220864..226307
FT                   /locus_tag="mCG_146305"
FT                   /note="gene_id=mCG146305.0"
FT   mRNA            join(<220864..221073,221256..221341,226149..226307)
FT                   /locus_tag="mCG_146305"
FT                   /product="mCG146305"
FT                   /note="gene_id=mCG146305.0 transcript_id=mCT186408.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<220926..221073,221256..221341,226149..226265)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146305"
FT                   /product="mCG146305"
FT                   /note="gene_id=mCG146305.0 transcript_id=mCT186408.0
FT                   protein_id=mCP107585.0"
FT                   /protein_id="EDL34061.1"
FT                   /translation="VESPGHYQMFQCQNQIKICKGNRDQIRCAYTSDCIQKHRPEQYAW
FT                   CGVEGGARFDSNSSSRGSTTHFSTQSTNMNIYEETQLLELKAQRLFKSVQCCALRKSLP
FT                   QQKLATYTPWQI"
FT   assembly_gap    235967..235986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            239440..247587
FT                   /gene="Rdm1"
FT                   /locus_tag="mCG_20208"
FT                   /note="gene_id=mCG20208.1"
FT   mRNA            join(239440..239571,239780..239959,241732..241854,
FT                   242307..242466,245289..245387,246276..246361,
FT                   247236..247587)
FT                   /gene="Rdm1"
FT                   /locus_tag="mCG_20208"
FT                   /product="RAD52 motif 1, transcript variant mCT19898"
FT                   /note="gene_id=mCG20208.1 transcript_id=mCT19898.2 created
FT                   on 02-APR-2003"
FT   mRNA            join(239443..239571,239780..239931,242366..242466,
FT                   245289..245387,246276..>246358)
FT                   /gene="Rdm1"
FT                   /locus_tag="mCG_20208"
FT                   /product="RAD52 motif 1, transcript variant mCT181684"
FT                   /note="gene_id=mCG20208.1 transcript_id=mCT181684.0 created
FT                   on 02-APR-2003"
FT   CDS             join(239476..239571,239780..239959,241732..241854,
FT                   242307..242466,245289..245387,246276..246361,
FT                   247236..247337)
FT                   /codon_start=1
FT                   /gene="Rdm1"
FT                   /locus_tag="mCG_20208"
FT                   /product="RAD52 motif 1, isoform CRA_b"
FT                   /note="gene_id=mCG20208.1 transcript_id=mCT19898.2
FT                   protein_id=mCP23401.2 isoform=CRA_b"
FT                   /protein_id="EDL34063.1"
FT                   /translation="MAELISFVVPTQSDKVLLVWDLSTGPPAEALSHSLFTVFSQFGLL
FT                   YSVRVFPNAAVARPGFYAIIKFYSSRDAQRAQKACDGKPLFQTSPVKVRLGTRHKALQH
FT                   QAFALNSSRCQELANYYFGFSGWSKRIIKLQELSGLEDAALAVPMQKGSPQFLCAVEVV
FT                   LPPYGCRSPGVGISEEPLRQLEEGQSSFLMKRKTAQKLAFQAAVSDAFQKLTIVVLESG
FT                   RIAVEYRPTAEDLDARSEEELQNLIQVSCSSWSQSSQREEECLSDFSLEEEDLKLCDPH
FT                   "
FT   CDS             join(239476..239571,239780..239931,242366..242466,
FT                   245289..245387,246276..>246358)
FT                   /codon_start=1
FT                   /gene="Rdm1"
FT                   /locus_tag="mCG_20208"
FT                   /product="RAD52 motif 1, isoform CRA_a"
FT                   /note="gene_id=mCG20208.1 transcript_id=mCT181684.0
FT                   protein_id=mCP104606.0 isoform=CRA_a"
FT                   /protein_id="EDL34062.1"
FT                   /translation="MAELISFVVPTQSDKVLLVWDLSTGPPAEALSHSLFTVFSQFGLL
FT                   YSVRVFPNAAVARPGFYAIIKFYSSRDAQRAQKACDGNPQFLCAVEVVLPPYGCRSPGV
FT                   GISEEPLRQLEEGQSSFLMKRKTAQKLAFQAAVSDAFQKLTIVVLESGRIAVEYRPTAE
FT                   DLDARSEEELQNLI"
FT   gene            277046..279333
FT                   /gene="Arfl4"
FT                   /locus_tag="mCG_20217"
FT                   /note="gene_id=mCG20217.1"
FT   mRNA            join(277046..277121,278032..279333)
FT                   /gene="Arfl4"
FT                   /locus_tag="mCG_20217"
FT                   /product="ADP-ribosylation factor 4-like"
FT                   /note="gene_id=mCG20217.1 transcript_id=mCT19907.1 created
FT                   on 15-JUL-2002"
FT   CDS             278134..278739
FT                   /codon_start=1
FT                   /gene="Arfl4"
FT                   /locus_tag="mCG_20217"
FT                   /product="ADP-ribosylation factor 4-like"
FT                   /note="gene_id=mCG20217.1 transcript_id=mCT19907.1
FT                   protein_id=mCP23588.2"
FT                   /db_xref="GOA:Q99PE9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR024156"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1933155"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99PE9"
FT                   /protein_id="EDL34064.1"
FT                   /translation="MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKE
FT                   FVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDSA
FT                   ETERLEEARMELHRISKASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLT
FT                   HVQGCSAVDGLGLQPGLEHLYEMILKRKKAPRSSKKRR"
FT   assembly_gap    286494..286513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    291466..296278
FT                   /estimated_length=4813
FT                   /gap_type="unknown"
FT   gene            344217..380565
FT                   /gene="Dhx8"
FT                   /locus_tag="mCG_20209"
FT                   /note="gene_id=mCG20209.2"
FT   mRNA            join(344217..344450,345418..345503,346640..346712,
FT                   347071..347156,348919..349028,349392..349823,
FT                   350966..351110,352138..352341,352976..353063,
FT                   354551..354648,356582..356729,361369..361550,
FT                   362362..362556,363495..363680,363769..363979,
FT                   364632..364813,366216..366356,369069..369224,
FT                   373675..373812,375363..375491,375611..375807,
FT                   376244..376423,378106..380565)
FT                   /gene="Dhx8"
FT                   /locus_tag="mCG_20209"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 8"
FT                   /note="gene_id=mCG20209.2 transcript_id=mCT19899.2 created
FT                   on 05-SEP-2002"
FT   CDS             join(344303..344450,345418..345503,346640..346712,
FT                   347071..347156,348919..349028,349392..349823,
FT                   350966..351110,352138..352341,352976..353063,
FT                   354551..354648,356582..356729,361369..361550,
FT                   362362..362556,363495..363680,363769..363979,
FT                   364632..364813,366216..366356,369069..369224,
FT                   373675..373812,375363..375491,375611..375807,
FT                   376244..376423,378106..378325)
FT                   /codon_start=1
FT                   /gene="Dhx8"
FT                   /locus_tag="mCG_20209"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 8"
FT                   /note="gene_id=mCG20209.2 transcript_id=mCT19899.2
FT                   protein_id=mCP23482.2"
FT                   /protein_id="EDL34065.1"
FT                   /translation="MAVAVAAAGVLMGSEPGPAEELAKLEYLSLVSKVCTELDNHLGIN
FT                   DKDLAEFVISLAEKNTTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDP
FT                   VVKPKTEKEKLRELFPVLCQPDNPSARTMLDEEDVKVAVDVLKELEALMPSAAGQEKQR
FT                   DPEHRDRTKKKKRSRSRDRDRDRDRDRDRDRDRDRDRDKDRERDRDRERDRERDRERDH
FT                   KRRHRSRSRSHSRTRERTKGKSRYRSRSRSQSPFKDRKDREKYGERNLDRWRDKHVDRP
FT                   PPEEPAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKG
FT                   QRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSL
FT                   VSAPEVEDDSLERKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEED
FT                   EDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQ
FT                   REAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGK
FT                   KTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRG
FT                   KIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLREC
FT                   LIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYF
FT                   YEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDT
FT                   ACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLT
FT                   IDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTER
FT                   AYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLG
FT                   ALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDK
FT                   QALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQML
FT                   GIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALF
FT                   NRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPL
FT                   YNRYEEPNAWRISRAFRRR"
FT   gene            complement(381212..>396866)
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /note="gene_id=mCG20218.2"
FT   mRNA            complement(join(381212..382056,382435..382536,
FT                   382794..382966,383155..383223,383347..383421,
FT                   385071..385339,385543..385689,386779..386905,
FT                   388598..388651,395472..395519,395735..395828,
FT                   396059..396169,396650..>396866))
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /product="ets variant gene 4 (E1A enhancer binding protein,
FT                   E1AF), transcript variant mCT19908"
FT                   /note="gene_id=mCG20218.2 transcript_id=mCT19908.2 created
FT                   on 15-JUL-2002"
FT   mRNA            complement(join(381213..382056,382435..382536,
FT                   382794..382966,383155..383223,383347..383421,
FT                   385071..385339,385543..385707,386779..386905,
FT                   388598..388651,395472..395519,395735..395831,
FT                   396650..>396866))
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /product="ets variant gene 4 (E1A enhancer binding protein,
FT                   E1AF), transcript variant mCT170711"
FT                   /note="gene_id=mCG20218.2 transcript_id=mCT170711.0 created
FT                   on 15-JUL-2002"
FT   mRNA            complement(join(381213..382056,382435..382536,
FT                   382794..382966,383155..383223,383347..383421,
FT                   385071..385339,385543..385707,386779..386905,
FT                   388598..388651,395472..395519,395735..395828,
FT                   396059..396169,396650..>396866))
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /product="ets variant gene 4 (E1A enhancer binding protein,
FT                   E1AF), transcript variant mCT170712"
FT                   /note="gene_id=mCG20218.2 transcript_id=mCT170712.0 created
FT                   on 15-JUL-2002"
FT   CDS             complement(join(381832..382056,382435..382536,
FT                   382794..382966,383155..383223,383347..383421,
FT                   385071..385339,385543..385707,386779..386905,
FT                   388598..388651,395472..395519,395735..395831,
FT                   396650..>396865))
FT                   /codon_start=1
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /product="ets variant gene 4 (E1A enhancer binding protein,
FT                   E1AF), isoform CRA_a"
FT                   /note="gene_id=mCG20218.2 transcript_id=mCT170711.0
FT                   protein_id=mCP93629.0 isoform=CRA_a"
FT                   /protein_id="EDL34066.1"
FT                   /translation="EERERRPRQRKCTNQLLPRAHNCLLRPENKPGLWGPGAQAASLRP
FT                   SPATLVVSSPGHAEHPPAAPAQTPGPQQKSPGNGSLGEALMVPQGKLMDPGSLPPSDSE
FT                   DLFQDLSHFQETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSC
FT                   SRKPPLPYHHGEQCLYSSAYDSPRQIAIKSPAPGAPGQSPLQPFSRAEQQQSLLRASSS
FT                   SQSHPGHGYLGEHSSVFQQPVDMCHSFTSPQGGGREPLPAPYQHQLSEPCPPYPQQNFK
FT                   QEYHDPLYEQAGQPASSQGGVSGHRYPGAGVVIKQERTDFAYDSDVPGCASMYLHPEGF
FT                   SGPSPGDGVMGYGYEKSLRPFPDDVCIVPEKFEGDIKQEGIGAFREGPPYQRRGALQLW
FT                   QFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYY
FT                   EKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDES
FT                   PAYLPELTGPAPPFGHRGGYSY"
FT   CDS             complement(join(381832..382056,382435..382536,
FT                   382794..382966,383155..383223,383347..383421,
FT                   385071..385339,385543..385689,386779..386905,
FT                   388598..388651,395472..395519,395735..395828,
FT                   396059..396169,396650..>396865))
FT                   /codon_start=1
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /product="ets variant gene 4 (E1A enhancer binding protein,
FT                   E1AF), isoform CRA_c"
FT                   /note="gene_id=mCG20218.2 transcript_id=mCT19908.2
FT                   protein_id=mCP23590.2 isoform=CRA_c"
FT                   /protein_id="EDL34068.1"
FT                   /translation="EERERRPRQRKCTNQLLPRAHNCLLRPENKPGLWGPGAQAASLRP
FT                   SPATLVVSSPGHAEHPPAAPAQTPGPQVSASARGPGPVAGGSGRMERRMKGGYLDQRVP
FT                   YTFCSKSPGNGSLGEALMVPQGKLMDPGSLPPSDSEDLFQDLSHFQETWLAEAQVPDSD
FT                   EQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSRQIAIK
FT                   SPAPGAPGQSPLQPFSRAEQQQSLLRASSSSQSHPGHGYLGEHSSVFQQPVDMCHSFTS
FT                   PQGGGREPLPAPYQHQLSEPCPPYPQQNFKQEYHDPLYEQAGQPASSQGGVSGHRYPGA
FT                   GVVIKQERTDFAYDSDVPGCASMYLHPEGFSGPSPGDGVMGYGYEKSLRPFPDDVCIVP
FT                   EKFEGDIKQEGIGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIE
FT                   PEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAF
FT                   PDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELTGPAPPFGHRGGYSY"
FT   CDS             complement(join(381832..382056,382435..382536,
FT                   382794..382966,383155..383223,383347..383421,
FT                   385071..385339,385543..385707,386779..386905,
FT                   388598..388651,395472..395519,395735..395828,
FT                   396059..396169,396650..>396865))
FT                   /codon_start=1
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /product="ets variant gene 4 (E1A enhancer binding protein,
FT                   E1AF), isoform CRA_b"
FT                   /note="gene_id=mCG20218.2 transcript_id=mCT170712.0
FT                   protein_id=mCP93630.0 isoform=CRA_b"
FT                   /protein_id="EDL34067.1"
FT                   /translation="EERERRPRQRKCTNQLLPRAHNCLLRPENKPGLWGPGAQAASLRP
FT                   SPATLVVSSPGHAEHPPAAPAQTPGPQVSASARGPGPVAGGSGRMERRMKGGYLDQRVP
FT                   YTFCSKSPGNGSLGEALMVPQGKLMDPGSLPPSDSEDLFQDLSHFQETWLAEAQVPDSD
FT                   EQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSSAYDSP
FT                   RQIAIKSPAPGAPGQSPLQPFSRAEQQQSLLRASSSSQSHPGHGYLGEHSSVFQQPVDM
FT                   CHSFTSPQGGGREPLPAPYQHQLSEPCPPYPQQNFKQEYHDPLYEQAGQPASSQGGVSG
FT                   HRYPGAGVVIKQERTDFAYDSDVPGCASMYLHPEGFSGPSPGDGVMGYGYEKSLRPFPD
FT                   DVCIVPEKFEGDIKQEGIGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGM
FT                   EFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEA
FT                   LFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELTGPAPPFGHRGGYSY"
FT   assembly_gap    395972..395991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    400706..400789
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   gene            complement(488940..506938)
FT                   /gene="Meox1"
FT                   /locus_tag="mCG_21357"
FT                   /note="gene_id=mCG21357.2"
FT   mRNA            complement(join(488940..490164,491884..492059,
FT                   506172..506938))
FT                   /gene="Meox1"
FT                   /locus_tag="mCG_21357"
FT                   /product="mesenchyme homeobox 1"
FT                   /note="gene_id=mCG21357.2 transcript_id=mCT22043.2 created
FT                   on 15-JUL-2002"
FT   CDS             complement(join(490042..490164,491884..492059,
FT                   506172..506634))
FT                   /codon_start=1
FT                   /gene="Meox1"
FT                   /locus_tag="mCG_21357"
FT                   /product="mesenchyme homeobox 1"
FT                   /note="gene_id=mCG21357.2 transcript_id=mCT22043.2
FT                   protein_id=mCP23463.2"
FT                   /db_xref="GOA:P32442"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:103220"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32442"
FT                   /protein_id="EDL34069.1"
FT                   /translation="MDPVANSCVRNPQPPAPVWGCLRNPHSEDSSASGLSHYPPTPFSF
FT                   HQKSDFPATAAYPDFSASCLAATPHSLPRTERIFNEQHPAFPQTPDWHFPISEAGQRLN
FT                   LGPAGSAREMGAGSPGLVDGTAGLGEDCMVLGTIANETEKKSSRRKKERSDNQENGGGK
FT                   PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRR
FT                   MKWKRVKGGQPVSPQEQDREDGDSAASPSSE"
FT   gene            <498849..503797
FT                   /locus_tag="mCG_1042067"
FT                   /note="gene_id=mCG1042067.0"
FT   mRNA            join(<498849..498967,503534..503797)
FT                   /locus_tag="mCG_1042067"
FT                   /product="mCG1042067"
FT                   /note="gene_id=mCG1042067.0 transcript_id=mCT159771.0
FT                   created on 05-SEP-2002"
FT   CDS             <503546..503698
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042067"
FT                   /product="mCG1042067"
FT                   /note="gene_id=mCG1042067.0 transcript_id=mCT159771.0
FT                   protein_id=mCP75432.0"
FT                   /protein_id="EDL34070.1"
FT                   /translation="RLQECNNVLRVAVTLSLHLPDNEVQWSRLAHLPGLSHGDLDEAPR
FT                   SQQSR"
FT   gene            552669..553099
FT                   /locus_tag="mCG_49945"
FT                   /note="gene_id=mCG49945.1"
FT   mRNA            552669..553099
FT                   /locus_tag="mCG_49945"
FT                   /product="mCG49945"
FT                   /note="gene_id=mCG49945.1 transcript_id=mCT50128.1 created
FT                   on 05-SEP-2002"
FT   CDS             552673..553071
FT                   /codon_start=1
FT                   /locus_tag="mCG_49945"
FT                   /product="mCG49945"
FT                   /note="gene_id=mCG49945.1 transcript_id=mCT50128.1
FT                   protein_id=mCP42949.0"
FT                   /protein_id="EDL34071.1"
FT                   /translation="MGKFMKSRKVVLVLAGRKAVIVKNIDDGTSDRPYSHALVAGIDRY
FT                   PRKVTAAMAKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKR
FT                   KARREAKVKFEEQYKTGKNKWFFQKLHF"
FT   assembly_gap    564785..564804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <567538..575690
FT                   /locus_tag="mCG_145529"
FT                   /note="gene_id=mCG145529.0"
FT   mRNA            join(<567538..567596,570812..570981,571168..571218,
FT                   574787..575690)
FT                   /locus_tag="mCG_145529"
FT                   /product="mCG145529"
FT                   /note="gene_id=mCG145529.0 transcript_id=mCT184953.0
FT                   created on 05-JUN-2003"
FT   CDS             <574891..575391
FT                   /codon_start=1
FT                   /locus_tag="mCG_145529"
FT                   /product="mCG145529"
FT                   /note="gene_id=mCG145529.0 transcript_id=mCT184953.0
FT                   protein_id=mCP105798.0"
FT                   /protein_id="EDL34072.1"
FT                   /translation="LSASPVPGYLMPSSDLLRHQACKCYTGIYSSKSTHTPKLNHKQNK
FT                   NTFNTCGTFPRPETSCALRWGNQGALQEWGRPKCSHPQWSGDRVGECGLLSGNLWKRVY
FT                   TGLSTRFQCLWLWVTQEASADPSVFPATSPSHFKESGDPVALLGFCNFVSFMRRNGLFL
FT                   ECK"
FT   gene            complement(577653..582132)
FT                   /gene="Sost"
FT                   /locus_tag="mCG_21360"
FT                   /note="gene_id=mCG21360.2"
FT   mRNA            complement(join(577653..579384,581877..582132))
FT                   /gene="Sost"
FT                   /locus_tag="mCG_21360"
FT                   /product="sclerostin"
FT                   /note="gene_id=mCG21360.2 transcript_id=mCT22041.2 created
FT                   on 15-JUL-2002"
FT   CDS             complement(join(578963..579384,581877..582090))
FT                   /codon_start=1
FT                   /gene="Sost"
FT                   /locus_tag="mCG_21360"
FT                   /product="sclerostin"
FT                   /note="gene_id=mCG21360.2 transcript_id=mCT22041.2
FT                   protein_id=mCP23468.2"
FT                   /db_xref="GOA:B2RQA5"
FT                   /db_xref="InterPro:IPR008835"
FT                   /db_xref="InterPro:IPR015665"
FT                   /db_xref="MGI:MGI:1921749"
FT                   /db_xref="UniProtKB/TrEMBL:B2RQA5"
FT                   /protein_id="EDL34073.1"
FT                   /translation="MQPSLAPCLICLLVHAAFCAVEGQGWQAFRNDATEVIPGLGEYPE
FT                   PPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCS
FT                   GQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASC
FT                   KCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY"
FT   gene            complement(589275..602104)
FT                   /gene="Dusp3"
FT                   /locus_tag="mCG_21353"
FT                   /note="gene_id=mCG21353.1"
FT   mRNA            complement(join(589275..590056,596730..596956,
FT                   599725..599864,601980..602104))
FT                   /gene="Dusp3"
FT                   /locus_tag="mCG_21353"
FT                   /product="dual specificity phosphatase 3 (vaccinia virus
FT                   phosphatase VH1-related), transcript variant mCT22038"
FT                   /note="gene_id=mCG21353.1 transcript_id=mCT22038.1 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(589276..590056,596730..596956,
FT                   599725..>599884))
FT                   /gene="Dusp3"
FT                   /locus_tag="mCG_21353"
FT                   /product="dual specificity phosphatase 3 (vaccinia virus
FT                   phosphatase VH1-related), transcript variant mCT193262"
FT                   /note="gene_id=mCG21353.1 transcript_id=mCT193262.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(589851..590056,596730..596956,
FT                   599725..>599882))
FT                   /codon_start=1
FT                   /gene="Dusp3"
FT                   /locus_tag="mCG_21353"
FT                   /product="dual specificity phosphatase 3 (vaccinia virus
FT                   phosphatase VH1-related), isoform CRA_a"
FT                   /note="gene_id=mCG21353.1 transcript_id=mCT193262.0
FT                   protein_id=mCP114228.0 isoform=CRA_a"
FT                   /protein_id="EDL34074.1"
FT                   /translation="SCPGVQRPAAAMSSSFELSVQDLNDLLSDGSGCYSLPSQPCNEVV
FT                   PRVYVGNASVAQDITQLQKLGITHVLNAAEGRSFMHVNTSASFYEDSGITYLGIKANDT
FT                   QEFNLSAYFERATDFIDQALAHKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALS
FT                   TVRQNREIGPNDGFLAQLCQLNDRLAKEGKVKL"
FT   CDS             complement(join(589851..590056,596730..596956,
FT                   599725..599849))
FT                   /codon_start=1
FT                   /gene="Dusp3"
FT                   /locus_tag="mCG_21353"
FT                   /product="dual specificity phosphatase 3 (vaccinia virus
FT                   phosphatase VH1-related), isoform CRA_b"
FT                   /note="gene_id=mCG21353.1 transcript_id=mCT22038.1
FT                   protein_id=mCP23566.1 isoform=CRA_b"
FT                   /protein_id="EDL34075.1"
FT                   /translation="MSSSFELSVQDLNDLLSDGSGCYSLPSQPCNEVVPRVYVGNASVA
FT                   QDITQLQKLGITHVLNAAEGRSFMHVNTSASFYEDSGITYLGIKANDTQEFNLSAYFER
FT                   ATDFIDQALAHKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSTVRQNREIGPN
FT                   DGFLAQLCQLNDRLAKEGKVKL"
FT   gene            602164..607350
FT                   /locus_tag="mCG_21361"
FT                   /note="gene_id=mCG21361.1"
FT   mRNA            join(602164..602350,603060..603130,603559..603677,
FT                   605881..606004,606543..606599,607207..607350)
FT                   /locus_tag="mCG_21361"
FT                   /product="mCG21361"
FT                   /note="gene_id=mCG21361.1 transcript_id=mCT22046.2 created
FT                   on 05-SEP-2002"
FT   CDS             join(602227..602350,603060..603130,603559..603677,
FT                   605881..606004,606543..606599)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21361"
FT                   /product="mCG21361"
FT                   /note="gene_id=mCG21361.1 transcript_id=mCT22046.2
FT                   protein_id=mCP23540.2"
FT                   /db_xref="GOA:Q9DAN9"
FT                   /db_xref="InterPro:IPR029488"
FT                   /db_xref="MGI:MGI:1922687"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DAN9"
FT                   /protein_id="EDL34076.1"
FT                   /translation="MNNSLDYLAYPVIVSNHRQSTTFRKKLDFGHYILHKNRVQIVKPA
FT                   VDTKPPMAHTHYILKLSKIQGEQKRIDKIEYENRQLCQKIANAYRGPAKVDCWNEYLSK
FT                   SLNRESRNRELVRITMENQGILRRLSDRKPNYDRRSSEMDWQNSRRYIRNTTRYLLFQE
FT                   D"
FT   gene            complement(614732..>642003)
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /note="gene_id=mCG21363.3"
FT   mRNA            complement(join(614732..615799,617094..617216,
FT                   620060..620168,620417..620510,623426..623506,
FT                   623590..623754,624713..624754,625277..625297,
FT                   626790..626854,628385..628581,631697..631771,
FT                   633680..633765,635540..635621,638395..638532,
FT                   638770..638850,640145..640222,640449..640567,
FT                   640800..640924,641935..642001))
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /product="membrane protein, palmitoylated 3 (MAGUK p55
FT                   subfamily member 3), transcript variant mCT22049"
FT                   /note="gene_id=mCG21363.3 transcript_id=mCT22049.2 created
FT                   on 15-JUL-2002"
FT   mRNA            complement(join(614732..615799,617094..617216,
FT                   620060..620168,620417..620510,623426..623506,
FT                   623590..623754,624713..624754,626775..626854,
FT                   628385..628581,631697..631771,633680..633765,
FT                   635540..635621,638395..638532,638770..638850,
FT                   640145..640222,640449..640567,640800..640924,
FT                   641935..>641973))
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /product="membrane protein, palmitoylated 3 (MAGUK p55
FT                   subfamily member 3), transcript variant mCT193170"
FT                   /note="gene_id=mCG21363.3 transcript_id=mCT193170.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(615256..615799,617094..617216,
FT                   620060..620168,620417..620510,623426..623506,
FT                   623590..623754,624713..624754,626775..626854,
FT                   628385..628581,631697..631771,633680..633765,
FT                   635540..635621,638395..638532,638770..640222,
FT                   640449..640567,640800..640924,641935..>642003))
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /product="membrane protein, palmitoylated 3 (MAGUK p55
FT                   subfamily member 3), transcript variant mCT193171"
FT                   /note="gene_id=mCG21363.3 transcript_id=mCT193171.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(615623..615799,617094..617216,
FT                   620060..620168,620417..620510,623426..623506,
FT                   623590..623754,624713..624754,625277..625297,
FT                   626790..626854,628385..628581,631697..631771,
FT                   633680..633765,635540..635621,638395..638532,
FT                   638770..638850,640145..640222,640449..640567,
FT                   640800..640824))
FT                   /codon_start=1
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /product="membrane protein, palmitoylated 3 (MAGUK p55
FT                   subfamily member 3), isoform CRA_c"
FT                   /note="gene_id=mCG21363.3 transcript_id=mCT22049.2
FT                   protein_id=mCP23470.2 isoform=CRA_c"
FT                   /protein_id="EDL34079.1"
FT                   /translation="MPILSEDSGLHETLALLTSQLRPDSNHREEMGFLRDVFSEKSLSY
FT                   LMKIHEKLRYYERQSPTPVLHSAMALAEDVMEELQAASVHSDERELLQLLSTPHLRAVL
FT                   MVHDTVAQKNFDPVLPPLPDNIDEDFEEESVKIVRLVKNKEPLGATIRRDEHSGAVVVA
FT                   RIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQEED
FT                   RFKDSKVFMRALFHYDPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTNL
FT                   RAGLIPSKQFQERRLSYRRTTGTLPSPQNFKKPPYDQPCDKETCDCDGYFKGHYVAGLR
FT                   RSFRLGCRERLGGSQEAKVPTGAESQVLLTYEEVARYQHQPGERPRLVVLIGSLGAHLH
FT                   ELKQRVVAEDPQQFAVAVPHTTRPRKSHERDGVEYHFVSKQAFEADVHHNKFLEHGEYK
FT                   ENLYGTSLEAIQAVMAKNKVCLVDVEPEALRHLRTPEFKPYVIFVKPAIQERRKTPPVS
FT                   PDSEDIASSLDEQQQEMAASAAFIDQHYGHLIDTVLVRQDLQEACSQLRAVIETLSKDT
FT                   SWVPISWVR"
FT   CDS             complement(join(626782..626854,628385..628581,
FT                   631697..631771,633680..633765,635540..635621,
FT                   638395..638532,638770..638850,640145..640222,
FT                   640449..640567,640800..>640884))
FT                   /codon_start=1
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /product="membrane protein, palmitoylated 3 (MAGUK p55
FT                   subfamily member 3), isoform CRA_a"
FT                   /note="gene_id=mCG21363.3 transcript_id=mCT193170.0
FT                   protein_id=mCP114166.0 isoform=CRA_a"
FT                   /protein_id="EDL34077.1"
FT                   /translation="EIPLPPTQTVGTAGDLLGTGMPILSEDSGLHETLALLTSQLRPDS
FT                   NHREEMGFLRDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAMALAEDVMEELQAASV
FT                   HSDERELLQLLSTPHLRAVLMVHDTVAQKNFDPVLPPLPDNIDEDFEEESVKIVRLVKN
FT                   KEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQI
FT                   LAQSQGSITLKIIPATQEEDRFKDSKVFMRALFHYDPREDRAIPCQEAGLPFQRRQVLE
FT                   VVSQDDPTWWQAKRVGDTNLRAGLIPSKQFQERRLSYRRTTGTLPSPQNFKKPPCE"
FT   CDS             complement(join(626782..626854,628385..628581,
FT                   631697..631771,633680..633765,635540..635621,
FT                   638395..638532,638770..>639051))
FT                   /codon_start=1
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /product="membrane protein, palmitoylated 3 (MAGUK p55
FT                   subfamily member 3), isoform CRA_b"
FT                   /note="gene_id=mCG21363.3 transcript_id=mCT193171.0
FT                   protein_id=mCP114167.0 isoform=CRA_b"
FT                   /protein_id="EDL34078.1"
FT                   /translation="VHSRPWFDFPRASASLGVASVTCFRVLRPFLRGSLCPRPREEGFP
FT                   PRGSIQQAPARGTSASCLLLLQVMEELQAASVHSDERELLQLLSTPHLRAVLMVHDTVA
FT                   QKNFDPVLPPLPDNIDEDFEEESVKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGA
FT                   ADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQEEDRFKDSKV
FT                   FMRALFHYDPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPS
FT                   KQFQERRLSYRRTTGTLPSPQNFKKPPCE"
FT   gene            complement(645337..650161)
FT                   /locus_tag="mCG_148168"
FT                   /note="gene_id=mCG148168.0"
FT   mRNA            complement(join(645337..645537,649911..650161))
FT                   /locus_tag="mCG_148168"
FT                   /product="mCG148168"
FT                   /note="gene_id=mCG148168.0 transcript_id=mCT188431.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(645372..645470)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148168"
FT                   /product="mCG148168"
FT                   /note="gene_id=mCG148168.0 transcript_id=mCT188431.0
FT                   protein_id=mCP109345.0"
FT                   /protein_id="EDL34080.1"
FT                   /translation="MRQTHVPLICRLMTQTGHDQLLHILLAVNSLP"
FT   gene            <656592..670682
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /note="gene_id=mCG21358.2"
FT   mRNA            join(<656592..656718,658057..658389,661921..662254,
FT                   663756..663868,665544..665596,668539..668658,
FT                   669160..669747)
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /product="CD300 antigen like family member G, transcript
FT                   variant mCT193269"
FT                   /note="gene_id=mCG21358.2 transcript_id=mCT193269.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<656592..656718,658057..658389,661921..662254,
FT                   663756..663868,665544..665596,668539..668658,
FT                   669160..669279)
FT                   /codon_start=1
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /product="CD300 antigen like family member G, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21358.2 transcript_id=mCT193269.0
FT                   protein_id=mCP114229.0 isoform=CRA_a"
FT                   /protein_id="EDL34081.1"
FT                   /translation="PPFLAPARQKLKLRRAPNCRQLQCPAPTMRPLVLLWGCLVLPGYE
FT                   ALKGPKEISGFEGDTVSLRCTYVEKMKEHRKYWCRQGGILVSRCGDIVYANQDQEVTRG
FT                   RMSIRDSPQELSMTVIMRDLTLKDSGKYWCGIDRLGRDESFEVTLIVFPASPGLHPTVV
FT                   TAKQGKTGVKAPVFTEAAPAWSTGTSQVPPGISPYAGSSPHTATPARSAGTSQVPPGIS
FT                   PYAGRSPHTATSPHAGSSRPVVWLPLTTPQDSRAVASSVSKPSVSIPMVRMMAPVLILL
FT                   SLLLAAGLIAFGSHMLRWRKKAWLATETQKNEKVYLETSLPGNGWTTEDSTIDLAVTPE
FT                   CLRNLNPSAVPSPETQNLSQSTEEEEAARSLDDDKEDVMAPPPLQMSAEELAFSEFISV
FT                   "
FT   mRNA            join(656595..656718,658057..658389,662173..662254,
FT                   663756..663868,665544..665596,668539..668658,
FT                   669160..670682)
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /product="CD300 antigen like family member G, transcript
FT                   variant mCT22044"
FT                   /note="gene_id=mCG21358.2 transcript_id=mCT22044.1 created
FT                   on 05-SEP-2002"
FT   mRNA            join(<656649..656718,658057..658389,661156..661287,
FT                   661921..662254,663756..663868,665544..665596,
FT                   668539..668658,669160..669753)
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /product="CD300 antigen like family member G, transcript
FT                   variant mCT193270"
FT                   /note="gene_id=mCG21358.2 transcript_id=mCT193270.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<656649..656718,658057..658389,661156..661287,
FT                   661921..662254,663756..663868,665544..665596,
FT                   668539..668658,669160..669279)
FT                   /codon_start=1
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /product="CD300 antigen like family member G, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21358.2 transcript_id=mCT193270.0
FT                   protein_id=mCP114230.0 isoform=CRA_b"
FT                   /protein_id="EDL34082.1"
FT                   /translation="RQLQCPAPTMRPLVLLWGCLVLPGYEALKGPKEISGFEGDTVSLR
FT                   CTYVEKMKEHRKYWCRQGGILVSRCGDIVYANQDQEVTRGRMSIRDSPQELSMTVIMRD
FT                   LTLKDSGKYWCGIDRLGRDESFEVTLIVFPGKRDNAVPAGTCCPSSPTPSFQPLTPTRS
FT                   LQPKAKAWQTQLPEPTSPGLHPTVVTAKQGKTGVKAPVFTEAAPAWSTGTSQVPPGISP
FT                   YAGSSPHTATPARSAGTSQVPPGISPYAGRSPHTATSPHAGSSRPVVWLPLTTPQDSRA
FT                   VASSVSKPSVSIPMVRMMAPVLILLSLLLAAGLIAFGSHMLRWRKKAWLATETQKNEKV
FT                   YLETSLPGNGWTTEDSTIDLAVTPECLRNLNPSAVPSPETQNLSQSTEEEEAARSLDDD
FT                   KEDVMAPPPLQMSAEELAFSEFISV"
FT   CDS             join(656676..656718,658057..658389,662173..662254,
FT                   663756..663868,665544..665596,668539..668658,
FT                   669160..669279)
FT                   /codon_start=1
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /product="CD300 antigen like family member G, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG21358.2 transcript_id=mCT22044.1
FT                   protein_id=mCP23586.2 isoform=CRA_c"
FT                   /protein_id="EDL34083.1"
FT                   /translation="MRPLVLLWGCLVLPGYEALKGPKEISGFEGDTVSLRCTYVEKMKE
FT                   HRKYWCRQGGILVSRCGDIVYANQDQEVTRGRMSIRDSPQELSMTVIMRDLTLKDSGKY
FT                   WCGIDRLGRDESFEVTLIVFPGSSRPVVWLPLTTPQDSRAVASSVSKPSVSIPMVRMMA
FT                   PVLILLSLLLAAGLIAFGSHMLRWRKKAWLATETQKNEKVYLETSLPGNGWTTEDSTID
FT                   LAVTPECLRNLNPSAVPSPETQNLSQSTEEEEAARSLDDDKEDVMAPPPLQMSAEELAF
FT                   SEFISV"
FT   gene            complement(672059..704152)
FT                   /gene="Mpp2"
FT                   /locus_tag="mCG_21348"
FT                   /note="gene_id=mCG21348.2"
FT   mRNA            complement(join(672059..674542,675470..675598,
FT                   675816..676018,676545..676706,676952..677020,
FT                   677106..677211,677302..677433,678239..678466,
FT                   679345..679494,679620..679772,696305..696423,
FT                   700954..701016,704059..704152))
FT                   /gene="Mpp2"
FT                   /locus_tag="mCG_21348"
FT                   /product="membrane protein, palmitoylated 2 (MAGUK p55
FT                   subfamily member 2), transcript variant mCT21545"
FT                   /note="gene_id=mCG21348.2 transcript_id=mCT21545.2 created
FT                   on 16-JUL-2002"
FT   mRNA            complement(join(672062..674542,675470..675598,
FT                   675816..676018,676545..676706,676952..677020,
FT                   677106..677211,677302..677433,678239..678466,
FT                   679345..679494,679620..679772,696305..696423,
FT                   700954..701016,703780..703917,704059..704152))
FT                   /gene="Mpp2"
FT                   /locus_tag="mCG_21348"
FT                   /product="membrane protein, palmitoylated 2 (MAGUK p55
FT                   subfamily member 2), transcript variant mCT170720"
FT                   /note="gene_id=mCG21348.2 transcript_id=mCT170720.0 created
FT                   on 16-JUL-2002"
FT   CDS             complement(join(674366..674542,675470..675598,
FT                   675816..676018,676545..676706,676952..677020,
FT                   677106..677211,677302..677433,678239..678466,
FT                   679345..679494,679620..679772,696305..696423,
FT                   700954..700984))
FT                   /codon_start=1
FT                   /gene="Mpp2"
FT                   /locus_tag="mCG_21348"
FT                   /product="membrane protein, palmitoylated 2 (MAGUK p55
FT                   subfamily member 2), isoform CRA_a"
FT                   /note="gene_id=mCG21348.2 transcript_id=mCT170720.0
FT                   protein_id=mCP93638.0 isoform=CRA_a"
FT                   /protein_id="EDL34084.1"
FT                   /translation="MPVAATNSESAMQQVLDNLGSLPNATGAAELDLIFLRGIMESPIV
FT                   RSLAKAHERLEETKLEAVRDNNLELVQEILRDLAELAEQSSTAAELARILQEPHFQSLL
FT                   ETHDSVASKTYETPPPSPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGGELV
FT                   IARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRSASGSVILKILPSYQEP
FT                   HLPRQVFVKCHFDYDPARDSLSPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEGGSAG
FT                   LIPSQLLEEKRKAFVKRDLELTPTSGTLCGSLSGKKKKRMMYLTTKNAEFDRHELLIYE
FT                   EVARMPPFRRKTLVLIGAQGVGRRSLKNKLILWDPDRYGTTVPYTSRRPKDSEREGQGY
FT                   SFVSRGEMEADIRAGRYLEHGEYEGNLYGTRIDSIRGVVASGKVCVLDVNPQAVKVLRT
FT                   AEFVPYVVFIEAPDYETLRAMNRAALESGVSTKQLTEADLRRTVEESSRIQRGYGHYFD
FT                   LSLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY"
FT   CDS             complement(join(674366..674542,675470..675598,
FT                   675816..676018,676545..676706,676952..677020,
FT                   677106..677211,677302..677433,678239..678466,
FT                   679345..679494,679620..679772,696305..696423,
FT                   700954..700984))
FT                   /codon_start=1
FT                   /gene="Mpp2"
FT                   /locus_tag="mCG_21348"
FT                   /product="membrane protein, palmitoylated 2 (MAGUK p55
FT                   subfamily member 2), isoform CRA_a"
FT                   /note="gene_id=mCG21348.2 transcript_id=mCT21545.2
FT                   protein_id=mCP23419.2 isoform=CRA_a"
FT                   /protein_id="EDL34085.1"
FT                   /translation="MPVAATNSESAMQQVLDNLGSLPNATGAAELDLIFLRGIMESPIV
FT                   RSLAKAHERLEETKLEAVRDNNLELVQEILRDLAELAEQSSTAAELARILQEPHFQSLL
FT                   ETHDSVASKTYETPPPSPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGGELV
FT                   IARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRSASGSVILKILPSYQEP
FT                   HLPRQVFVKCHFDYDPARDSLSPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEGGSAG
FT                   LIPSQLLEEKRKAFVKRDLELTPTSGTLCGSLSGKKKKRMMYLTTKNAEFDRHELLIYE
FT                   EVARMPPFRRKTLVLIGAQGVGRRSLKNKLILWDPDRYGTTVPYTSRRPKDSEREGQGY
FT                   SFVSRGEMEADIRAGRYLEHGEYEGNLYGTRIDSIRGVVASGKVCVLDVNPQAVKVLRT
FT                   AEFVPYVVFIEAPDYETLRAMNRAALESGVSTKQLTEADLRRTVEESSRIQRGYGHYFD
FT                   LSLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY"
FT   assembly_gap    685722..685741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    709072..709211
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            complement(715663..717059)
FT                   /gene="Ppy"
FT                   /locus_tag="mCG_21350"
FT                   /note="gene_id=mCG21350.2"
FT   mRNA            complement(join(715663..715799,715899..716016,
FT                   716280..716470,717025..717059))
FT                   /gene="Ppy"
FT                   /locus_tag="mCG_21350"
FT                   /product="pancreatic polypeptide"
FT                   /note="gene_id=mCG21350.2 transcript_id=mCT21547.2 created
FT                   on 16-JUL-2002"
FT   CDS             complement(join(715905..716016,716280..716470))
FT                   /codon_start=1
FT                   /gene="Ppy"
FT                   /locus_tag="mCG_21350"
FT                   /product="pancreatic polypeptide"
FT                   /note="gene_id=mCG21350.2 transcript_id=mCT21547.2
FT                   protein_id=mCP23441.2"
FT                   /db_xref="GOA:Q496X5"
FT                   /db_xref="InterPro:IPR001955"
FT                   /db_xref="InterPro:IPR015480"
FT                   /db_xref="InterPro:IPR020392"
FT                   /db_xref="MGI:MGI:97753"
FT                   /db_xref="UniProtKB/TrEMBL:Q496X5"
FT                   /protein_id="EDL34086.1"
FT                   /translation="MAVAYCCLSLFLVSTWVALLLQPLQGTWGAPLEPMYPGDYATPEQ
FT                   MAQYETQLRRYINTLTRPRYGKRAEEENTGGLPGVQLSPCTSPPVGLIPCSAPWS"
FT   gene            complement(722425..723581)
FT                   /gene="Pyy"
FT                   /locus_tag="mCG_21368"
FT                   /note="gene_id=mCG21368.1"
FT   mRNA            complement(join(722425..722616,722723..722806,
FT                   722915..723102,723491..723581))
FT                   /gene="Pyy"
FT                   /locus_tag="mCG_21368"
FT                   /product="peptide YY, transcript variant mCT22053"
FT                   /note="gene_id=mCG21368.1 transcript_id=mCT22053.1 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(722430..722616,722717..722806,
FT                   722915..723102,723491..723571))
FT                   /gene="Pyy"
FT                   /locus_tag="mCG_21368"
FT                   /product="peptide YY, transcript variant mCT172782"
FT                   /note="gene_id=mCG21368.1 transcript_id=mCT172782.0 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(722592..722616,722723..722806,
FT                   722915..723102))
FT                   /codon_start=1
FT                   /gene="Pyy"
FT                   /locus_tag="mCG_21368"
FT                   /product="peptide YY, isoform CRA_b"
FT                   /note="gene_id=mCG21368.1 transcript_id=mCT22053.1
FT                   protein_id=mCP23391.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V334"
FT                   /db_xref="InterPro:IPR001955"
FT                   /db_xref="InterPro:IPR020392"
FT                   /db_xref="MGI:MGI:99924"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V334"
FT                   /protein_id="EDL34088.1"
FT                   /translation="MVAVRRPWPVTVAMLLILLACLGALVDAYPAKPEAPGEDASPEEL
FT                   SRYYASLRHYLNLVTRQRYGKRDVPAALFSKLLFTDDSDSENLPFRPEGLDQW"
FT   CDS             complement(join(722592..722616,722717..722806,
FT                   722915..723102))
FT                   /codon_start=1
FT                   /gene="Pyy"
FT                   /locus_tag="mCG_21368"
FT                   /product="peptide YY, isoform CRA_a"
FT                   /note="gene_id=mCG21368.1 transcript_id=mCT172782.0
FT                   protein_id=mCP95701.0 isoform=CRA_a"
FT                   /db_xref="GOA:H3BK86"
FT                   /db_xref="InterPro:IPR001955"
FT                   /db_xref="InterPro:IPR020392"
FT                   /db_xref="MGI:MGI:99924"
FT                   /db_xref="UniProtKB/TrEMBL:H3BK86"
FT                   /protein_id="EDL34087.1"
FT                   /translation="MVAVRRPWPVTVAMLLILLACLGALVDAYPAKPEAPGEDASPEEL
FT                   SRYYASLRHYLNLVTRQRYGKRDVPAALFSKLLFTDDSDSENLPFRSRPEGLDQW"
FT   gene            739807..740418
FT                   /locus_tag="mCG_141025"
FT                   /note="gene_id=mCG141025.0"
FT   mRNA            739807..740418
FT                   /locus_tag="mCG_141025"
FT                   /product="mCG141025"
FT                   /note="gene_id=mCG141025.0 transcript_id=mCT172754.0
FT                   created on 05-SEP-2002"
FT   CDS             739835..740401
FT                   /codon_start=1
FT                   /locus_tag="mCG_141025"
FT                   /product="mCG141025"
FT                   /note="gene_id=mCG141025.0 transcript_id=mCT172754.0
FT                   protein_id=mCP95673.0"
FT                   /protein_id="EDL34089.1"
FT                   /translation="MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQ
FT                   FCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRH
FT                   SAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIEFQAPLGKR
FT                   VQAWTHSLTCPALTGILALILMPTE"
FT   assembly_gap    747719..747738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <761102..765116
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /note="gene_id=mCG21373.1"
FT   mRNA            join(761102..761580,762079..762353,762452..762665,
FT                   762953..763133,763399..763570,763681..763863,
FT                   764507..765116)
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /product="N-acetylglutamate synthase, transcript variant
FT                   mCT22059"
FT                   /note="gene_id=mCG21373.1 transcript_id=mCT22059.1 created
FT                   on 05-SEP-2002"
FT   mRNA            join(<761102..761580,762079..763570,763681..763863,
FT                   764507..765065)
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /product="N-acetylglutamate synthase, transcript variant
FT                   mCT193211"
FT                   /note="gene_id=mCG21373.1 transcript_id=mCT193211.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<761104..761580,762079..762582)
FT                   /codon_start=1
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /product="N-acetylglutamate synthase, isoform CRA_a"
FT                   /note="gene_id=mCG21373.1 transcript_id=mCT193211.0
FT                   protein_id=mCP114169.0 isoform=CRA_a"
FT                   /protein_id="EDL34090.1"
FT                   /translation="TPSAVRSRATVTCGWGGRVGLVVVMATAWVATALRSAAAARRLRS
FT                   PGGPGGSRRLSGSARRRGAKSASPGRRLSTARAHAEDAEGAKGRVQSPAVEEPSWTPLP
FT                   TPLESPAPPAGRSLVQRDIQAFLNQCGASPGEARHWLTQFQTCYHSVDKPFAVMEVDEE
FT                   VIRCPQAVSRLAFALAFLQRMDMKPLVVLGLPTPTAPSGCLSFWEAKAQLAQSCKVLVD
FT                   ELRHNAATAVPFFGGGSVLSAAEPAPHARLVSTQPAPASSERADHSAGPALVPLKHHIW
FT                   PTATVASSRWRQTCCSGVWNPTASPSCAPLGKRLRAVPCSLTRWR"
FT   CDS             join(761176..761580,762079..762353,762452..762665,
FT                   762953..763133,763399..763570,763681..763863,
FT                   764507..764660)
FT                   /codon_start=1
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /product="N-acetylglutamate synthase, isoform CRA_b"
FT                   /note="gene_id=mCG21373.1 transcript_id=mCT22059.1
FT                   protein_id=mCP23454.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8R4H7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011243"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="MGI:MGI:2387600"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R4H7"
FT                   /protein_id="EDL34091.1"
FT                   /translation="MATAWVATALRSAAAARRLRSPGGPGGSRRLSGSARRRGAKSASP
FT                   GRRLSTARAHAEDAEGAKGRVQSPAVEEPSWTPLPTPLESPAPPAGRSLVQRDIQAFLN
FT                   QCGASPGEARHWLTQFQTCYHSVDKPFAVMEVDEEVIRCPQAVSRLAFALAFLQRMDMK
FT                   PLVVLGLPTPTAPSGCLSFWEAKAQLAQSCKVLVDELRHNAATAVPFFGGGSVLSAAEP
FT                   APHASYGGIVAVETDLLQWCLESNSIPILCPIGETAARRSVLLDSLEVTASLAKALQPT
FT                   KIIFLNNSGGLRNNSQKILSNVNLPADLDLVTNAEWLSIKERQQIRLIVDVLSRLPHYS
FT                   SAVITAASTLLTELFSNKGCGTLFKNAERMLRVRNLDSLDQGRLVNLVNASFGKKLRED
FT                   YLESLRPRLHSIYVSEGYNAAAILTVEPVLGGTPYLDKFVVSSSRQGQGSGQMLWECLR
FT                   RDLQTLFWRSRVTNPINPWYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDS
FT                   FCKPASDPGS"
FT   mRNA            join(761953..762353,762452..762665,762953..763133,
FT                   763399..763570,763681..763863,764507..765065)
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /product="N-acetylglutamate synthase, transcript variant
FT                   mCT172786"
FT                   /note="gene_id=mCG21373.1 transcript_id=mCT172786.0 created
FT                   on 05-SEP-2002"
FT   CDS             join(762151..762353,762452..762665,762953..763133,
FT                   763399..763570,763681..763863,764507..764660)
FT                   /codon_start=1
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /product="N-acetylglutamate synthase, isoform CRA_c"
FT                   /note="gene_id=mCG21373.1 transcript_id=mCT172786.0
FT                   protein_id=mCP95705.0 isoform=CRA_c"
FT                   /protein_id="EDL34092.1"
FT                   /translation="MDMKPLVVLGLPTPTAPSGCLSFWEAKAQLAQSCKVLVDELRHNA
FT                   ATAVPFFGGGSVLSAAEPAPHASYGGIVAVETDLLQWCLESNSIPILCPIGETAARRSV
FT                   LLDSLEVTASLAKALQPTKIIFLNNSGGLRNNSQKILSNVNLPADLDLVTNAEWLSIKE
FT                   RQQIRLIVDVLSRLPHYSSAVITAASTLLTELFSNKGCGTLFKNAERMLRVRNLDSLDQ
FT                   GRLVNLVNASFGKKLREDYLESLRPRLHSIYVSEGYNAAAILTVEPVLGGTPYLDKFVV
FT                   SSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSDGSFSNKQWIFFWFGLA
FT                   DIRDSYELVNHAKGLPDSFCKPASDPGS"
FT   gene            complement(768142..771954)
FT                   /gene="Tmem101"
FT                   /locus_tag="mCG_21351"
FT                   /note="gene_id=mCG21351.1"
FT   mRNA            complement(join(768142..769188,770151..770297,
FT                   771318..771498,771802..771954))
FT                   /gene="Tmem101"
FT                   /locus_tag="mCG_21351"
FT                   /product="transmembrane protein 101"
FT                   /note="gene_id=mCG21351.1 transcript_id=mCT21548.1 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(768880..769188,770151..770297,
FT                   771318..771498,771802..771938))
FT                   /codon_start=1
FT                   /gene="Tmem101"
FT                   /locus_tag="mCG_21351"
FT                   /product="transmembrane protein 101"
FT                   /note="gene_id=mCG21351.1 transcript_id=mCT21548.1
FT                   protein_id=mCP23563.1"
FT                   /protein_id="EDL34093.1"
FT                   /translation="MASKIGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEAR
FT                   RKPDIPVPYLYFDMGAAVLCASFMSFGVKRRWFALGAALQLAISTYTAYIGGYVHYGDW
FT                   LKVRMYSRTVAIIGGFLVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSK
FT                   EDRLAYLNHLPGGELMVQLFFVLYGVLALAFLSGYYVTLAAQILAVLLPPVMLLIDGNV
FT                   SYWHNTRRVEFWNQMKLLGESVGIFGAAVILATDG"
FT   assembly_gap    773328..773433
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            complement(778160..800984)
FT                   /gene="2600001B17Rik"
FT                   /locus_tag="mCG_21364"
FT                   /note="gene_id=mCG21364.2"
FT   mRNA            complement(join(778160..779819,781012..781138,
FT                   782739..782848,798564..798697,800814..800983))
FT                   /gene="2600001B17Rik"
FT                   /locus_tag="mCG_21364"
FT                   /product="RIKEN cDNA 2600001B17, transcript variant
FT                   mCT22047"
FT                   /note="gene_id=mCG21364.2 transcript_id=mCT22047.2 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(778165..779819,780196..780288,
FT                   781012..781138,782739..782848,798564..798697,
FT                   800814..800984))
FT                   /gene="2600001B17Rik"
FT                   /locus_tag="mCG_21364"
FT                   /product="RIKEN cDNA 2600001B17, transcript variant
FT                   mCT172781"
FT                   /note="gene_id=mCG21364.2 transcript_id=mCT172781.0 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(779727..779819,781012..781138,
FT                   782739..782848,798564..798697,800814..800937))
FT                   /codon_start=1
FT                   /gene="2600001B17Rik"
FT                   /locus_tag="mCG_21364"
FT                   /product="RIKEN cDNA 2600001B17, isoform CRA_b"
FT                   /note="gene_id=mCG21364.2 transcript_id=mCT22047.2
FT                   protein_id=mCP23542.2 isoform=CRA_b"
FT                   /protein_id="EDL34095.1"
FT                   /translation="MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPS
FT                   SSGKPNHADILLINLQYVSEVEIINDRTETPPPLASLNVSKLASKARTEKEEKLSQAYA
FT                   ISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVMEEVVITPPYQVENCKGKEGSALSHVR
FT                   KIVEKHFRDVESQKILQRSQAQQPQKEAALSS"
FT   CDS             complement(join(780262..780288,781012..781138,
FT                   782739..782848,798564..798697,800814..800937))
FT                   /codon_start=1
FT                   /gene="2600001B17Rik"
FT                   /locus_tag="mCG_21364"
FT                   /product="RIKEN cDNA 2600001B17, isoform CRA_a"
FT                   /note="gene_id=mCG21364.2 transcript_id=mCT172781.0
FT                   protein_id=mCP95700.0 isoform=CRA_a"
FT                   /protein_id="EDL34094.1"
FT                   /translation="MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPS
FT                   SSGKPNHADILLINLQYVSEVEIINDRTETPPPLASLNVSKLASKARTEKEEKLSQAYA
FT                   ISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVMEEVVITPPYQVENCKGKEGSALSHVR
FT                   KIIGRRGLKR"
FT   assembly_gap    787015..787034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            805341..809801
FT                   /gene="G6pc3"
FT                   /locus_tag="mCG_21355"
FT                   /note="gene_id=mCG21355.1"
FT   mRNA            join(805341..805376,805595..805867,807752..807858,
FT                   808190..808280,808466..808584,808802..808943,
FT                   809160..809801)
FT                   /gene="G6pc3"
FT                   /locus_tag="mCG_21355"
FT                   /product="glucose 6 phosphatase, catalytic, 3, transcript
FT                   variant mCT22040"
FT                   /note="gene_id=mCG21355.1 transcript_id=mCT22040.1 created
FT                   on 05-SEP-2002"
FT   mRNA            join(805413..805867,807752..807858,808190..808280,
FT                   808466..808584,808802..808943,809160..809796)
FT                   /gene="G6pc3"
FT                   /locus_tag="mCG_21355"
FT                   /product="glucose 6 phosphatase, catalytic, 3, transcript
FT                   variant mCT172780"
FT                   /note="gene_id=mCG21355.1 transcript_id=mCT172780.0 created
FT                   on 05-SEP-2002"
FT   CDS             join(805650..805867,807752..807858,808190..808280,
FT                   808466..808584,808802..808943,809160..809523)
FT                   /codon_start=1
FT                   /gene="G6pc3"
FT                   /locus_tag="mCG_21355"
FT                   /product="glucose 6 phosphatase, catalytic, 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21355.1 transcript_id=mCT172780.0
FT                   protein_id=mCP95699.0 isoform=CRA_a"
FT                   /protein_id="EDL34096.1"
FT                   /translation="MESTLSAGIIMAEALQNRLPGLENMWLWVTFLGDPKNLFQFCFPA
FT                   AYYASRRLGISVLWITFIAEWLNLVFKWFLFGDRPFWWVHESGYSTQTPIQIHQFPSSC
FT                   ETGPGSPSGHCMITGAALWPVMTAISSQVASRSRSPWVRVIPGLAYCTFLLAVGLSRVF
FT                   LLAHFPHQVLGGLIVGAALGWLMSPRVPMERELSFYGLTALALMLGASLMYWTLFTLGL
FT                   DLSWSINLASKWCERPEWVHMDSRPFASLSRDSGSALGLGIALHTPCYAQIRRAHLGNG
FT                   QKIACFVLAMGLLVFLEWLGYPPQISLFYIFNFLKYTLWPCLVLALVPWVVHTLSDQEA
FT                   PPIRSS"
FT   CDS             join(805650..805867,807752..807858,808190..808280,
FT                   808466..808584,808802..808943,809160..809523)
FT                   /codon_start=1
FT                   /gene="G6pc3"
FT                   /locus_tag="mCG_21355"
FT                   /product="glucose 6 phosphatase, catalytic, 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21355.1 transcript_id=mCT22040.1
FT                   protein_id=mCP23580.1 isoform=CRA_a"
FT                   /protein_id="EDL34097.1"
FT                   /translation="MESTLSAGIIMAEALQNRLPGLENMWLWVTFLGDPKNLFQFCFPA
FT                   AYYASRRLGISVLWITFIAEWLNLVFKWFLFGDRPFWWVHESGYSTQTPIQIHQFPSSC
FT                   ETGPGSPSGHCMITGAALWPVMTAISSQVASRSRSPWVRVIPGLAYCTFLLAVGLSRVF
FT                   LLAHFPHQVLGGLIVGAALGWLMSPRVPMERELSFYGLTALALMLGASLMYWTLFTLGL
FT                   DLSWSINLASKWCERPEWVHMDSRPFASLSRDSGSALGLGIALHTPCYAQIRRAHLGNG
FT                   QKIACFVLAMGLLVFLEWLGYPPQISLFYIFNFLKYTLWPCLVLALVPWVVHTLSDQEA
FT                   PPIRSS"
FT   gene            complement(811459..846494)
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /note="gene_id=mCG140723.0"
FT   mRNA            complement(join(811459..811585,811669..811834,
FT                   811955..812039,812256..812389,812776..812894,
FT                   813056..813153,813383..813502,814514..814601,
FT                   814722..814777,815083..815190,815323..815372,
FT                   815656..815776,816087..816220,816920..817091,
FT                   817746..818030,818240..818451,820127..820349,
FT                   820528..820659,820980..821092,821181..821327,
FT                   821486..821616,822118..822232,822326..822470,
FT                   822576..822835,834081..834155,840399..840620,
FT                   846359..846494))
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /product="histone deacetylase 5, transcript variant
FT                   mCT171073"
FT                   /note="gene_id=mCG140723.0 transcript_id=mCT171073.0
FT                   created on 02-APR-2003"
FT   mRNA            complement(join(811466..811585,811665..811834,
FT                   811955..812039,812256..812389,812776..812894,
FT                   813056..813153,813383..813502,814514..814601,
FT                   814722..814777,815083..815190,815323..815372,
FT                   815656..815776,816087..816220,816920..817091,
FT                   817746..818030,818240..818451,820127..820349,
FT                   820528..820659,820980..821092,821181..821327,
FT                   821486..821616,822118..822232,822326..822470,
FT                   822576..822835,834081..834446,834810..834946,
FT                   837433..837516,840399..840620,846359..>846478))
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /product="histone deacetylase 5, transcript variant
FT                   mCT193221"
FT                   /note="gene_id=mCG140723.0 transcript_id=mCT193221.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(811466..811585,811669..811834,
FT                   811955..812039,812256..812389,812776..812894,
FT                   813056..813153,813383..813502,814514..814601,
FT                   814722..814777,815083..815190,815323..815372,
FT                   815656..815776,816087..816220,816920..817091,
FT                   817746..818030,818240..818451,820127..820349,
FT                   820528..820659,820980..821092,821181..821327,
FT                   821486..821616,822118..822232,822326..822470,
FT                   822576..822835,834081..834152,840399..840504))
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /product="histone deacetylase 5, transcript variant
FT                   mCT181660"
FT                   /note="gene_id=mCG140723.0 transcript_id=mCT181660.0
FT                   created on 02-APR-2003"
FT   CDS             complement(join(811546..811585,811669..811834,
FT                   811955..812039,812256..812389,812776..812894,
FT                   813056..813153,813383..813502,814514..814601,
FT                   814722..814777,815083..815190,815323..815372,
FT                   815656..815776,816087..816220,816920..817091,
FT                   817746..818030,818240..818451,820127..820349,
FT                   820528..820659,820980..821092,821181..821327,
FT                   821486..821616,822118..822232,822326..822470,
FT                   822576..822835,834081..834152,840399..840420))
FT                   /codon_start=1
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /product="histone deacetylase 5, isoform CRA_a"
FT                   /note="gene_id=mCG140723.0 transcript_id=mCT181660.0
FT                   protein_id=mCP104582.0 isoform=CRA_a"
FT                   /protein_id="EDL34098.1"
FT                   /translation="MNSPNESDGMSGREPSLEILPRTPLHSIPVAVEVKPVLPGAMPSS
FT                   MGGGGGGSPSPVELRGALAGPMDPALREQQLQQELLVLKQQQQLQKQLLFAEFQKQHDH
FT                   LTRQHEVQLQKHLKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEK
FT                   SKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGP
FT                   PGTPPSYKLPLLGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVI
FT                   STFKKRAVEITGTGPGVSSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMIPQH
FT                   RALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLR
FT                   QGGTLTGKFMSTSSIPGCLLGVALEGDTSPHGHASLLQHVLLLEQARQQSTLIAVPLHG
FT                   QSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQ
FT                   QQMQLGKILTKTGELSRQPTTHPEETEEELTEQQEALLGEGALTIPREGSTESESTQED
FT                   LEEEEEEEEEEEEEDCIQVKDEDGESGPDEGPDLEESSAGYKKLFADAQQLQPLQVYQA
FT                   PLSLATVPHQALGRTQSSPAAPGSMKSPTDQPTVVKHLFTTGVVYDTFMLKHQCMCGNT
FT                   HVHPEHAGRIQSIWSRLQETGLLGKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQ
FT                   KLDSKKLLGPISQKMYAMLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLVELAFKVAAGE
FT                   LKNGFAIIRPPGHHAEESTAMGFCFFNSVAITAKLLQQKLSVGKVLIVDWDIHHGNGTQ
FT                   QAFYNDPSVLYISLHRYDNGNFFPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEY
FT                   LTAFRTVVMPIAQEFSPDVVLVSAGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGG
FT                   RVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVLQQKPSVNAVATLEKVIEIQS
FT                   KHWSCVQRFAAGLGCSLREAQTGEKEEAETVSAMALLSVGAEQAQAVATQEHSPRPAEE
FT                   PMEQEPAL"
FT   CDS             complement(join(811546..811585,811669..811834,
FT                   811955..812039,812256..812389,812776..812894,
FT                   813056..813153,813383..813502,814514..814601,
FT                   814722..814777,815083..815190,815323..815372,
FT                   815656..815776,816087..816220,816920..817091,
FT                   817746..818030,818240..818451,820127..820349,
FT                   820528..820659,820980..821092,821181..821327,
FT                   821486..821616,822118..822232,822326..822470,
FT                   822576..822835,834081..834155,840399..840420))
FT                   /codon_start=1
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /product="histone deacetylase 5, isoform CRA_c"
FT                   /note="gene_id=mCG140723.0 transcript_id=mCT171073.0
FT                   protein_id=mCP93991.0 isoform=CRA_c"
FT                   /protein_id="EDL34100.1"
FT                   /translation="MNSPNESADGMSGREPSLEILPRTPLHSIPVAVEVKPVLPGAMPS
FT                   SMGGGGGGSPSPVELRGALAGPMDPALREQQLQQELLVLKQQQQLQKQLLFAEFQKQHD
FT                   HLTRQHEVQLQKHLKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKE
FT                   KSKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSG
FT                   PPGTPPSYKLPLLGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTV
FT                   ISTFKKRAVEITGTGPGVSSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMIPQ
FT                   HRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSL
FT                   RQGGTLTGKFMSTSSIPGCLLGVALEGDTSPHGHASLLQHVLLLEQARQQSTLIAVPLH
FT                   GQSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQK
FT                   QQQMQLGKILTKTGELSRQPTTHPEETEEELTEQQEALLGEGALTIPREGSTESESTQE
FT                   DLEEEEEEEEEEEEEDCIQVKDEDGESGPDEGPDLEESSAGYKKLFADAQQLQPLQVYQ
FT                   APLSLATVPHQALGRTQSSPAAPGSMKSPTDQPTVVKHLFTTGVVYDTFMLKHQCMCGN
FT                   THVHPEHAGRIQSIWSRLQETGLLGKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNR
FT                   QKLDSKKLLGPISQKMYAMLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLVELAFKVAAG
FT                   ELKNGFAIIRPPGHHAEESTAMGFCFFNSVAITAKLLQQKLSVGKVLIVDWDIHHGNGT
FT                   QQAFYNDPSVLYISLHRYDNGNFFPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVE
FT                   YLTAFRTVVMPIAQEFSPDVVLVSAGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAG
FT                   GRVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVLQQKPSVNAVATLEKVIEIQ
FT                   SKHWSCVQRFAAGLGCSLREAQTGEKEEAETVSAMALLSVGAEQAQAVATQEHSPRPAE
FT                   EPMEQEPAL"
FT   CDS             complement(join(811665..811834,811955..812039,
FT                   812256..812389,812776..812894,813056..813153,
FT                   813383..813502,814514..814601,814722..814777,
FT                   815083..815190,815323..815372,815656..815776,
FT                   816087..816220,816920..817091,817746..818030,
FT                   818240..818451,820127..820349,820528..820659,
FT                   820980..821092,821181..821327,821486..821616,
FT                   822118..822232,822326..822470,822576..822835,
FT                   834081..>834396))
FT                   /codon_start=1
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /product="histone deacetylase 5, isoform CRA_b"
FT                   /note="gene_id=mCG140723.0 transcript_id=mCT193221.0
FT                   protein_id=mCP114210.0 isoform=CRA_b"
FT                   /protein_id="EDL34099.1"
FT                   /translation="PPCVCCLRSAPRPDEVPPCLVGPSGSGLRESLSSQLAPLTTFSLT
FT                   GFRLGRPLPGMLLVPKAQGLVEMLQTIYETESCFSADGMSGREPSLEILPRTPLHSIPV
FT                   AVEVKPVLPGAMPSSMGGGGGGSPSPVELRGALAGPMDPALREQQLQQELLVLKQQQQL
FT                   QKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQQEMLAAKRQQELEQQRQREQQRQEELEK
FT                   QRLEQQLLILRNKEKSKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGA
FT                   HHASLDQSSPPQSGPPGTPPSYKLPLLGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAE
FT                   RRSSPLLRRKDGTVISTFKKRAVEITGTGPGVSSVCNSAPGSGPSSPNSSHSTIAENGF
FT                   TGSVPNIPTEMIPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKL
FT                   STQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDTSPHGHASLLQHVLLLE
FT                   QARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQL
FT                   VMQQQHQQFLEKQKQQQMQLGKILTKTGELSRQPTTHPEETEEELTEQQEALLGEGALT
FT                   IPREGSTESESTQEDLEEEEEEEEEEEEEDCIQVKDEDGESGPDEGPDLEESSAGYKKL
FT                   FADAQQLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGSMKSPTDQPTVVKHLFTTGVV
FT                   YDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQETGLLGKCERIRGRKATLDEIQTVHS
FT                   EYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAMLPCGGIGVDSDTVWNEMHSSSAVRMA
FT                   VGCLVELAFKVAAGELKNGFAIIRPPGHHAEESTAMGFCFFNSVAITAKLLQQKLSVGK
FT                   VLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNFFPGSGAPEEVGGGPGVGYNVNV
FT                   AWTGGVDPPIGDVEYLTAFRTVVMPIAQEFSPDVVLVSAGFDAVEGHLSPLGGYSVTAR
FT                   CFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVLQQKPS
FT                   VNAVATLEKVIEIQSKHWSCVQRFAAGLGCSLREAQTGEKEEAETVSAMALLSVGAEQA
FT                   QAVATQEHSPR"
FT   assembly_gap    815199..815314
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    846214..846233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    860678..860697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <865566..881887
FT                   /gene="BC030867"
FT                   /locus_tag="mCG_122973"
FT                   /note="gene_id=mCG122973.1"
FT   mRNA            join(<865566..865775,867362..867412,871641..872708,
FT                   874574..874657,876006..876146,876520..876628,
FT                   876765..876850,877177..877302,878869..878986,
FT                   880620..880885,881334..881887)
FT                   /gene="BC030867"
FT                   /locus_tag="mCG_122973"
FT                   /product="cDNA sequence BC030867, transcript variant
FT                   mCT193196"
FT                   /note="gene_id=mCG122973.1 transcript_id=mCT193196.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(865583..865775,867362..867412,871641..872708,
FT                   874574..874657,876006..876146,876520..876628,
FT                   876765..876850,877177..877302,878869..878986,
FT                   881334..881887)
FT                   /gene="BC030867"
FT                   /locus_tag="mCG_122973"
FT                   /product="cDNA sequence BC030867, transcript variant
FT                   mCT124199"
FT                   /note="gene_id=mCG122973.1 transcript_id=mCT124199.0
FT                   created on 05-SEP-2002"
FT   CDS             join(<865680..865775,867362..867412,871641..872708,
FT                   874574..874657,876006..876146,876520..876628,
FT                   876765..876850,877177..877302,878869..878986,
FT                   880620..880648)
FT                   /codon_start=1
FT                   /gene="BC030867"
FT                   /locus_tag="mCG_122973"
FT                   /product="cDNA sequence BC030867, isoform CRA_b"
FT                   /note="gene_id=mCG122973.1 transcript_id=mCT193196.0
FT                   protein_id=mCP114140.0 isoform=CRA_b"
FT                   /protein_id="EDL34102.1"
FT                   /translation="FPTLRLGRVGGEPLSLTRPGRPAGPSPRPVVMTCGFQKLFSVEED
FT                   FEDEDFLSALENAENHVVSALPRDAGCLRPVSSRPQETVQTQSSRPVPSYPTSNQSVPR
FT                   LCLPPSSMRENAKAPLSTGVMSLRPASISSSSLSSQQRMTGAKVFQESSGPQPSAAHSG
FT                   YIFESHQQGIGDFEAPDQDDLDKALASMEFEGAGLELEADSGATQILPAKHCEDPVLAK
FT                   KARVADLSGSLRKEPMVHCRNPWPSLRPTSATGSLPVPATSCVSTSQQRGSPAPAPQYL
FT                   PVAGRTIRSSPQNYGPGQPLQSPRAWSSGKPRFSGPQRPHGSSAAFCQGPLSSRAPVSS
FT                   VESPVSTPRNTSTPVTQPALQTPVVTNHLVQLVTATNRTPQQPSRPSIRAKTRRFPGPA
FT                   GLLPHQHSGENLEEIMVSTPQTPTHGALAKFQTEIATSSQGSVEEDFGQGPWLTMKSAL
FT                   GLDEGDPTCFLYTYSIVMVLRKAALKQLPRNKVPNMAVMIKSLTRSTMDASVVFKDPTG
FT                   EMLGTVHRVLLETHQSELRPGSVLLLKQIGVFSPSLRNHYLNVTPNNLVHIYSLDSGDG
FT                   DFLEPPQPLPKDLGNSHGSLQPDVAAEPTRGLRTAQNPAVAFPEEELSEAGGRPAMTPV
FT                   "
FT   CDS             join(865773..865775,867362..867412,871641..872708,
FT                   874574..874657,876006..876146,876520..876628,
FT                   876765..876850,877177..877302,878869..878986,
FT                   881334..881395)
FT                   /codon_start=1
FT                   /gene="BC030867"
FT                   /locus_tag="mCG_122973"
FT                   /product="cDNA sequence BC030867, isoform CRA_a"
FT                   /note="gene_id=mCG122973.1 transcript_id=mCT124199.0
FT                   protein_id=mCP74967.1 isoform=CRA_a"
FT                   /protein_id="EDL34101.1"
FT                   /translation="MTCGFQKLFSVEEDFEDEDFLSALENAENHVVSALPRDAGCLRPV
FT                   SSRPQETVQTQSSRPVPSYPTSNQSVPRLCLPPSSMRENAKAPLSTGVMSLRPASISSS
FT                   SLSSQQRMTGAKVFQESSGPQPSAAHSGYIFESHQQGIGDFEAPDQDDLDKALASMEFE
FT                   GAGLELEADSGATQILPAKHCEDPVLAKKARVADLSGSLRKEPMVHCRNPWPSLRPTSA
FT                   TGSLPVPATSCVSTSQQRGSPAPAPQYLPVAGRTIRSSPQNYGPGQPLQSPRAWSSGKP
FT                   RFSGPQRPHGSSAAFCQGPLSSRAPVSSVESPVSTPRNTSTPVTQPALQTPVVTNHLVQ
FT                   LVTATNRTPQQPSRPSIRAKTRRFPGPAGLLPHQHSGENLEEIMVSTPQTPTHGALAKF
FT                   QTEIATSSQGSVEEDFGQGPWLTMKSALGLDEGDPTCFLYTYSIVMVLRKAALKQLPRN
FT                   KVPNMAVMIKSLTRSTMDASVVFKDPTGEMLGTVHRVLLETHQSELRPGSVLLLKQIGV
FT                   FSPSLRNHYLNVTPNNLVHIYSLDSGDGDFLEPPQPLPKDLGNSHGSLQPDVAAEPTRG
FT                   LRTAQNPAVAFPEEELSEADDLDGLLSELPEDFFCEPSS"
FT   gene            <885521..894809
FT                   /gene="Asb16"
FT                   /locus_tag="mCG_49416"
FT                   /note="gene_id=mCG49416.2"
FT   mRNA            join(<885521..885821,889183..889450,893085..893577,
FT                   893884..893997,894584..894809)
FT                   /gene="Asb16"
FT                   /locus_tag="mCG_49416"
FT                   /product="ankyrin repeat and SOCS box-containing 16"
FT                   /note="gene_id=mCG49416.2 transcript_id=mCT49599.2 created
FT                   on 05-SEP-2002"
FT   CDS             join(885521..885821,889183..889450,893085..893577,
FT                   893884..893997,894584..894769)
FT                   /codon_start=1
FT                   /gene="Asb16"
FT                   /locus_tag="mCG_49416"
FT                   /product="ankyrin repeat and SOCS box-containing 16"
FT                   /note="gene_id=mCG49416.2 transcript_id=mCT49599.2
FT                   protein_id=mCP42946.2"
FT                   /protein_id="EDL34103.1"
FT                   /translation="MAGESFPFTSSTLRALRLQREWLDWEDRRRAAAQQCRRHRDLPCP
FT                   QAQLLRPRRSCRDPAVHNALFSGDLQQLQILFQDEDAANMIVETVSNQLAWSAEQGFWV
FT                   LTPKTKQTAPLTIAVARGYTDCARHLILQGAELDARIGGRAALHEACAQAHPDCVRLLL
FT                   TFGAKANVSSEEGMTPLHLCTSPESLQCAKLLLEAGASVNVASQESEVTPLHVAAARGL
FT                   EQHVALYLQNGADVALRTSQGETALNAACAGAEGPGSSRQHEAAARQLLEAGADPQAAG
FT                   RKRHTPLHNACANGCGGLAELLLRHGASPGVTNGAGHTPMDCALQAVQDAPNWEPEVLF
FT                   AALLDYGAQPVHPEMLKHCANFPRALEVLLNAYPCVPSCDPWVEAVLPELWQEHEAFYS
FT                   SALSMENQPRQLQHLARLAVRAQLGSHCRQAAAQLPLPPLLRDYLLLGVEGRIQ"
FT   assembly_gap    897807..897911
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            901646..905932
FT                   /locus_tag="mCG_21372"
FT                   /note="gene_id=mCG21372.3"
FT   mRNA            join(901646..901787,902363..902417,904005..904568,
FT                   904773..905930)
FT                   /locus_tag="mCG_21372"
FT                   /product="mCG21372, transcript variant mCT22058"
FT                   /note="gene_id=mCG21372.3 transcript_id=mCT22058.2 created
FT                   on 05-SEP-2002"
FT   mRNA            join(<901684..901787,904005..904568,904773..905932)
FT                   /locus_tag="mCG_21372"
FT                   /product="mCG21372, transcript variant mCT193207"
FT                   /note="gene_id=mCG21372.3 transcript_id=mCT193207.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<901684..901787,904005..904568,904773..905133)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21372"
FT                   /product="mCG21372, isoform CRA_b"
FT                   /note="gene_id=mCG21372.3 transcript_id=mCT193207.0
FT                   protein_id=mCP114168.0 isoform=CRA_b"
FT                   /protein_id="EDL34105.1"
FT                   /translation="PGQNPELPAPPLTPTERELQRLSWRSQNIYPGFVSVDPVSSQAME
FT                   LSDVTLIEGVGNEVMVVAGVVALTLALVLAWLSTYVADSGNNQLLGTIVSAGDTSVLHL
FT                   GHVDQLVNQGTPEPTEHPHPSGGNDDKAEETSDSGGDATGEPGARGEMEPSLEHLLDIQ
FT                   GLPKRQAGLGSSRPEAPLGLDDGSCLSPSPSLINVRLKFLNDTEELAVARPEDTVGTLK
FT                   SKYFPGQENQMKLIYQGRLLQDPARTLSSLNITNNCVIHCHRSPPGAAVSGPSASLTPT
FT                   TEQSSLGVNVGSLMVPVFVVLLGVVWYFRINYRQFFTGPATISLVGVTVFFSILVFGMY
FT                   GR"
FT   mRNA            join(901713..902417,904005..904568,904773..905882)
FT                   /locus_tag="mCG_21372"
FT                   /product="mCG21372, transcript variant mCT172785"
FT                   /note="gene_id=mCG21372.3 transcript_id=mCT172785.0 created
FT                   on 05-SEP-2002"
FT   CDS             join(902383..902417,904005..904568,904773..905133)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21372"
FT                   /product="mCG21372, isoform CRA_a"
FT                   /note="gene_id=mCG21372.3 transcript_id=mCT172785.0
FT                   protein_id=mCP95704.0 isoform=CRA_a"
FT                   /protein_id="EDL34104.1"
FT                   /translation="MISRLLQNNLMSVDPVSSQAMELSDVTLIEGVGNEVMVVAGVVAL
FT                   TLALVLAWLSTYVADSGNNQLLGTIVSAGDTSVLHLGHVDQLVNQGTPEPTEHPHPSGG
FT                   NDDKAEETSDSGGDATGEPGARGEMEPSLEHLLDIQGLPKRQAGLGSSRPEAPLGLDDG
FT                   SCLSPSPSLINVRLKFLNDTEELAVARPEDTVGTLKSKYFPGQENQMKLIYQGRLLQDP
FT                   ARTLSSLNITNNCVIHCHRSPPGAAVSGPSASLTPTTEQSSLGVNVGSLMVPVFVVLLG
FT                   VVWYFRINYRQFFTGPATISLVGVTVFFSILVFGMYGR"
FT   CDS             join(902383..902417,904005..904568,904773..905133)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21372"
FT                   /product="mCG21372, isoform CRA_a"
FT                   /note="gene_id=mCG21372.3 transcript_id=mCT22058.2
FT                   protein_id=mCP23453.2 isoform=CRA_a"
FT                   /protein_id="EDL34106.1"
FT                   /translation="MISRLLQNNLMSVDPVSSQAMELSDVTLIEGVGNEVMVVAGVVAL
FT                   TLALVLAWLSTYVADSGNNQLLGTIVSAGDTSVLHLGHVDQLVNQGTPEPTEHPHPSGG
FT                   NDDKAEETSDSGGDATGEPGARGEMEPSLEHLLDIQGLPKRQAGLGSSRPEAPLGLDDG
FT                   SCLSPSPSLINVRLKFLNDTEELAVARPEDTVGTLKSKYFPGQENQMKLIYQGRLLQDP
FT                   ARTLSSLNITNNCVIHCHRSPPGAAVSGPSASLTPTTEQSSLGVNVGSLMVPVFVVLLG
FT                   VVWYFRINYRQFFTGPATISLVGVTVFFSILVFGMYGR"
FT   gene            complement(907157..911762)
FT                   /locus_tag="mCG_21369"
FT                   /note="gene_id=mCG21369.2"
FT   mRNA            complement(join(907157..908500,908595..908752,
FT                   908833..908904,909139..909182,909402..909470,
FT                   909764..909792,909973..910018,910343..910365,
FT                   910541..910638,910831..911002,911207..911339,
FT                   911646..911762))
FT                   /locus_tag="mCG_21369"
FT                   /product="mCG21369, transcript variant mCT172784"
FT                   /note="gene_id=mCG21369.2 transcript_id=mCT172784.0 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(907157..908500,908595..908752,
FT                   908833..908904,909139..909182,909402..909470,
FT                   909764..909849,909973..910018,910343..910365,
FT                   910541..910638,910831..911002,911207..911339,
FT                   911646..911760))
FT                   /locus_tag="mCG_21369"
FT                   /product="mCG21369, transcript variant mCT172783"
FT                   /note="gene_id=mCG21369.2 transcript_id=mCT172783.0 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(907157..908500,908595..908752,
FT                   908833..908904,909139..909182,909402..909470,
FT                   909764..909792,909973..910039,910343..910365,
FT                   910541..910638,910831..911002,911207..911339,
FT                   911646..911756))
FT                   /locus_tag="mCG_21369"
FT                   /product="mCG21369, transcript variant mCT22054"
FT                   /note="gene_id=mCG21369.2 transcript_id=mCT22054.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(908352..908500,908595..908752,
FT                   908833..908904,909139..909182,909402..909470,
FT                   909764..909792,909973..910018,910343..910365,
FT                   910541..910638,910831..911002,911207..911339,
FT                   911646..911696))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21369"
FT                   /product="mCG21369, isoform CRA_a"
FT                   /note="gene_id=mCG21369.2 transcript_id=mCT172784.0
FT                   protein_id=mCP95702.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AWT3"
FT                   /db_xref="InterPro:IPR013243"
FT                   /db_xref="InterPro:IPR013246"
FT                   /db_xref="MGI:MGI:3036270"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2AWT3"
FT                   /protein_id="EDL34107.1"
FT                   /translation="MKMEEMSLSGLDNSKLEAIAQEIYADLVEDSCLGFCFEVHRAVKC
FT                   GYFFLDDTDPDSMKDFEIVDQPGLDIFGQVFNQWKSKECVCPNCSRSIAASRFAPHLEK
FT                   CLGMGRNSSRIANRRIANSNNMNKSESDQEDNDDINDNDWSYGSEKKAKKRKSDKNPNS
FT                   PRRSKSLKHKNGELSNSDPFKYSNSTGISYETLGPEELRSLLTTQCGVISEHTKKMCTR
FT                   SLRCPQHTDEQRRTVRIYFLGPSAVLPEVESSLDNDGFDMTDSQALISRLQWDGSSDLS
FT                   PSDSGSSKTSENQGWGLGTNSSESRKTKKKKSHLSLVGTASGLGSNKKKKPKPPAPPTP
FT                   SIYDDIN"
FT   CDS             complement(join(908352..908500,908595..908752,
FT                   908833..908904,909139..909182,909402..909470,
FT                   909764..909849,909973..910018,910343..910365,
FT                   910541..910638,910831..911002,911207..911339,
FT                   911646..911696))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21369"
FT                   /product="mCG21369, isoform CRA_b"
FT                   /note="gene_id=mCG21369.2 transcript_id=mCT172783.0
FT                   protein_id=mCP95703.0 isoform=CRA_b"
FT                   /protein_id="EDL34108.1"
FT                   /translation="MKMEEMSLSGLDNSKLEAIAQEIYADLVEDSCLGFCFEVHRAVKC
FT                   GYFFLDDTDPDSMKDFEIVDQPGLDIFGQVFNQWKSKECVCPNCSRSIAASRFAPHLEK
FT                   CLGMGRNSSRIANRRIANSNNMNKSESDQEDNDDINDNDWSYGSEKKAKKRKSDKNPNS
FT                   PRRSKSLKHKNGFSVCTSASNTLPLLFSSSGELSNSDPFKYSNSTGISYETLGPEELRS
FT                   LLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSAVLPEVESSLDNDGFDM
FT                   TDSQALISRLQWDGSSDLSPSDSGSSKTSENQGWGLGTNSSESRKTKKKKSHLSLVGTA
FT                   SGLGSNKKKKPKPPAPPTPSIYDDIN"
FT   CDS             complement(join(908352..908500,908595..908752,
FT                   908833..908904,909139..909182,909402..909470,
FT                   909764..909792,909973..910039,910343..910365,
FT                   910541..910638,910831..911002,911207..911339,
FT                   911646..911696))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21369"
FT                   /product="mCG21369, isoform CRA_c"
FT                   /note="gene_id=mCG21369.2 transcript_id=mCT22054.2
FT                   protein_id=mCP23404.2 isoform=CRA_c"
FT                   /protein_id="EDL34109.1"
FT                   /translation="MKMEEMSLSGLDNSKLEAIAQEIYADLVEDSCLGFCFEVHRAVKC
FT                   GYFFLDDTDPDSMKDFEIVDQPGLDIFGQVFNQWKSKECVCPNCSRSIAASRFAPHLEK
FT                   CLGMGRNSSRIANRRIANSNNMNKSESDQEDNDDINDNDWSYGSEKKAKKRKSDKLWYL
FT                   PFQNPNSPRRSKSLKHKNGELSNSDPFKYSNSTGISYETLGPEELRSLLTTQCGVISEH
FT                   TKKMCTRSLRCPQHTDEQRRTVRIYFLGPSAVLPEVESSLDNDGFDMTDSQALISRLQW
FT                   DGSSDLSPSDSGSSKTSENQGWGLGTNSSESRKTKKKKSHLSLVGTASGLGSNKKKKPK
FT                   PPAPPTPSIYDDIN"
FT   assembly_gap    913034..913804
FT                   /estimated_length=771
FT                   /gap_type="unknown"
FT   gene            921519..922029
FT                   /locus_tag="mCG_1042023"
FT                   /note="gene_id=mCG1042023.0"
FT   mRNA            join(921519..921953,921985..922029)
FT                   /locus_tag="mCG_1042023"
FT                   /product="mCG1042023"
FT                   /note="gene_id=mCG1042023.0 transcript_id=mCT159727.0
FT                   created on 05-SEP-2002"
FT   CDS             921798..921908
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042023"
FT                   /product="mCG1042023"
FT                   /note="gene_id=mCG1042023.0 transcript_id=mCT159727.0
FT                   protein_id=mCP74974.1"
FT                   /protein_id="EDL34110.1"
FT                   /translation="MSCSKLFLSENAFHSSVTVQGVQTRRWSSLQALSGT"
FT   assembly_gap    921957..921976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(922771..936002)
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /note="gene_id=mCG140722.0"
FT   mRNA            complement(join(922771..923760,923852..923995,
FT                   924075..924146,924240..924287,924945..925134,
FT                   925225..925313,925691..925801,925886..926041,
FT                   926389..926544,926646..926759,926860..926901,
FT                   927183..927324,927435..927568,928364..928484,
FT                   928738..928802,930882..931037,931123..931206,
FT                   931848..932023,933333..933457,935772..936002))
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /product="upstream binding transcription factor, RNA
FT                   polymerase I, transcript variant mCT171074"
FT                   /note="gene_id=mCG140722.0 transcript_id=mCT171074.0
FT                   created on 02-APR-2003"
FT   mRNA            complement(join(922771..923760,923852..923995,
FT                   924075..924146,924240..924287,924945..925134,
FT                   925225..925313,925691..925801,925886..926041,
FT                   926389..926544,926646..926759,926860..926901,
FT                   927183..927324,927435..927568,927918..928028,
FT                   928364..928484,928738..928802,930882..931037,
FT                   931123..931206,931848..932023,933333..933391,
FT                   933410..933458))
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /product="upstream binding transcription factor, RNA
FT                   polymerase I, transcript variant mCT171075"
FT                   /note="gene_id=mCG140722.0 transcript_id=mCT171075.0
FT                   created on 02-APR-2003"
FT   mRNA            complement(join(922990..923760,923852..923995,
FT                   924079..924146,924240..924287,924945..925134,
FT                   925225..925313,925691..925801,925886..926041,
FT                   926389..926544,926646..926759,926860..926901,
FT                   927183..927324,927435..927568,928364..928484,
FT                   928738..928802,930882..931037,931123..931206,
FT                   931848..932023,933333..933457,935772..935887))
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /product="upstream binding transcription factor, RNA
FT                   polymerase I, transcript variant mCT181661"
FT                   /note="gene_id=mCG140722.0 transcript_id=mCT181661.0
FT                   created on 02-APR-2003"
FT   CDS             complement(join(923556..923760,923852..923995,
FT                   924079..924146,924240..924287,924945..925134,
FT                   925225..925313,925691..925801,925886..926041,
FT                   926389..926544,926646..926759,926860..926901,
FT                   927183..927324,927435..927568,928364..928484,
FT                   928738..928802,930882..931037,931123..931206,
FT                   931848..932023,933333..933390))
FT                   /codon_start=1
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /product="upstream binding transcription factor, RNA
FT                   polymerase I, isoform CRA_b"
FT                   /note="gene_id=mCG140722.0 transcript_id=mCT181661.0
FT                   protein_id=mCP104583.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR029215"
FT                   /db_xref="MGI:MGI:98512"
FT                   /db_xref="UniProtKB/TrEMBL:A2AWT7"
FT                   /protein_id="EDL34112.1"
FT                   /translation="MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSK
FT                   FKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKK
FT                   LKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQ
FT                   DFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDEI
FT                   MRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKD
FT                   VPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEE
FT                   KMLNINKKQTTSPASKKPSQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESE
FT                   LTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREDRGKLPESPKRAEEIWQQS
FT                   VIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAA
FT                   TNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKE
FT                   HYKKLAEEQQRQYKVHLDLWVKSLSPQDRAAYKEYISNKRKNMTKLRGPNPKSSRTTLQ
FT                   SKSPRRMTMRRRRTTRRRRKRKMMRTVTLLRMAGTLLSPAVKMKARMGMRMMMTTTMKM
FT                   TKMTTMRMKTTSLRAVAPALHPQGTLRILTPTEAQPPPQAGRQAGSQGESPCRAHLPN"
FT   CDS             complement(join(923635..923760,923852..923995,
FT                   924075..924146,924240..924287,924945..925134,
FT                   925225..925313,925691..925801,925886..926041,
FT                   926389..926544,926646..926759,926860..926901,
FT                   927183..927324,927435..927568,928364..928484,
FT                   928738..928802,930882..931037,931123..931206,
FT                   931848..932023,933333..933390))
FT                   /codon_start=1
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /product="upstream binding transcription factor, RNA
FT                   polymerase I, isoform CRA_a"
FT                   /note="gene_id=mCG140722.0 transcript_id=mCT171074.0
FT                   protein_id=mCP93993.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR029215"
FT                   /db_xref="MGI:MGI:98512"
FT                   /db_xref="UniProtKB/TrEMBL:A2AWT6"
FT                   /protein_id="EDL34111.1"
FT                   /translation="MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSK
FT                   FKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKK
FT                   LKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQ
FT                   DFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDEI
FT                   MRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKD
FT                   VPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEE
FT                   KMLNINKKQTTSPASKKPSQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESE
FT                   LTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREDRGKLPESPKRAEEIWQQS
FT                   VIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAA
FT                   TNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKE
FT                   HYKKLAEEQQRQYKVHLDLWVKSLSPQDRAAYKEYISNKRKNMTKLRGPNPKSSRTTLQ
FT                   SKSESEEDDDEEEEDDEEEEEEEDDENGDSSEDGGDSSESSSEDESEDGDENDDDDDDE
FT                   DDEDDDDEDEDNESEGSSSSSSSSGDSSDSDSN"
FT   CDS             complement(join(923635..923760,923852..923995,
FT                   924075..924146,924240..924287,924945..925134,
FT                   925225..925313,925691..925801,925886..926041,
FT                   926389..926544,926646..926759,926860..926901,
FT                   927183..927324,927435..927568,927918..928028,
FT                   928364..928484,928738..928802,930882..931037,
FT                   931123..931206,931848..932023,933333..933390))
FT                   /codon_start=1
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /product="upstream binding transcription factor, RNA
FT                   polymerase I, isoform CRA_c"
FT                   /note="gene_id=mCG140722.0 transcript_id=mCT171075.0
FT                   protein_id=mCP93992.0 isoform=CRA_c"
FT                   /db_xref="GOA:A2AWT5"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR029215"
FT                   /db_xref="MGI:MGI:98512"
FT                   /db_xref="UniProtKB/TrEMBL:A2AWT5"
FT                   /protein_id="EDL34113.1"
FT                   /translation="MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSK
FT                   FKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKK
FT                   LKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQ
FT                   DFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDAT
FT                   TKEVKDSLGKQWSQLSDKKRLKWIHKALEQRKEYEEIMRDYIQKHPELNISEEGITKST
FT                   LTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQKEK
FT                   DAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQTTSPASKKPSQEG
FT                   GKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKA
FT                   REAALKAQSERKPGGEREDRGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEM
FT                   TWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQ
FT                   KFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQRQYKVHLDLWVK
FT                   SLSPQDRAAYKEYISNKRKNMTKLRGPNPKSSRTTLQSKSESEEDDDEEEEDDEEEEEE
FT                   EDDENGDSSEDGGDSSESSSEDESEDGDENDDDDDDEDDEDDDDEDEDNESEGSSSSSS
FT                   SSGDSSDSDSN"
FT   assembly_gap    928071..928109
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    934773..935650
FT                   /estimated_length=878
FT                   /gap_type="unknown"
FT   assembly_gap    942785..943386
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   assembly_gap    949343..949362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    952671..952781
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    954454..954473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    960948..966170
FT                   /estimated_length=5223
FT                   /gap_type="unknown"
FT   gene            complement(968039..984492)
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /note="gene_id=mCG21367.2"
FT   mRNA            complement(join(968039..969582,970317..970490,
FT                   970572..970741,971654..971907,972406..972572,
FT                   973039..973128,973481..973651,975295..975489,
FT                   975598..975746,975935..976147,976259..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980681,984275..984492))
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, transcript variant mCT22052"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT22052.2 created
FT                   on 16-JUL-2002"
FT   mRNA            complement(join(968043..969582,970317..970490,
FT                   970572..970741,971654..971907,972406..972572,
FT                   973039..973128,973481..973651,975295..975489,
FT                   975598..975746,975935..976147,976259..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980681,981844..981917,
FT                   984275..984355))
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, transcript variant mCT170732"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT170732.0 created
FT                   on 16-JUL-2002"
FT   mRNA            complement(join(968043..969582,970317..970490,
FT                   970572..970741,971654..971907,972406..972572,
FT                   973039..973128,973481..973651,975295..975489,
FT                   975598..975746,975935..976147,976259..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980681,982179..982231,
FT                   982883..982924))
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, transcript variant mCT170733"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT170733.0 created
FT                   on 16-JUL-2002"
FT   mRNA            complement(join(<968044..968123,976389..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980681,984275..984329))
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, transcript variant mCT170731"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT170731.0 created
FT                   on 16-JUL-2002"
FT   CDS             complement(join(<968044..968123,976389..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980613))
FT                   /codon_start=1
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT170731.0
FT                   protein_id=mCP93651.0 isoform=CRA_a"
FT                   /protein_id="EDL34114.1"
FT                   /translation="MGDMRDHEEVLEIPDRDSEEELENIIGQIAYRDLTIPVTEMQDPE
FT                   ALPTEQTATDYVPSSTSTPHPSSGQVYVELQELMMDQRNQELQWVEAAHWIGLEENLRE
FT                   DGVWGRPHLSYLTFWSLLELQKVFSKGTFLLGLAETSLAGVANHLLDCFIYEDQIRPQD
FT                   REELLRALLLKRSHAEDLGNLEGVKPAVLTRSGGASEPLLPHQPSLETQLYCGQAEGGS
FT                   EGPSTSGTLKIPPDSETTLVLVGRANFLEKPVLGFVRLKEAVPLEDLVLPEPVGFLLVL
FT                   LGPEAPHVDYTQLGRAAATLMTERVFRITASMAHNREELLRSLESFLDCSLGSCRPLCQ
FT                   RSSPPLCLGIGFANKRVCV"
FT   CDS             complement(join(969502..969582,970317..970490,
FT                   970572..970741,971654..971907,972406..972572,
FT                   973039..973128,973481..973651,975295..975489,
FT                   975598..975746,975935..976147,976259..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980613))
FT                   /codon_start=1
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT170732.0
FT                   protein_id=mCP93650.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q53ZN9"
FT                   /db_xref="InterPro:IPR001717"
FT                   /db_xref="InterPro:IPR002977"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="InterPro:IPR013769"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR018241"
FT                   /db_xref="MGI:MGI:109393"
FT                   /db_xref="UniProtKB/TrEMBL:Q53ZN9"
FT                   /protein_id="EDL34115.1"
FT                   /translation="MGDMRDHEEVLEIPDRDSEEELENIIGQIAYRDLTIPVTEMQDPE
FT                   ALPTEQTATDYVPSSTSTPHPSSGQVYVELQELMMDQRNQELQWVEAAHWIGLEENLRE
FT                   DGVWGRPHLSYLTFWSLLELQKVFSKGTFLLGLAETSLAGVANHLLDCFIYEDQIRPQD
FT                   REELLRALLLKRSHAEDLGNLEGVKPAVLTRSGGASEPLLPHQPSLETQLYCGQAEGGS
FT                   EGPSTSGTLKIPPDSETTLVLVGRANFLEKPVLGFVRLKEAVPLEDLVLPEPVGFLLVL
FT                   LGPEAPHVDYTQLGRAAATLMTERVFRITASMAHNREELLRSLESFLDCSLVLPPTDAP
FT                   SEKALLNLVPVQKELLRRRYLPSPAKPDPNLYNTLDLNGGKGGPGDEDDPLRRTGRIFG
FT                   GLIRDIRRRYPYYLSDITDALSPQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSE
FT                   LLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLI
FT                   LLVMLVVAFEGSFLVQYISRYTQEIFSFLISLIFIYETFSKLIKIFQDYPLQQTYAPVV
FT                   MKPKPQGPVPNTALFSLVLMAGTFLLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIM
FT                   VLVDSFIKGTYTQKLSVPDGLKVSNSSARGWVIHPLGLYRLFPTWMMFASVLPALLVFI
FT                   LIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHA
FT                   NALTVMGKASGPGAAAQIQEVKEQRISGLLVSVLVGLSILMEPILSRIPLAVLFGIFLY
FT                   MGVTSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRMHLFTGIQIICLAVLWVVKST
FT                   PASLALPFVLILTVPLRRLILPLIFRELELQCLDGDDAKVTFDEENGLDEYDEVPMPV"
FT   CDS             complement(join(969502..969582,970317..970490,
FT                   970572..970741,971654..971907,972406..972572,
FT                   973039..973128,973481..973651,975295..975489,
FT                   975598..975746,975935..976147,976259..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980613))
FT                   /codon_start=1
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT170733.0
FT                   protein_id=mCP93649.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q53ZN9"
FT                   /db_xref="InterPro:IPR001717"
FT                   /db_xref="InterPro:IPR002977"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="InterPro:IPR013769"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR018241"
FT                   /db_xref="MGI:MGI:109393"
FT                   /db_xref="UniProtKB/TrEMBL:Q53ZN9"
FT                   /protein_id="EDL34116.1"
FT                   /translation="MGDMRDHEEVLEIPDRDSEEELENIIGQIAYRDLTIPVTEMQDPE
FT                   ALPTEQTATDYVPSSTSTPHPSSGQVYVELQELMMDQRNQELQWVEAAHWIGLEENLRE
FT                   DGVWGRPHLSYLTFWSLLELQKVFSKGTFLLGLAETSLAGVANHLLDCFIYEDQIRPQD
FT                   REELLRALLLKRSHAEDLGNLEGVKPAVLTRSGGASEPLLPHQPSLETQLYCGQAEGGS
FT                   EGPSTSGTLKIPPDSETTLVLVGRANFLEKPVLGFVRLKEAVPLEDLVLPEPVGFLLVL
FT                   LGPEAPHVDYTQLGRAAATLMTERVFRITASMAHNREELLRSLESFLDCSLVLPPTDAP
FT                   SEKALLNLVPVQKELLRRRYLPSPAKPDPNLYNTLDLNGGKGGPGDEDDPLRRTGRIFG
FT                   GLIRDIRRRYPYYLSDITDALSPQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSE
FT                   LLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLI
FT                   LLVMLVVAFEGSFLVQYISRYTQEIFSFLISLIFIYETFSKLIKIFQDYPLQQTYAPVV
FT                   MKPKPQGPVPNTALFSLVLMAGTFLLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIM
FT                   VLVDSFIKGTYTQKLSVPDGLKVSNSSARGWVIHPLGLYRLFPTWMMFASVLPALLVFI
FT                   LIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHA
FT                   NALTVMGKASGPGAAAQIQEVKEQRISGLLVSVLVGLSILMEPILSRIPLAVLFGIFLY
FT                   MGVTSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRMHLFTGIQIICLAVLWVVKST
FT                   PASLALPFVLILTVPLRRLILPLIFRELELQCLDGDDAKVTFDEENGLDEYDEVPMPV"
FT   CDS             complement(join(969502..969582,970317..970490,
FT                   970572..970741,971654..971907,972406..972572,
FT                   973039..973128,973481..973651,975295..975489,
FT                   975598..975746,975935..976147,976259..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980613))
FT                   /codon_start=1
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT22052.2
FT                   protein_id=mCP23490.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q53ZN9"
FT                   /db_xref="InterPro:IPR001717"
FT                   /db_xref="InterPro:IPR002977"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="InterPro:IPR013769"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR018241"
FT                   /db_xref="MGI:MGI:109393"
FT                   /db_xref="UniProtKB/TrEMBL:Q53ZN9"
FT                   /protein_id="EDL34117.1"
FT                   /translation="MGDMRDHEEVLEIPDRDSEEELENIIGQIAYRDLTIPVTEMQDPE
FT                   ALPTEQTATDYVPSSTSTPHPSSGQVYVELQELMMDQRNQELQWVEAAHWIGLEENLRE
FT                   DGVWGRPHLSYLTFWSLLELQKVFSKGTFLLGLAETSLAGVANHLLDCFIYEDQIRPQD
FT                   REELLRALLLKRSHAEDLGNLEGVKPAVLTRSGGASEPLLPHQPSLETQLYCGQAEGGS
FT                   EGPSTSGTLKIPPDSETTLVLVGRANFLEKPVLGFVRLKEAVPLEDLVLPEPVGFLLVL
FT                   LGPEAPHVDYTQLGRAAATLMTERVFRITASMAHNREELLRSLESFLDCSLVLPPTDAP
FT                   SEKALLNLVPVQKELLRRRYLPSPAKPDPNLYNTLDLNGGKGGPGDEDDPLRRTGRIFG
FT                   GLIRDIRRRYPYYLSDITDALSPQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSE
FT                   LLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLI
FT                   LLVMLVVAFEGSFLVQYISRYTQEIFSFLISLIFIYETFSKLIKIFQDYPLQQTYAPVV
FT                   MKPKPQGPVPNTALFSLVLMAGTFLLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIM
FT                   VLVDSFIKGTYTQKLSVPDGLKVSNSSARGWVIHPLGLYRLFPTWMMFASVLPALLVFI
FT                   LIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHA
FT                   NALTVMGKASGPGAAAQIQEVKEQRISGLLVSVLVGLSILMEPILSRIPLAVLFGIFLY
FT                   MGVTSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRMHLFTGIQIICLAVLWVVKST
FT                   PASLALPFVLILTVPLRRLILPLIFRELELQCLDGDDAKVTFDEENGLDEYDEVPMPV"
FT   assembly_gap    1008029..1009002
FT                   /estimated_length=974
FT                   /gap_type="unknown"
FT   assembly_gap    1009845..1010631
FT                   /estimated_length=787
FT                   /gap_type="unknown"
FT   gene            1012686..1021755
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /note="gene_id=mCG21347.2"
FT   mRNA            join(1012686..1012984,1016773..1016888,1017287..1017435,
FT                   1017579..1017664,1018397..1018486,1018585..1018665,
FT                   1018817..1018982,1019090..1019247,1019863..1020000,
FT                   1020096..1020202,1021183..1021755)
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, transcript variant
FT                   mCT21544"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT21544.2 created
FT                   on 17-JUL-2002"
FT   mRNA            join(1012686..1012984,1016773..1016888,1017287..1017435,
FT                   1017579..1017664,1018397..1018486,1018585..1018665,
FT                   1018817..1018982,1019090..1019247,1020096..1020202,
FT                   1021183..1021755)
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, transcript variant
FT                   mCT170717"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT170717.0 created
FT                   on 17-JUL-2002"
FT   mRNA            join(<1012705..1012984,1016773..1016888,1017287..1017435,
FT                   1017579..1017664,1018397..1018486,1018585..1018665,
FT                   1018817..1018982,1019090..1019247,1019839..1020000,
FT                   1020096..1020202,1020591..1020954)
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, transcript variant
FT                   mCT193236"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT193236.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1012764..1012984,1016773..1016888,1017287..1017435,
FT                   1017579..1017664,1018397..1018486,1018585..1018665,
FT                   1018817..1018982,1019090..1019247,1019839..1020000,
FT                   1020096..1020202,1020591..1020610)
FT                   /codon_start=1
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, isoform CRA_b"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT193236.0
FT                   protein_id=mCP114227.0 isoform=CRA_b"
FT                   /protein_id="EDL34119.1"
FT                   /translation="RRRRAPGGRRPSRDPARRAGAPGGVGGSGRRQQWPHIWMEASFVQ
FT                   TTMALGLPSKKASSRNVIVERRNLITVCRFSVKTLLEKYTAEPIDDSSEEFVNFAAILE
FT                   QILSHRFKACAPAGPASWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAKG
FT                   RAWIRVALMEKRMSEYITTALRDNRTTRRFYDSGAIMLREEATVLTGMLIGLSAIDFSF
FT                   CLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTD
FT                   EDSWYNKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQR
FT                   EKRELEGVILELQEQLPDPPPPPRTGLIPGDHAPLAQGSKELTTSLVNQWPSLSTLHRP
FT                   EGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLGEAKRDEEPWGPIGSSEPN"
FT   CDS             join(1012878..1012984,1016773..1016888,1017287..1017435,
FT                   1017579..1017664,1018397..1018486,1018585..1018665,
FT                   1018817..1018982,1019090..1019247,1019863..1020000,
FT                   1020096..1020202,1021183..1021325)
FT                   /codon_start=1
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, isoform CRA_c"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT21544.2
FT                   protein_id=mCP23512.2 isoform=CRA_c"
FT                   /protein_id="EDL34120.1"
FT                   /translation="MEASFVQTTMALGLPSKKASSRNVIVERRNLITVCRFSVKTLLEK
FT                   YTAEPIDDSSEEFVNFAAILEQILSHRFKACAPAGPASWFSSDGQRGFWDYIRLACSKV
FT                   PNNCVSSIENMENISTARAKGRAWIRVALMEKRMSEYITTALRDNRTTRRFYDSGAIML
FT                   REEATVLTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHS
FT                   AESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYAQKGYLEELVRLRESQLKD
FT                   LEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPGDHAPLAQGSKELTTSL
FT                   VNQWPSLSTLHRPEGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLGEAKRDEEPWGPI
FT                   GKDPTPSMLGLCGSLASIPSCKSLASFKSNECLVSDSPEGSPALSPS"
FT   CDS             join(1012878..1012984,1016773..1016888,1017287..1017435,
FT                   1017579..1017664,1018397..1018486,1018585..1018665,
FT                   1018817..1018982,1019090..1019247,1020096..1020202,
FT                   1021183..1021325)
FT                   /codon_start=1
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, isoform CRA_d"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT170717.0
FT                   protein_id=mCP93636.0 isoform=CRA_d"
FT                   /protein_id="EDL34121.1"
FT                   /translation="MEASFVQTTMALGLPSKKASSRNVIVERRNLITVCRFSVKTLLEK
FT                   YTAEPIDDSSEEFVNFAAILEQILSHRFKACAPAGPASWFSSDGQRGFWDYIRLACSKV
FT                   PNNCVSSIENMENISTARAKGRAWIRVALMEKRMSEYITTALRDNRTTRRFYDSGAIML
FT                   REEATVLTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHS
FT                   AESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYAQKGYLEELVRLRESQLKD
FT                   LEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLHSFMSTEPLSAEASLSSDSQRL
FT                   GEAKRDEEPWGPIGKDPTPSMLGLCGSLASIPSCKSLASFKSNECLVSDSPEGSPALSP
FT                   S"
FT   mRNA            join(<1017066..1017435,1017579..1017664,1018397..1018486,
FT                   1018585..1018665,1018817..1018982,1019090..1019247,
FT                   1019863..1020000,1020096..1020202,1021183..1021755)
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, transcript variant
FT                   mCT170718"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT170718.0 created
FT                   on 17-JUL-2002"
FT   CDS             join(<1017205..1017435,1017579..1017664,1018397..1018486,
FT                   1018585..1018665,1018817..1018982,1019090..1019247,
FT                   1019863..1020000,1020096..1020202,1021183..1021325)
FT                   /codon_start=1
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, isoform CRA_a"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT170718.0
FT                   protein_id=mCP93635.0 isoform=CRA_a"
FT                   /protein_id="EDL34118.1"
FT                   /translation="AYACKCFVTWTFSKLPGIAESPPCPGSACAPAGPASWFSSDGQRG
FT                   FWDYIRLACSKVPNNCVSSIENMENISTARAKGRAWIRVALMEKRMSEYITTALRDNRT
FT                   TRRFYDSGAIMLREEATVLTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQS
FT                   YDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYAQKGYLE
FT                   ELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPGDHAP
FT                   LAQGSKELTTSLVNQWPSLSTLHRPEGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLG
FT                   EAKRDEEPWGPIGKDPTPSMLGLCGSLASIPSCKSLASFKSNECLVSDSPEGSPALSPS
FT                   "
FT   mRNA            join(1018368..1018486,1018585..1018665,1018817..1018982,
FT                   1019090..1019247,1019863..1020000,1020096..1020202,
FT                   1021183..1021755)
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, transcript variant
FT                   mCT170719"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT170719.0 created
FT                   on 17-JUL-2002"
FT   CDS             join(1018422..1018486,1018585..1018665,1018817..1018982,
FT                   1019090..1019247,1019863..1020000,1020096..1020202,
FT                   1021183..1021325)
FT                   /codon_start=1
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, isoform CRA_e"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT170719.0
FT                   protein_id=mCP93637.0 isoform=CRA_e"
FT                   /protein_id="EDL34122.1"
FT                   /translation="MLREEATVLTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLK
FT                   FTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYAQK
FT                   GYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPG
FT                   DHAPLAQGSKELTTSLVNQWPSLSTLHRPEGASNSKLYRRHSFMSTEPLSAEASLSSDS
FT                   QRLGEAKRDEEPWGPIGKDPTPSMLGLCGSLASIPSCKSLASFKSNECLVSDSPEGSPA
FT                   LSPS"
FT   gene            complement(1021012..1027139)
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /note="gene_id=mCG21352.1"
FT   mRNA            complement(join(1021012..1021293,1023045..1023074,
FT                   1023233..1023342,1023654..1023827,1023997..1024121,
FT                   1024214..1024281,1024892..1025025,1025405..1025449,
FT                   1025561..1025620,1025754..1025853,1026589..1026708))
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   transcript variant mCT170722"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170722.0 created
FT                   on 18-JUL-2002"
FT   CDS             complement(join(1021261..1021293,1023045..1023074,
FT                   1023233..1023342,1023654..1023827,1023997..1024121,
FT                   1024214..1024281,1024892..1025025,1025405..1025449,
FT                   1025561..1025620,1025754..1025838))
FT                   /codon_start=1
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170722.0
FT                   protein_id=mCP93642.0 isoform=CRA_b"
FT                   /protein_id="EDL34124.1"
FT                   /translation="MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPS
FT                   ATSELTTPSRFWSLSYTKSSSALQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRF
FT                   TGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYA
FT                   PMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPT
FT                   ALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDGCRS
FT                   PGIRWI"
FT   mRNA            complement(join(1021626..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025853,
FT                   1026977..1027139))
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   transcript variant mCT170725"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170725.0 created
FT                   on 18-JUL-2002"
FT   mRNA            complement(join(1021626..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025853,
FT                   1026589..1026708))
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   transcript variant mCT22037"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT22037.1 created
FT                   on 18-JUL-2002"
FT   mRNA            complement(join(1021626..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025853,
FT                   1026449..1026514))
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   transcript variant mCT170724"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170724.0 created
FT                   on 18-JUL-2002"
FT   mRNA            complement(join(1021626..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025853,
FT                   1026025..1026124))
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   transcript variant mCT170723"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170723.0 created
FT                   on 18-JUL-2002"
FT   mRNA            complement(join(1021626..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1026007))
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   transcript variant mCT170721"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170721.0 created
FT                   on 18-JUL-2002"
FT   CDS             complement(join(1022622..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025838))
FT                   /codon_start=1
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170721.0
FT                   protein_id=mCP93640.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q14BQ5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:1196386"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BQ5"
FT                   /protein_id="EDL34123.1"
FT                   /translation="MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPS
FT                   ATSELTTPSRFWSLSYTKSSSALQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRF
FT                   TGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYA
FT                   PMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPT
FT                   ALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDVVKT
FT                   QRQMSLGAVEAVRVKPPRVDSTWLLLRRIRAESGTRGLFAGFLPRIIKAAPSCAIMIST
FT                   YEFGKSFFQRLNQEQPLGR"
FT   CDS             complement(join(1022622..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025838))
FT                   /codon_start=1
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170723.0
FT                   protein_id=mCP93641.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q14BQ5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:1196386"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BQ5"
FT                   /protein_id="EDL34125.1"
FT                   /translation="MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPS
FT                   ATSELTTPSRFWSLSYTKSSSALQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRF
FT                   TGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYA
FT                   PMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPT
FT                   ALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDVVKT
FT                   QRQMSLGAVEAVRVKPPRVDSTWLLLRRIRAESGTRGLFAGFLPRIIKAAPSCAIMIST
FT                   YEFGKSFFQRLNQEQPLGR"
FT   CDS             complement(join(1022622..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025838))
FT                   /codon_start=1
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170724.0
FT                   protein_id=mCP93639.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q14BQ5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:1196386"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BQ5"
FT                   /protein_id="EDL34126.1"
FT                   /translation="MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPS
FT                   ATSELTTPSRFWSLSYTKSSSALQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRF
FT                   TGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYA
FT                   PMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPT
FT                   ALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDVVKT
FT                   QRQMSLGAVEAVRVKPPRVDSTWLLLRRIRAESGTRGLFAGFLPRIIKAAPSCAIMIST
FT                   YEFGKSFFQRLNQEQPLGR"
FT   CDS             complement(join(1022622..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025838))
FT                   /codon_start=1
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170725.0
FT                   protein_id=mCP93643.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q14BQ5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:1196386"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BQ5"
FT                   /protein_id="EDL34127.1"
FT                   /translation="MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPS
FT                   ATSELTTPSRFWSLSYTKSSSALQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRF
FT                   TGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYA
FT                   PMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPT
FT                   ALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDVVKT
FT                   QRQMSLGAVEAVRVKPPRVDSTWLLLRRIRAESGTRGLFAGFLPRIIKAAPSCAIMIST
FT                   YEFGKSFFQRLNQEQPLGR"
FT   CDS             complement(join(1022622..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025838))
FT                   /codon_start=1
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT22037.1
FT                   protein_id=mCP23443.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q14BQ5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:1196386"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BQ5"
FT                   /protein_id="EDL34128.1"
FT                   /translation="MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPS
FT                   ATSELTTPSRFWSLSYTKSSSALQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRF
FT                   TGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYA
FT                   PMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPT
FT                   ALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDVVKT
FT                   QRQMSLGAVEAVRVKPPRVDSTWLLLRRIRAESGTRGLFAGFLPRIIKAAPSCAIMIST
FT                   YEFGKSFFQRLNQEQPLGR"
FT   assembly_gap    1029626..1029645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1050479..1056809
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /note="gene_id=mCG21354.2"
FT   mRNA            join(1050479..1050541,1052967..1053111,1053227..1053352,
FT                   1053488..1053572,1053938..1054030,1055139..1055158,
FT                   1055248..1055493,1055711..1055944,1056026..1056250,
FT                   1056337..1056809)
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, transcript variant mCT170726"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170726.0 created
FT                   on 18-JUL-2002"
FT   mRNA            join(1050479..1050541,1052967..1053111,1053227..1053352,
FT                   1053488..1053548,1054483..1054511,1054705..1054828,
FT                   1055061..1055158,1055248..1055493,1055711..1055944,
FT                   1056026..1056250,1056337..1056809)
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, transcript variant mCT170727"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170727.0 created
FT                   on 18-JUL-2002"
FT   mRNA            join(1050479..1050541,1052967..1053111,1053227..1053352,
FT                   1053488..1053572,1053938..1054047,1054144..1054279,
FT                   1054402..1054511,1054705..1054828,1055061..1055158,
FT                   1055248..1055493,1055711..1055944,1056026..1056250,
FT                   1056337..1056807)
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, transcript variant mCT170730"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170730.0 created
FT                   on 18-JUL-2002"
FT   mRNA            join(1052787..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054705..1054828,1055061..1055158,1055248..1055493,
FT                   1055711..1055944,1056026..1056250,1056337..1056809)
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, transcript variant mCT22039"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT22039.1 created
FT                   on 18-JUL-2002"
FT   mRNA            join(1052967..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054705..1054828,1055061..1055158,1055248..1055493,
FT                   1055771..1055944,1056026..1056250,1056337..1056809)
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, transcript variant mCT170729"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170729.0 created
FT                   on 18-JUL-2002"
FT   mRNA            join(1052967..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054774..1054828,1055061..1055158,1055248..1055493,
FT                   1055711..1055944,1056026..1056250,1056337..1056809)
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, transcript variant mCT170728"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170728.0 created
FT                   on 18-JUL-2002"
FT   CDS             join(1052974..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054705..1054828,1055061..1055158,1055248..1055493,
FT                   1055711..1055944,1056026..1056250,1056337..1056474)
FT                   /codon_start=1
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, isoform CRA_e"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170730.0
FT                   protein_id=mCP93648.0 isoform=CRA_e"
FT                   /db_xref="InterPro:IPR000118"
FT                   /db_xref="MGI:MGI:95832"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Y8"
FT                   /protein_id="EDL34133.1"
FT                   /translation="MWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPL
FT                   LDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH
FT                   CSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHC
FT                   CPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCE
FT                   LPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKLPGYPVKEVK
FT                   CDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQV
FT                   PWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQ
FT                   HCCPQGFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSL
FT                   KGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVEC
FT                   GEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRW
FT                   DMFLRDPVPRPLL"
FT   CDS             join(1052974..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054705..1054828,1055061..1055158,1055248..1055493,
FT                   1055711..1055944,1056026..1056250,1056337..1056474)
FT                   /codon_start=1
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, isoform CRA_e"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT22039.1
FT                   protein_id=mCP23462.0 isoform=CRA_e"
FT                   /db_xref="InterPro:IPR000118"
FT                   /db_xref="MGI:MGI:95832"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Y8"
FT                   /protein_id="EDL34134.1"
FT                   /translation="MWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPL
FT                   LDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH
FT                   CSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHC
FT                   CPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCE
FT                   LPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKLPGYPVKEVK
FT                   CDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQV
FT                   PWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQ
FT                   HCCPQGFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSL
FT                   KGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVEC
FT                   GEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRW
FT                   DMFLRDPVPRPLL"
FT   CDS             join(1052974..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054705..1054828,1055061..1055158,1055248..1055493,
FT                   1055771..1055944,1056026..1056250,1056337..1056474)
FT                   /codon_start=1
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, isoform CRA_d"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170729.0
FT                   protein_id=mCP93644.0 isoform=CRA_d"
FT                   /protein_id="EDL34132.1"
FT                   /translation="MWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPL
FT                   LDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH
FT                   CSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHC
FT                   CPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCE
FT                   LPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKLPGYPVKEVK
FT                   CDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQV
FT                   PWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEGYCQKGDT
FT                   MVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQH
FT                   CCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVW
FT                   ACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFLRDPVPRPLL"
FT   CDS             join(1052974..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054774..1054828,1055061..1055158,1055248..1055493,
FT                   1055711..1055944,1056026..1056250,1056337..1056474)
FT                   /codon_start=1
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, isoform CRA_c"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170728.0
FT                   protein_id=mCP93647.0 isoform=CRA_c"
FT                   /protein_id="EDL34131.1"
FT                   /translation="MWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPL
FT                   LDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH
FT                   CSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHC
FT                   CPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCE
FT                   LPTGKYGCCPMPNCLSKNYTTDLLTKLPGYPVKEVKCDMEVSCPEGYTCCRLNTGAWGC
FT                   CPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTP
FT                   CDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGYCQKGDTMVA
FT                   GLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCP
FT                   AGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVWACC
FT                   PYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFLRDPVPRPLL"
FT   CDS             join(1052974..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054030,1055139..1055158,1055248..1055493,
FT                   1055711..1055944,1056026..1056250,1056337..1056474)
FT                   /codon_start=1
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, isoform CRA_a"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170726.0
FT                   protein_id=mCP93646.0 isoform=CRA_a"
FT                   /protein_id="EDL34129.1"
FT                   /translation="MWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPL
FT                   LDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH
FT                   CSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCCPFAKAVCCEDHIH
FT                   CCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCC
FT                   KLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQ
FT                   IGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEK
FT                   DVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHC
FT                   CPGGFHCSARGTKCLRKKIPRWDMFLRDPVPRPLL"
FT   CDS             join(1052974..1053111,1053227..1053352,1053488..1053548,
FT                   1054483..1054511,1054705..1054828,1055061..1055158,
FT                   1055248..1055493,1055711..1055944,1056026..1056250,
FT                   1056337..1056474)
FT                   /codon_start=1
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, isoform CRA_b"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170727.0
FT                   protein_id=mCP93645.0 isoform=CRA_b"
FT                   /protein_id="EDL34130.1"
FT                   /translation="MWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPL
FT                   LDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH
FT                   CSADGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKLPGYPVKEV
FT                   KCDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQ
FT                   VPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDN
FT                   QHCCPQGFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPS
FT                   LKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVE
FT                   CGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPR
FT                   WDMFLRDPVPRPLL"
FT   gene            complement(1057293..1067614)
FT                   /gene="BC025575"
FT                   /locus_tag="mCG_21371"
FT                   /note="gene_id=mCG21371.1"
FT   mRNA            complement(join(1057293..1057799,1057917..1058901,
FT                   1059424..1059550,1059660..1059776,1059874..1060053,
FT                   1060136..1060294,1063646..1063738,1063960..1064187,
FT                   1067385..1067614))
FT                   /gene="BC025575"
FT                   /locus_tag="mCG_21371"
FT                   /product="cDNA sequence BC025575"
FT                   /note="gene_id=mCG21371.1 transcript_id=mCT22057.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(1057476..1057799,1057917..1058901,
FT                   1059424..1059550,1059660..1059776,1059874..1060053,
FT                   1060136..1060294,1063646..1063738,1063960..1064187,
FT                   1067385..1067502))
FT                   /codon_start=1
FT                   /gene="BC025575"
FT                   /locus_tag="mCG_21371"
FT                   /product="cDNA sequence BC025575"
FT                   /note="gene_id=mCG21371.1 transcript_id=mCT22057.2
FT                   protein_id=mCP23447.2"
FT                   /protein_id="EDL34135.1"
FT                   /translation="MPPPSGPGVLARLLPLLGLLLGGASRAPGKSPPEPPSPQEILIKV
FT                   QVYVSGELVPLARASVDVFGNRTLLAAGTTDSEGVATLPLSYRLGTWVLVTAARPGFLT
FT                   NSVPWRVDKLPLYASVSLYLLPERPATLILYEDLVHILLGSPGARSQPWVQFQRRAARL
FT                   PVSSTYSQLWASLTPASTQQEMRAFPAFLGTEASSSGNGSWLELIPLAAVSVHLLTGNG
FT                   TEVPLSGPIHLSLPVPSEPRALAVGTSIPAWRFDPKSGLWVRNGTGVIRKEGRQLYWTF
FT                   VSPQLGYWVAAMASPTSGLVTITSGIQDIGTYHTIFLLTILAALALLVLILLCLLIYYC
FT                   RRRCLKPRQQHRKLQLSGPSDNKRDQATSMSQLHLICGGPLEPTSSGDPEAPPPGSLHS
FT                   AFSSSRDLASSRDDFFRAKPRSASRPAAEPPGARTVEGAGLKSARSVEGPGGLEPSLDE
FT                   YRRGPAGAAAFLHEPPSPPPSFDHYLGHKGAAESKTPDFLLSQSVDQLARPPSLSQPGQ
FT                   LIFCGSIDHLKDNVYRNVMPTLVIPAHYVRLGGEAGAAGVGDEATPPEGSAAGPARPFP
FT                   QPDPQRPLMQGHAGAGGDSGGGEGWGGGRSAPVSGSVTIPVLFNESTMAQLNGELQALT
FT                   EKKLLELGVKPHPRAWFVSLDGRSNSQVRHSYIDLPAPPPPAPPRLALSEDTEPSSSES
FT                   RTGLCSPEDNSLTPLLDEVVAPEGRAATVPRGRGRSRGDSSRSSASELRRDSLTSPEDE
FT                   LGAEVGDEAGDKKSPWQRREERP"
FT   gene            complement(1073320..1089888)
FT                   /gene="Itga2b"
FT                   /locus_tag="mCG_21359"
FT                   /note="gene_id=mCG21359.2"
FT   mRNA            complement(join(1073320..1073540,1075592..1075708,
FT                   1075927..1076028,1076258..1076374,1076993..1077112,
FT                   1077213..1077356,1077488..1077587,1077800..1077880,
FT                   1078141..1078220,1078370..1078462,1079900..1080047,
FT                   1080165..1080232,1080543..1080668,1080776..1080927,
FT                   1081017..1081072,1081157..1081261,1081346..1081391,
FT                   1081665..1081847,1084979..1085190,1085344..1085396,
FT                   1085536..1085589,1085750..1085793,1085929..1085976,
FT                   1086296..1086424,1086516..1086561,1087095..1087144,
FT                   1087368..1087530,1087634..1087731,1087821..1087942,
FT                   1089566..1089888))
FT                   /gene="Itga2b"
FT                   /locus_tag="mCG_21359"
FT                   /product="integrin alpha 2b"
FT                   /note="gene_id=mCG21359.2 transcript_id=mCT22045.2 created
FT                   on 18-JUL-2002"
FT   CDS             complement(join(1073484..1073540,1075592..1075708,
FT                   1075927..1076028,1076258..1076374,1076993..1077112,
FT                   1077213..1077356,1077488..1077587,1077800..1077880,
FT                   1078141..1078220,1078370..1078462,1079900..1080047,
FT                   1080165..1080232,1080543..1080668,1080776..1080927,
FT                   1081017..1081072,1081157..1081261,1081346..1081391,
FT                   1081665..1081847,1084979..1085190,1085344..1085396,
FT                   1085536..1085589,1085750..1085793,1085929..1085976,
FT                   1086296..1086424,1086516..1086561,1087095..1087144,
FT                   1087368..1087530,1087634..1087731,1087821..1087942,
FT                   1089566..1089753))
FT                   /codon_start=1
FT                   /gene="Itga2b"
FT                   /locus_tag="mCG_21359"
FT                   /product="integrin alpha 2b"
FT                   /note="gene_id=mCG21359.2 transcript_id=mCT22045.2
FT                   protein_id=mCP23544.2"
FT                   /db_xref="GOA:B2RPR7"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR013649"
FT                   /db_xref="InterPro:IPR018184"
FT                   /db_xref="InterPro:IPR032695"
FT                   /db_xref="MGI:MGI:96601"
FT                   /db_xref="UniProtKB/TrEMBL:B2RPR7"
FT                   /protein_id="EDL34136.1"
FT                   /translation="MARASCAWHSLWLLQWTPLFLGPSAVPPVWALNLDSEKFSVYAGP
FT                   NGSHFGFSVDFHKDKHGSVSIVVGAPRALNASQEETGAVFLCPWKANGGKCNPLLFDLR
FT                   DETRNLGFQIFQTFKTGQGLGASVVSWNDVIVACAPWQHWNVLEKRDEAEKTPVGGCFL
FT                   AQLQSGGRAEYSPCRANTMSSVYAESFRGDKRYCEAGFSLAVTQAGELVLGAPGGYFFL
FT                   GLLARVPIENIISSYRPGTLLWHVSNQRFTYDNSNPVFFDGYRGYSVAVGEFDGDPSTT
FT                   EYVSGAPTWSWTLGAVEILDSYYQPLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGA
FT                   PLYMESRADRKLAEVGRVYLFLQPKGPQALSTPTLLLTGTQLYGRFGSAIAPLGDLNRD
FT                   GYNDIAVAAPYGGPSGQGQVLIFLGQSEGLSPRPSQVLDSPFPTGSGFGFSLRGAVDID
FT                   DNGYPDLIVGAYGASKVAVYRAQPVVMATVQLMVQDSLNPTLKNCVLDQTKTPVSCFNI
FT                   QMCVGATGHNIPQKLHLKAELQLDLQKPRQGRRVLLLASQQASLTLSLDLGGRDKPICH
FT                   TTGAFLRDEADFRDKLSPIVLSLNVSLPPEETGGAPAVVLHGETHVQEQTRIILDCGED
FT                   DLCVPQLRLTATAGDSPLLIGADNVLELKIEAANDGEGAYEAELAVHLPPGAHYMRALS
FT                   NIEGFERLVCTQKKENESRVALCELGNPMKKDTRIGITMLVSVENLEEAGESVSFQLQV
FT                   RSKNSQNPNSKVVMLPVAIQAEATVELRGNSFPASLVVAAEEGDREQEDLDSWVSRLEH
FT                   TYELHNIGPGTVNGLRLLIHIPGQSQPSDLLYILDVQPQGGLLCSTQPSPKVDWKLSTP
FT                   SPSSIRPVHHQRERRQAFLQGPKPGQQDPVLVSCDGSASCTVVECELREMVRGQRAMVT
FT                   VQAMLGLSSLRQRPQEQFVLQSHAWFNVSSLPYSVPVVSLPSGQARVQTQLLRALEERA
FT                   IPVWWVLVGVLGGLLLLTLLVLAMWKAGFFKRNRPPLEEDEEEE"
FT   gene            complement(1096202..1107686)
FT                   /locus_tag="mCG_21366"
FT                   /note="gene_id=mCG21366.2"
FT   mRNA            complement(join(1096202..1100119,1100262..1102127,
FT                   1107556..1107686))
FT                   /locus_tag="mCG_21366"
FT                   /product="mCG21366"
FT                   /note="gene_id=mCG21366.2 transcript_id=mCT22051.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(1098229..1100119,1100262..1102108))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21366"
FT                   /product="mCG21366"
FT                   /note="gene_id=mCG21366.2 transcript_id=mCT22051.2
FT                   protein_id=mCP23562.2"
FT                   /protein_id="EDL34137.1"
FT                   /translation="MFRPTTVAVDEDGGEEDKDESSTNSGASAVSSCGFGADFSTDKGG
FT                   SFTSVQITNTTGLSQAPGLASQGISFGIKNNLGPPLQKLGVSFSFAKKAPVKLESIASV
FT                   FKDHAEEGSSEDGTKADEKSSDQGVQKVGDTDGTGNLDGKKEDEDPQDGGSLASTLSKL
FT                   KRMKREEGTGATEPEYYHYIPPAHCKVKPNFPFLLFMRASEQMEGDHSAHSKSAPENRK
FT                   SSSPKPQGCSKTAASPGAERTVSEASELQKEAAVAGPSEPGGKTETKKGSGGGEDEQSV
FT                   ESRETSESPMCESNPKDISQATPATKAGQGPKHPTGPFFPVLSKDESTALQWPSELLIF
FT                   TKAEPSISYSCNPLYFDFKLSRNKDAKAKGTEKPKDVAGSSKDHLQSLDPREPNKSQEE
FT                   EQDVVLSSEGRVDEPASGAACSSLNKQEPGGSHMSETEDTGRSHPSKKEPSGKSHRHKK
FT                   KKKHKKSSKHKRKHKADTEEKSSKAESGEKSKKRKKRKRKKNKSSAAADSERGPKSEPP
FT                   GSGSPAPPRRRRRAQDDSQRRSLPAEEGNSGKKDDGGGGSSCQDHSGRKHKGEPPTSSC
FT                   QRRANTKHSSRSSHRSQPSSGDEDSDDASSHRLHQKSPSHSSDASSDQSCYSRQHSYSD
FT                   DSYSDYSDRSRRHSKRSHDSDDSDYTSSKHRSKRHKYSSSDDDYSLSCSQSRSRSRSHT
FT                   RERSRSRGRSRSSSCSRSRSKRRSRSTTAHSWQRSRSYSRDRSRSTRSPSQRSGSRKGS
FT                   WGHESPEERRSGRRDFIRSKIYRSQSPHYFQSGRGEGPGKKEDGRGDDSKGAGLPSQNS
FT                   NTGTGRGSESDCSPEDKNSVTARLLLEKIQSRKVERKPNVCEEVLATPNKAGLKYKNPP
FT                   QGYFGPKLPPSLGNKPVLPMIGKLPATRKSNKKCEESGLERGEEQEHSEPEEGSPRSSD
FT                   APFGHQFSEEAAGPLSDPPPEEPKSEEATADHSVAPLGTPAHTDCYPGDPAISHNYLPD
FT                   PSDGDTLESLDSGSQPGPVESSLLPIAPDLEHFPNYAPPSGEPSIESTDGTEDASLAPL
FT                   ESQPITFTPEEMEKYSKLQQAAQQHIQQQLLAKQVKAFPASTALAPATPALQPIHIQQP
FT                   ATASATSITTVQHAILQHHAAAAAAAIGIHPHPHPQPLAQVHHIPQPHLTPISLSHLTH
FT                   SIIPGHPATFLASHPIHIIPASAIHPGPFTFHPVPHAALYPTLLAPRPAAAAATALHLH
FT                   PLLHPIFSGQDLQHPPSHGT"
FT   assembly_gap    1126711..1126730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1175376..1176245)
FT                   /locus_tag="mCG_148166"
FT                   /note="gene_id=mCG148166.0"
FT   mRNA            complement(1175376..1176245)
FT                   /locus_tag="mCG_148166"
FT                   /product="mCG148166"
FT                   /note="gene_id=mCG148166.0 transcript_id=mCT188429.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1175732..1176013)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148166"
FT                   /product="mCG148166"
FT                   /note="gene_id=mCG148166.0 transcript_id=mCT188429.0
FT                   protein_id=mCP109343.0"
FT                   /protein_id="EDL34138.1"
FT                   /translation="MRPRPRLHPYSRRFFGSAFLLFCSWLPAPQPGALWGLRFACLGAC
FT                   AGAGPARPPGERAGAGKAWASGFQAGAMEALAFARPDHPGDRLSVFPL"
FT   assembly_gap    1196362..1196512
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   gene            complement(1196648..1199506)
FT                   /locus_tag="mCG_21374"
FT                   /note="gene_id=mCG21374.2"
FT   mRNA            complement(join(1196648..1197047,1199004..1199149,
FT                   1199445..1199506))
FT                   /locus_tag="mCG_21374"
FT                   /product="mCG21374, transcript variant mCT172787"
FT                   /note="gene_id=mCG21374.2 transcript_id=mCT172787.0 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(1196695..1197047,1199004..1199149,
FT                   1199242..1199319))
FT                   /locus_tag="mCG_21374"
FT                   /product="mCG21374, transcript variant mCT22055"
FT                   /note="gene_id=mCG21374.2 transcript_id=mCT22055.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(1196933..1197047,1199004..1199056))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21374"
FT                   /product="mCG21374, isoform CRA_a"
FT                   /note="gene_id=mCG21374.2 transcript_id=mCT172787.0
FT                   protein_id=mCP95706.0 isoform=CRA_a"
FT                   /db_xref="GOA:A6PWP4"
FT                   /db_xref="MGI:MGI:3650659"
FT                   /db_xref="UniProtKB/TrEMBL:A6PWP4"
FT                   /protein_id="EDL34139.1"
FT                   /translation="MFGGNSQASKIFVRSGASNSYLHGTCRQEGLFVSKKICTGCTQIE
FT                   RHFDMKDFSP"
FT   CDS             complement(join(1196933..1197047,1199004..1199056))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21374"
FT                   /product="mCG21374, isoform CRA_a"
FT                   /note="gene_id=mCG21374.2 transcript_id=mCT22055.2
FT                   protein_id=mCP23472.2 isoform=CRA_a"
FT                   /db_xref="GOA:A6PWP4"
FT                   /db_xref="MGI:MGI:3650659"
FT                   /db_xref="UniProtKB/TrEMBL:A6PWP4"
FT                   /protein_id="EDL34140.1"
FT                   /translation="MFGGNSQASKIFVRSGASNSYLHGTCRQEGLFVSKKICTGCTQIE
FT                   RHFDMKDFSP"
FT   assembly_gap    1206664..1207452
FT                   /estimated_length=789
FT                   /gap_type="unknown"
FT   assembly_gap    1215780..1215960
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    1224400..1224419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1224425..1227368
FT                   /gene="Fzd2"
FT                   /locus_tag="mCG_21349"
FT                   /note="gene_id=mCG21349.3"
FT   mRNA            1224425..1227368
FT                   /gene="Fzd2"
FT                   /locus_tag="mCG_21349"
FT                   /product="frizzled homolog 2 (Drosophila)"
FT                   /note="gene_id=mCG21349.3 transcript_id=mCT21546.3 created
FT                   on 23-JUN-2003"
FT   CDS             1224762..1226474
FT                   /codon_start=1
FT                   /gene="Fzd2"
FT                   /locus_tag="mCG_21349"
FT                   /product="frizzled homolog 2 (Drosophila)"
FT                   /note="gene_id=mCG21349.3 transcript_id=mCT21546.3
FT                   protein_id=mCP23527.2"
FT                   /protein_id="EDL34141.1"
FT                   /translation="MRARSALPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQ
FT                   PISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPV
FT                   CTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSED
FT                   GAPALLTTAPPSGLQPGAGGTPGGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSYKFLG
FT                   ERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYP
FT                   ERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLY
FT                   FFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQID
FT                   GDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTE
FT                   KLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTP
FT                   RMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRHGETTV"
FT   assembly_gap    1227369..1227420
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   gene            complement(1239952..1244536)
FT                   /locus_tag="mCG_131532"
FT                   /note="gene_id=mCG131532.1"
FT   mRNA            complement(join(1239952..1240617,1241636..1241728,
FT                   1242216..1242363,1244448..1244517))
FT                   /locus_tag="mCG_131532"
FT                   /product="mCG131532, transcript variant mCT132867"
FT                   /note="gene_id=mCG131532.1 transcript_id=mCT132867.1
FT                   created on 05-SEP-2002"
FT   mRNA            complement(join(1240559..1241010,1241625..1241728,
FT                   1242216..1242363,1244448..1244505))
FT                   /locus_tag="mCG_131532"
FT                   /product="mCG131532, transcript variant mCT172757"
FT                   /note="gene_id=mCG131532.1 transcript_id=mCT172757.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(1240597..1240617,1241636..1241728,
FT                   1242216..1242347))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131532"
FT                   /product="mCG131532, isoform CRA_c"
FT                   /note="gene_id=mCG131532.1 transcript_id=mCT132867.1
FT                   protein_id=mCP75354.1 isoform=CRA_c"
FT                   /protein_id="EDL34144.1"
FT                   /translation="MMTQKYGALRSLPHNPHAIGLQSICGTQEEQQTKTLEPPTEKLQA
FT                   VASFRVSLPVSFAAAGFSGLGMELWDSCMLRKEDQP"
FT   CDS             complement(join(1241004..1241010,1241625..1241728,
FT                   1242216..1242347))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131532"
FT                   /product="mCG131532, isoform CRA_b"
FT                   /note="gene_id=mCG131532.1 transcript_id=mCT172757.0
FT                   protein_id=mCP95676.0 isoform=CRA_b"
FT                   /protein_id="EDL34143.1"
FT                   /translation="MMTQKYGALRSLPHNPHAIGLQSICGTQEEQQTKTLEPPTEKLQA
FT                   VASFRVSLPVSFAAAGFSGLGMELWDSCMLVSTLH"
FT   mRNA            complement(join(1241476..1241728,1242216..1242363,
FT                   1244448..1244536))
FT                   /locus_tag="mCG_131532"
FT                   /product="mCG131532, transcript variant mCT172756"
FT                   /note="gene_id=mCG131532.1 transcript_id=mCT172756.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(1241582..1241728,1242216..1242347))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131532"
FT                   /product="mCG131532, isoform CRA_a"
FT                   /note="gene_id=mCG131532.1 transcript_id=mCT172756.0
FT                   protein_id=mCP95675.0 isoform=CRA_a"
FT                   /protein_id="EDL34142.1"
FT                   /translation="MMTQKYGALRSLPHNPHAIGLQSICGTQEEQQTKTLEPPTEKLQA
FT                   VASFRVSLPVSFAAAGFSGLGMELWDSCMLVSTLPLSHILKLLSLSM"
FT   assembly_gap    1253789..1254525
FT                   /estimated_length=737
FT                   /gap_type="unknown"
FT   assembly_gap    1262143..1262315
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    1264041..1264060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1271015..1271423
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    1275838..1275987
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   gene            complement(<1279518..>1280263)
FT                   /locus_tag="mCG_7455"
FT                   /note="gene_id=mCG7455.2"
FT   mRNA            complement(join(<1279518..1280197,1280212..>1280263))
FT                   /locus_tag="mCG_7455"
FT                   /product="mCG7455"
FT                   /note="gene_id=mCG7455.2 transcript_id=mCT6549.2 created on
FT                   05-SEP-2002"
FT   CDS             complement(1279518..>1279952)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7455"
FT                   /product="mCG7455"
FT                   /note="gene_id=mCG7455.2 transcript_id=mCT6549.2
FT                   protein_id=mCP1162.2"
FT                   /protein_id="EDL34145.1"
FT                   /translation="QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMDTMICGWDK
FT                   RGPGLYYVDSEGNRISGTAFAVGSGFVYAYGVMDRGYSYDLKVEEAYDLACQAIYQATY
FT                   RDAYSGGAVNLYHVQEDGWIRVSSDTVADLHDKYSSVSVP"
FT   assembly_gap    1286812..1286831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1295321..1301127
FT                   /locus_tag="mCG_7453"
FT                   /note="gene_id=mCG7453.2"
FT   mRNA            join(1295321..1296213,1297036..1297170,1300246..1300426,
FT                   1300824..1301127)
FT                   /locus_tag="mCG_7453"
FT                   /product="mCG7453"
FT                   /note="gene_id=mCG7453.2 transcript_id=mCT6558.2 created on
FT                   05-SEP-2002"
FT   CDS             join(1295563..1296213,1297036..1297170,1300246..1300426,
FT                   1300824..1301053)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7453"
FT                   /product="mCG7453"
FT                   /note="gene_id=mCG7453.2 transcript_id=mCT6558.2
FT                   protein_id=mCP1167.2"
FT                   /protein_id="EDL34146.1"
FT                   /translation="MEGLTKTGEDNLFESVTEKKIKQPNGFCDSYSASQYGIIENVNKH
FT                   NFQAKPQSGHYDPEDIPKHFDGLPQNTYQDLLESQGHFNSHRQGSGDNNINSRVNRTQA
FT                   SCFSNNYMMGDLRHNQGFQQLGSNGFPLRSTHPFGHSVVPLLDSYDLFSYDDLSHLYPY
FT                   FNDMMYGDNSFSGFVPTFGFQRPIKTRSGPASELHIRLEECYEQWRALEKERKKTELAL
FT                   AKNYPGKKVSSTNNTPIPRLTSNPSRVDRLIVDELREQARVVTLLGKMERLRSSPLHAN
FT                   ISTALDRHLESIHIVQSRRKDEIVNASNRQRQGVPRCQDDRDVFALATAIKEMCVATRK
FT                   ARTTLWCALQMTLPKTASTAGQADMEKAFQDLVNCEEKVHESINSSNPMNQRGETSKH"
FT   gene            complement(1305002..1318030)
FT                   /gene="Ccdc43"
FT                   /locus_tag="mCG_7458"
FT                   /note="gene_id=mCG7458.1"
FT   mRNA            complement(join(1305002..1306814,1309118..1309176,
FT                   1310518..1310653,1312366..1312453,1317814..1318030))
FT                   /gene="Ccdc43"
FT                   /locus_tag="mCG_7458"
FT                   /product="coiled-coil domain containing 43"
FT                   /note="gene_id=mCG7458.1 transcript_id=mCT6543.2 created on
FT                   18-JUL-2002"
FT   CDS             complement(join(1306627..1306814,1309118..1309176,
FT                   1310518..1310653,1312366..1312453,1317814..1318011))
FT                   /codon_start=1
FT                   /gene="Ccdc43"
FT                   /locus_tag="mCG_7458"
FT                   /product="coiled-coil domain containing 43"
FT                   /note="gene_id=mCG7458.1 transcript_id=mCT6543.2
FT                   protein_id=mCP1161.1"
FT                   /protein_id="EDL34147.1"
FT                   /translation="MAAPSEVAAAVLGEGDGGAFGSWLDGRLEALGVDRAVYAAYILGV
FT                   LQEEEEEEKLDALQGILSAFLEEESLLDICKEIVERWSETRDVTTKVKKEDEVQAIATL
FT                   IEKQAQIVVKPRVVSEEEKQRKAALLAQYADVTDEEDEADKKDDAGASTANVSSDRTLF
FT                   RNTNVEDVLNARKLERDSLRDESQRKKEQDKLQREKDKLAKQERKEKEKKRTQKGERKR
FT                   "
FT   assembly_gap    1314190..1314209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1320136..1321533)
FT                   /locus_tag="mCG_1042069"
FT                   /note="gene_id=mCG1042069.1"
FT   mRNA            complement(1320136..1321533)
FT                   /locus_tag="mCG_1042069"
FT                   /product="mCG1042069"
FT                   /note="gene_id=mCG1042069.1 transcript_id=mCT159773.1
FT                   created on 05-SEP-2002"
FT   CDS             complement(1320503..1320820)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042069"
FT                   /product="mCG1042069"
FT                   /note="gene_id=mCG1042069.1 transcript_id=mCT159773.1
FT                   protein_id=mCP75442.1"
FT                   /protein_id="EDL34148.1"
FT                   /translation="MPYSFLPFLLPVCLSLSFLLFLSLFFFLSLSLSLSLSFFLFFLFL
FT                   FFETGSHYVALAVLELTISLCRLGWPRTQKSTCLCLPNAGIKFMHNYTWIQCHSLSIQK
FT                   P"
FT   assembly_gap    1339405..1339682
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    1341265..1341422
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    1351175..1351326
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    1354279..1354311
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    1365837..1366160
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    1369996..1370459
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   assembly_gap    1374148..1374500
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    1381850..1382349
FT                   /estimated_length=500
FT                   /gap_type="unknown"
FT   gene            1382386..1399799
FT                   /gene="Adam11"
FT                   /locus_tag="mCG_7457"
FT                   /note="gene_id=mCG7457.1"
FT   mRNA            join(1382386..1382464,1382924..1383108,1390643..1390719,
FT                   1390870..1390936,1391983..1392068,1392183..1392258,
FT                   1392663..1392729,1392793..1392860,1393203..1393277,
FT                   1393360..1393431,1393583..1393749,1394145..1394229,
FT                   1394328..1394418,1394526..1394577,1395017..1395116,
FT                   1395193..1395264,1395383..1395475,1395782..1395862,
FT                   1396405..1396455,1396548..1396611,1396821..1396920,
FT                   1397071..1397190,1397284..1397452,1397544..1397658,
FT                   1397743..1397833,1398866..1399799)
FT                   /gene="Adam11"
FT                   /locus_tag="mCG_7457"
FT                   /product="a disintegrin and metallopeptidase domain 11,
FT                   transcript variant mCT6546"
FT                   /note="gene_id=mCG7457.1 transcript_id=mCT6546.2 created on
FT                   18-JUL-2002"
FT   mRNA            join(1382386..1382464,1382924..1383108,1390643..1390719,
FT                   1390870..1390936,1391983..1392068,1392183..1392258,
FT                   1392663..1392729,1392793..1392860,1393203..1393277,
FT                   1393360..1393431,1393583..1393749,1394145..1394229,
FT                   1394328..1394418,1394526..1394577,1395017..1395116,
FT                   1395193..1395264,1395383..1395475,1395782..1395862,
FT                   1396405..1396455,1396548..1396611,1396821..1396920,
FT                   1397071..1397190,1397284..1397452,1397544..1397658,
FT                   1397743..1397833,1398386..1398451)
FT                   /gene="Adam11"
FT                   /locus_tag="mCG_7457"
FT                   /product="a disintegrin and metallopeptidase domain 11,
FT                   transcript variant mCT170734"
FT                   /note="gene_id=mCG7457.1 transcript_id=mCT170734.0 created
FT                   on 18-JUL-2002"
FT   CDS             join(1382401..1382464,1382924..1383108,1390643..1390719,
FT                   1390870..1390936,1391983..1392068,1392183..1392258,
FT                   1392663..1392729,1392793..1392860,1393203..1393277,
FT                   1393360..1393431,1393583..1393749,1394145..1394229,
FT                   1394328..1394418,1394526..1394577,1395017..1395116,
FT                   1395193..1395264,1395383..1395475,1395782..1395862,
FT                   1396405..1396455,1396548..1396611,1396821..1396920,
FT                   1397071..1397190,1397284..1397452,1397544..1397658,
FT                   1397743..1397833,1398866..1399058)
FT                   /codon_start=1
FT                   /gene="Adam11"
FT                   /locus_tag="mCG_7457"
FT                   /product="a disintegrin and metallopeptidase domain 11,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7457.1 transcript_id=mCT6546.2
FT                   protein_id=mCP1164.2 isoform=CRA_b"
FT                   /protein_id="EDL34150.1"
FT                   /translation="MRRLRRWAIAALLLLPLLPPPGLGALGPRGALHWRSSAHVGSPES
FT                   PEGSEVTEPSRLVRQSSGGEVRKPQLDTRVRQDPPRGTPVHLAQVSFVIPAFDSNFTLD
FT                   LELNHHLLSSQYVERHFSREGTRQHSTGAGDHCYYHGKLRGNPQSFAALSTCQGLHGVF
FT                   SDGNLTYIVEPKEIAGPWGPPQGPLPHLIYRTPLLPAPLGCREPGCLFAVPAQSALPNW
FT                   PKLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIY
FT                   KEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQ
FT                   STSSGAAYVGGICSLSRGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCP
FT                   DIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEA
FT                   GEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLCCRRCKYEPRGVSCREAVNECDIA
FT                   ETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQALWGHAAADRFCYEKLN
FT                   VEGTERGNCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLGGDISSVTFYHQGKEL
FT                   DCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCPGSGERRICSHHG
FT                   VCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSIAGAVLVAAI
FT                   VLGGTGWGFKCPLSIPGPEGPKCHPAPSEPGTHHLGPEPRGCLHPATEGGTVQMSSGSE
FT                   PFNSWLHRGWGLGL"
FT   CDS             join(1382401..1382464,1382924..1383108,1390643..1390719,
FT                   1390870..1390936,1391983..1392068,1392183..1392258,
FT                   1392663..1392729,1392793..1392860,1393203..1393277,
FT                   1393360..1393431,1393583..1393749,1394145..1394229,
FT                   1394328..1394418,1394526..1394577,1395017..1395116,
FT                   1395193..1395264,1395383..1395475,1395782..1395862,
FT                   1396405..1396455,1396548..1396611,1396821..1396920,
FT                   1397071..1397190,1397284..1397452,1397544..1397658,
FT                   1397743..1397833,1398386..1398434)
FT                   /codon_start=1
FT                   /gene="Adam11"
FT                   /locus_tag="mCG_7457"
FT                   /product="a disintegrin and metallopeptidase domain 11,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7457.1 transcript_id=mCT170734.0
FT                   protein_id=mCP93652.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q7TQG7"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013111"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:1098667"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQG7"
FT                   /protein_id="EDL34149.1"
FT                   /translation="MRRLRRWAIAALLLLPLLPPPGLGALGPRGALHWRSSAHVGSPES
FT                   PEGSEVTEPSRLVRQSSGGEVRKPQLDTRVRQDPPRGTPVHLAQVSFVIPAFDSNFTLD
FT                   LELNHHLLSSQYVERHFSREGTRQHSTGAGDHCYYHGKLRGNPQSFAALSTCQGLHGVF
FT                   SDGNLTYIVEPKEIAGPWGPPQGPLPHLIYRTPLLPAPLGCREPGCLFAVPAQSALPNW
FT                   PKLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIY
FT                   KEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQ
FT                   STSSGAAYVGGICSLSRGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCP
FT                   DIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEA
FT                   GEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLCCRRCKYEPRGVSCREAVNECDIA
FT                   ETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQALWGHAAADRFCYEKLN
FT                   VEGTERGNCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLGGDISSVTFYHQGKEL
FT                   DCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCPGSGERRICSHHG
FT                   VCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSIAGAVLVAAI
FT                   VLGGTGWGFKNIRRGRYDPTQQGAV"
FT   assembly_gap    1386165..1386184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1392108..1392127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1407177..1407196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1408936..1408955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1414526..1414571
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    1416631..1417357
FT                   /estimated_length=727
FT                   /gap_type="unknown"
FT   gene            complement(1421086..>1427252)
FT                   /gene="Gja7"
FT                   /locus_tag="mCG_7456"
FT                   /note="gene_id=mCG7456.3"
FT   mRNA            complement(join(1421086..1422803,1424295..1424370,
FT                   1425739..1426483))
FT                   /gene="Gja7"
FT                   /locus_tag="mCG_7456"
FT                   /product="gap junction membrane channel protein alpha 7,
FT                   transcript variant mCT6550"
FT                   /note="gene_id=mCG7456.3 transcript_id=mCT6550.2 created on
FT                   18-JUL-2002"
FT   CDS             complement(1421593..1422783)
FT                   /codon_start=1
FT                   /gene="Gja7"
FT                   /locus_tag="mCG_7456"
FT                   /product="gap junction membrane channel protein alpha 7,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7456.3 transcript_id=mCT6550.2
FT                   protein_id=mCP1163.2 isoform=CRA_b"
FT                   /protein_id="EDL34152.1"
FT                   /translation="MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYY
FT                   DEQSKFVCNTEQPGCENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEH
FT                   GEADKKAARSKPYAMRWKQHRALEETEEDHEEDPMMYPEMELESEKENKEQSQPKPKHD
FT                   GRRRIREDGLMKIYVLQLLARTVFEVGFLIGQYFLYGFQVHPFYVCSRLPCPHKIDCFI
FT                   SRPTEKTIFLLIMYGVTGLCLLLNIWEMLHLGFGTIRDSLNSKRRELDDPGAYNYPFTW
FT                   NTPSAPPGYNIAVKPDQIQYTELSNAKIAYKQNKANIAQEQQYGSHEEHLPADLETLQR
FT                   EIRMAQERLDLAIQAYHHQNNPHGPREKKAKVGSKSGSNKSSISSKSGDGKTSVWI"
FT   mRNA            complement(join(<1422339..1422803,1424295..>1427252))
FT                   /gene="Gja7"
FT                   /locus_tag="mCG_7456"
FT                   /product="gap junction membrane channel protein alpha 7,
FT                   transcript variant mCT193275"
FT                   /note="gene_id=mCG7456.3 transcript_id=mCT193275.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<1422339..1422803,1424295..>1424298))
FT                   /codon_start=1
FT                   /gene="Gja7"
FT                   /locus_tag="mCG_7456"
FT                   /product="gap junction membrane channel protein alpha 7,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7456.3 transcript_id=mCT193275.0
FT                   protein_id=mCP114249.0 isoform=CRA_a"
FT                   /protein_id="EDL34151.1"
FT                   /translation="TGQTNSTTMSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTA
FT                   VGGESIYYDEQSKFVCNTEQPGCENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAI
FT                   HKIAKMEHGEADKKAARSKPYAMRWKQHRALEETEEDHEEDPMMYPEMELES"
FT   assembly_gap    1440076..1443186
FT                   /estimated_length=3111
FT                   /gap_type="unknown"
FT   assembly_gap    1450832..1450851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1455668..1457094
FT                   /estimated_length=1427
FT                   /gap_type="unknown"
FT   gene            1457493..1459621
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /note="gene_id=mCG7447.2"
FT   mRNA            join(1457493..1457541,1458194..1458343,1458815..1458949,
FT                   1459489..1459621)
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /product="HIG1 domain family, member 1B, transcript variant
FT                   mCT171106"
FT                   /note="gene_id=mCG7447.2 transcript_id=mCT171106.0 created
FT                   on 22-JUL-2002"
FT   mRNA            join(1457877..1458343,1458815..1458949,1459489..1459620)
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /product="HIG1 domain family, member 1B, transcript variant
FT                   mCT6553"
FT                   /note="gene_id=mCG7447.2 transcript_id=mCT6553.2 created on
FT                   22-JUL-2002"
FT   mRNA            join(1458027..1458105,1458194..1458343,1458815..1458949,
FT                   1459489..1459619)
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /product="HIG1 domain family, member 1B, transcript variant
FT                   mCT171105"
FT                   /note="gene_id=mCG7447.2 transcript_id=mCT171105.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(1458244..1458343,1458815..1458949,1459489..1459550)
FT                   /codon_start=1
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /product="HIG1 domain family, member 1B, isoform CRA_a"
FT                   /note="gene_id=mCG7447.2 transcript_id=mCT171105.0
FT                   protein_id=mCP94023.0 isoform=CRA_a"
FT                   /protein_id="EDL34153.1"
FT                   /translation="MSANKGWWVPPEGEDNLSKKFLRKTRESPLVPIGVAGCLVIAAYR
FT                   IYRLKARGSTKLSIHLIHTRVAAQACAVGAIMLGAMYTMYRDYIKRVSEDAEK"
FT   CDS             join(1458244..1458343,1458815..1458949,1459489..1459550)
FT                   /codon_start=1
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /product="HIG1 domain family, member 1B, isoform CRA_a"
FT                   /note="gene_id=mCG7447.2 transcript_id=mCT171106.0
FT                   protein_id=mCP94024.0 isoform=CRA_a"
FT                   /protein_id="EDL34154.1"
FT                   /translation="MSANKGWWVPPEGEDNLSKKFLRKTRESPLVPIGVAGCLVIAAYR
FT                   IYRLKARGSTKLSIHLIHTRVAAQACAVGAIMLGAMYTMYRDYIKRVSEDAEK"
FT   CDS             join(1458244..1458343,1458815..1458949,1459489..1459550)
FT                   /codon_start=1
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /product="HIG1 domain family, member 1B, isoform CRA_a"
FT                   /note="gene_id=mCG7447.2 transcript_id=mCT6553.2
FT                   protein_id=mCP1166.1 isoform=CRA_a"
FT                   /protein_id="EDL34155.1"
FT                   /translation="MSANKGWWVPPEGEDNLSKKFLRKTRESPLVPIGVAGCLVIAAYR
FT                   IYRLKARGSTKLSIHLIHTRVAAQACAVGAIMLGAMYTMYRDYIKRVSEDAEK"
FT   gene            complement(<1460382..1501875)
FT                   /gene="Eftud2"
FT                   /locus_tag="mCG_49887"
FT                   /note="gene_id=mCG49887.2"
FT   mRNA            complement(join(<1460382..1460477,1460731..1460838,
FT                   1461001..1461154,1461605..1461699,1461845..1461963,
FT                   1462750..1462837,1462981..1463107,1463262..1463348,
FT                   1464934..1465016,1465724..1465825,1467678..1467818,
FT                   1468167..1468278,1469594..1469787,1470821..1470948,
FT                   1473394..1473529,1476424..1476514,1476869..1476932,
FT                   1481648..1481772,1484256..1484422,1486353..1486435,
FT                   1487215..1487305,1489691..1489726,1490432..1490497,
FT                   1490940..1491015,1492013..1492091,1492865..1493030,
FT                   1498524..1498632,1501804..1501875))
FT                   /gene="Eftud2"
FT                   /locus_tag="mCG_49887"
FT                   /product="elongation factor Tu GTP binding domain
FT                   containing 2"
FT                   /note="gene_id=mCG49887.2 transcript_id=mCT50070.2 created
FT                   on 18-JUL-2002"
FT   CDS             complement(join(1460382..1460477,1460731..1460838,
FT                   1461001..1461154,1461605..1461699,1461845..1461963,
FT                   1462750..1462837,1462981..1463107,1463262..1463348,
FT                   1464934..1465016,1465724..1465825,1467678..1467818,
FT                   1468167..1468278,1469594..1469787,1470821..1470948,
FT                   1473394..1473529,1476424..1476514,1476869..1476932,
FT                   1481648..1481772,1484256..1484422,1486353..1486435,
FT                   1487215..1487305,1489691..1489726,1490432..1490497,
FT                   1490940..1491015,1492013..1492091,1492865..1493030,
FT                   1498524..1498628))
FT                   /codon_start=1
FT                   /gene="Eftud2"
FT                   /locus_tag="mCG_49887"
FT                   /product="elongation factor Tu GTP binding domain
FT                   containing 2"
FT                   /note="gene_id=mCG49887.2 transcript_id=mCT50070.2
FT                   protein_id=mCP24049.1"
FT                   /db_xref="GOA:A2AH85"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031950"
FT                   /db_xref="MGI:MGI:1336880"
FT                   /db_xref="UniProtKB/TrEMBL:A2AH85"
FT                   /protein_id="EDL34156.1"
FT                   /translation="MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDEDEDEDDV
FT                   GEHEDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTL
FT                   MEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQ
FT                   DLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRIS
FT                   DGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHI
FT                   VDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFA
FT                   KRLWGDIYFNPKTRKFTKKAPSSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDEL
FT                   GIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVD
FT                   SDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLE
FT                   DEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQI
FT                   FRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGEL
FT                   YLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEK
FT                   GLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSE
FT                   VDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTA
FT                   RRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTI
FT                   KAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLA
FT                   REFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM"
FT   assembly_gap    1488726..1488944
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   gene            1502144..1505259
FT                   /gene="Ccdc103"
FT                   /locus_tag="mCG_7446"
FT                   /note="gene_id=mCG7446.1"
FT   mRNA            join(1502144..1502224,1503265..1503340,1503454..1503605,
FT                   1503983..1504115,1504756..1505259)
FT                   /gene="Ccdc103"
FT                   /locus_tag="mCG_7446"
FT                   /product="coiled-coil domain containing 103, transcript
FT                   variant mCT6552"
FT                   /note="gene_id=mCG7446.1 transcript_id=mCT6552.2 created on
FT                   04-APR-2003"
FT   mRNA            join(1502155..1502224,1503261..1503340,1503454..1503605,
FT                   1503983..1504115,1504756..1505249)
FT                   /gene="Ccdc103"
FT                   /locus_tag="mCG_7446"
FT                   /product="coiled-coil domain containing 103, transcript
FT                   variant mCT181706"
FT                   /note="gene_id=mCG7446.1 transcript_id=mCT181706.0 created
FT                   on 04-APR-2003"
FT   CDS             join(1503463..1503605,1503983..1504115,1504756..1505193)
FT                   /codon_start=1
FT                   /gene="Ccdc103"
FT                   /locus_tag="mCG_7446"
FT                   /product="coiled-coil domain containing 103, isoform CRA_a"
FT                   /note="gene_id=mCG7446.1 transcript_id=mCT181706.0
FT                   protein_id=mCP104628.0 isoform=CRA_a"
FT                   /protein_id="EDL34157.1"
FT                   /translation="MEKNDVINFKALEKELQAALAADEKYKRENAAKLRAVEQRVPSYE
FT                   EFRGIVLASHLKPLEQKDKMGGKRFVPWNCHTTRERTSQDVVTEIPQEKSPFQPTTSAE
FT                   FYRDWRRHLRSGPERYQALLQLGGPKLGHLFQMDVGFGLLGELLVALAEHTRLSDRTAV
FT                   LGILHSLANTGRFNLNLSLLSHAERESCQRLFQKLQAMSTTRPMQEGLTVEEPSAGLQG
FT                   EEGLLQELLELYGVH"
FT   CDS             join(1503463..1503605,1503983..1504115,1504756..1505193)
FT                   /codon_start=1
FT                   /gene="Ccdc103"
FT                   /locus_tag="mCG_7446"
FT                   /product="coiled-coil domain containing 103, isoform CRA_a"
FT                   /note="gene_id=mCG7446.1 transcript_id=mCT6552.2
FT                   protein_id=mCP1165.1 isoform=CRA_a"
FT                   /protein_id="EDL34158.1"
FT                   /translation="MEKNDVINFKALEKELQAALAADEKYKRENAAKLRAVEQRVPSYE
FT                   EFRGIVLASHLKPLEQKDKMGGKRFVPWNCHTTRERTSQDVVTEIPQEKSPFQPTTSAE
FT                   FYRDWRRHLRSGPERYQALLQLGGPKLGHLFQMDVGFGLLGELLVALAEHTRLSDRTAV
FT                   LGILHSLANTGRFNLNLSLLSHAERESCQRLFQKLQAMSTTRPMQEGLTVEEPSAGLQG
FT                   EEGLLQELLELYGVH"
FT   gene            1505456..1507630
FT                   /gene="4933439F11Rik"
FT                   /locus_tag="mCG_7452"
FT                   /note="gene_id=mCG7452.1"
FT   mRNA            1505456..1507630
FT                   /gene="4933439F11Rik"
FT                   /locus_tag="mCG_7452"
FT                   /product="RIKEN cDNA 4933439F11"
FT                   /note="gene_id=mCG7452.1 transcript_id=mCT6547.1 created on
FT                   18-JUL-2002"
FT   CDS             1506271..1507524
FT                   /codon_start=1
FT                   /gene="4933439F11Rik"
FT                   /locus_tag="mCG_7452"
FT                   /product="RIKEN cDNA 4933439F11"
FT                   /note="gene_id=mCG7452.1 transcript_id=mCT6547.1
FT                   protein_id=mCP1171.1"
FT                   /protein_id="EDL34159.1"
FT                   /translation="MSLAHTTVLLWAWGSLQAFEIVEKESVFQRTPCPAFLVFDNAAYL
FT                   ADMSFELPCHCKPEDVSAVVWYYQKHLGSKRTTVLTDFDGRLLTEAAHVRVGSSMLVRF
FT                   SIRMFSLLVFRAQPEDTGLYFCGTREGDYFYAYDVDIQSNKEIVASFKDMAQEPLPDEY
FT                   YGALHVFTTFWEWTPCDRCGVRGEQWRFGLCYLQYPDLSPRYIKTRSDVVSCGSGAVPW
FT                   KLHLQTKYHTPELQFQSCLVSCQKRNKTRKGVLAIYSYVSKLGSRPWVPQVPIQFHQQR
FT                   LGHGLIISCPGARPEHAVAWDKDNQPLYRAQYLKGVNRSMRVFIDHGNHLHIRFTQLSD
FT                   RGIYYCWLQGLKIAGFRLGVITRGRYPASLSDPETRTAIELTLMGYLLITIFFITIHLC
FT                   RCCCQSRCCPNFSAQTLL"
FT   gene            complement(1508233..>1517997)
FT                   /gene="Gfap"
FT                   /locus_tag="mCG_7451"
FT                   /note="gene_id=mCG7451.1"
FT   mRNA            complement(join(1508233..1509605,1510328..1510413,
FT                   1512790..1512833,1513911..1514133,1514332..1514457,
FT                   1515249..1515410,1516357..1516452,1516635..1516695,
FT                   1517546..>1517997))
FT                   /gene="Gfap"
FT                   /locus_tag="mCG_7451"
FT                   /product="glial fibrillary acidic protein"
FT                   /note="gene_id=mCG7451.1 transcript_id=mCT6551.2 created on
FT                   05-SEP-2002"
FT   CDS             complement(join(1513972..1514133,1514332..1514457,
FT                   1515249..1515410,1516357..1516452,1516635..1516695,
FT                   1517546..1517997))
FT                   /codon_start=1
FT                   /gene="Gfap"
FT                   /locus_tag="mCG_7451"
FT                   /product="glial fibrillary acidic protein"
FT                   /note="gene_id=mCG7451.1 transcript_id=mCT6551.2
FT                   protein_id=mCP1160.2"
FT                   /protein_id="EDL34160.1"
FT                   /translation="MERRRITSARRSYASETVVRGLGPSRQLGTMPRFSLSRMTPPLPA
FT                   RVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAK
FT                   EPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLGTLRQKLQDETNLRLEAE
FT                   NNLAAYRQEADEATLARVDLERKVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMD
FT                   VAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEAND
FT                   YRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLGGGGPKPQGGDG
FT                   PPPAGVPGSTQR"
FT   assembly_gap    1518475..1518494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1526895..1546516)
FT                   /gene="3000004C01Rik"
FT                   /locus_tag="mCG_7449"
FT                   /note="gene_id=mCG7449.1"
FT   mRNA            complement(join(1526895..1527598,1527818..1527903,
FT                   1528318..1528398,1529435..1529960,1530209..1530414,
FT                   1533674..1533789,1534243..1534411,1534773..1534873,
FT                   1535007..1535081,1535573..1535785,1535862..1536059,
FT                   1536138..1536248,1536455..1536577,1536866..1537023,
FT                   1537512..1537838,1546410..1546516))
FT                   /gene="3000004C01Rik"
FT                   /locus_tag="mCG_7449"
FT                   /product="RIKEN cDNA 3000004C01"
FT                   /note="gene_id=mCG7449.1 transcript_id=mCT6555.2 created on
FT                   05-SEP-2002"
FT   CDS             complement(join(1527522..1527598,1527818..1527903,
FT                   1528318..1528398,1529435..1529960,1530209..1530414,
FT                   1533674..1533789,1534243..1534411,1534773..1534873,
FT                   1535007..1535081,1535573..1535785,1535862..1536059,
FT                   1536138..1536248,1536455..1536577,1536866..1537023,
FT                   1537512..1537830))
FT                   /codon_start=1
FT                   /gene="3000004C01Rik"
FT                   /locus_tag="mCG_7449"
FT                   /product="RIKEN cDNA 3000004C01"
FT                   /note="gene_id=mCG7449.1 transcript_id=mCT6555.2
FT                   protein_id=mCP1169.2"
FT                   /protein_id="EDL34161.1"
FT                   /translation="MVMAVEDSVVRVVVRVRPPTPKELESQRRPVIQVVDERMLVFDPE
FT                   ECDGGFPGLKWSGSHNGPKKKGKDLTFVFDRVFGEMATQEDVFQHTTHNILDSFLQGYN
FT                   CSVFAYGATGAGKTHTMLGREGEPGIMYLTTMELYRRLEARQEEKQFEVLISYLEVYNE
FT                   QIHDLLEPKGPLTIREDPDKGVVVPGLSFHQVFAGPQPASAEQLLEMLTRGNCSRTQHP
FT                   TDANATSSRSHAIFQIFVKQQDRVPGLTQALRVAKMSLIDLAGSERASSTHAKGERLRE
FT                   GANINRSLLALINVLNALADAKGNLTQLRTYCRQGRKSHVPYRDSKLTRLLKDSIGGNC
FT                   RTVMIAAISPSSLTYEDTYNTLKYADRAKEIRLTLKSNVISVDHHISQYATICQQLQAE
FT                   VAFLREKLQMYEAGAQALQQQCSPQPPTLSIPQSLSSSSLQPGPSSQSSTLECHAKNET
FT                   LQEESLGSDAQGQEIVEESASEQEQCPQDKQCPTQKPEPNLPGSPSPSVQAKPGTGQHS
FT                   PQKQDADHSKQLALQVLRLAQRQYSLLQAANLLTPDMISEFETLQQLVLEESVDHRAES
FT                   PRSPALARGDPLAQALCSESKSSGYCGPVTRTMAKQLNGLTHTLGALLAPDCTSDKTFQ
FT                   KPTKEKKRKLTPEEPGSLPAPNLEMKRQRQSFLPCLRRGSLPKAQPCSEPRTPKRERAS
FT                   SPSPSSRVCPATVIKSRVPLGPSALQNCSTPLALPTRDLNTTFNVSEESPSKPSFQEFV
FT                   DWEKVSPELNSTDQPFLPSAPVFIFTKGRKPSLPAVTASKKRRTMRPSVSRGRSCIARL
FT                   HSSTLKKPNRPFTVPEPPLSPHCLDDQRTPKGLTGVTESY"
FT   gene            complement(1560720..>1567915)
FT                   /gene="C1ql1"
FT                   /locus_tag="mCG_7450"
FT                   /note="gene_id=mCG7450.2"
FT   mRNA            complement(join(1560720..1561366,1567319..>1567915))
FT                   /gene="C1ql1"
FT                   /locus_tag="mCG_7450"
FT                   /product="complement component 1, q subcomponent-like 1"
FT                   /note="gene_id=mCG7450.2 transcript_id=mCT6556.1 created on
FT                   22-JUL-2002"
FT   CDS             complement(join(1561187..1561366,1567319..1567915))
FT                   /codon_start=1
FT                   /gene="C1ql1"
FT                   /locus_tag="mCG_7450"
FT                   /product="complement component 1, q subcomponent-like 1"
FT                   /note="gene_id=mCG7450.2 transcript_id=mCT6556.1
FT                   protein_id=mCP1170.0"
FT                   /db_xref="GOA:O88992"
FT                   /db_xref="InterPro:IPR001073"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="MGI:MGI:1344400"
FT                   /db_xref="PDB:4D7Y"
FT                   /db_xref="PDB:4QQ2"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88992"
FT                   /protein_id="EDL34162.1"
FT                   /translation="MLLVLVVLIPVLVSSGGPDGHYEMLGTCRMVCDPYPARGPGAGAR
FT                   SDGGDALSEQSGAPPPSTLVQGPQGKPGRTGKPGPPGPPGDRGPPGPVGPPGEKGEPGK
FT                   PGPPGLPGSGGSGAISTATYTTVPRVAFYAGLKNPHEGYEVLKFDDVVTNLGNNYDAAS
FT                   GKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVIL
FT                   HLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD"
FT   assembly_gap    1571224..1571324
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   gene            complement(1579778..1585625)
FT                   /locus_tag="mCG_1042027"
FT                   /note="gene_id=mCG1042027.0"
FT   mRNA            complement(join(1579778..1580369,1583281..1583500,
FT                   1585493..1585625))
FT                   /locus_tag="mCG_1042027"
FT                   /product="mCG1042027"
FT                   /note="gene_id=mCG1042027.0 transcript_id=mCT159731.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(1580205..1580369,1583281..1583376))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042027"
FT                   /product="mCG1042027"
FT                   /note="gene_id=mCG1042027.0 transcript_id=mCT159731.0
FT                   protein_id=mCP75009.1"
FT                   /protein_id="EDL34163.1"
FT                   /translation="MMEVDQMAGMMELNPEGFLVVVGTICSTILLQCLYYRQSTLHLAF
FT                   GSFSSLQLEEQDVQVSKLCLMTLPLDPRGVALLCGLLIFNF"
FT   assembly_gap    1592723..1592742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1598579..1598755
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    1607536..1607915
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    1613286..1613564
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   gene            complement(1616418..1646001)
FT                   /gene="Dcakd"
FT                   /locus_tag="mCG_7448"
FT                   /note="gene_id=mCG7448.2"
FT   mRNA            complement(join(1616418..1617543,1619724..1619811,
FT                   1622016..1622219,1622522..1622728,1645902..1646001))
FT                   /gene="Dcakd"
FT                   /locus_tag="mCG_7448"
FT                   /product="dephospho-CoA kinase domain containing,
FT                   transcript variant mCT171104"
FT                   /note="gene_id=mCG7448.2 transcript_id=mCT171104.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(1616420..1617543,1619724..>1619921))
FT                   /gene="Dcakd"
FT                   /locus_tag="mCG_7448"
FT                   /product="dephospho-CoA kinase domain containing,
FT                   transcript variant mCT6554"
FT                   /note="gene_id=mCG7448.2 transcript_id=mCT6554.1 created on
FT                   23-JUL-2002"
FT   CDS             complement(join(1617252..1617543,1619724..1619811,
FT                   1622016..1622219,1622522..1622633))
FT                   /codon_start=1
FT                   /gene="Dcakd"
FT                   /locus_tag="mCG_7448"
FT                   /product="dephospho-CoA kinase domain containing, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG7448.2 transcript_id=mCT171104.0
FT                   protein_id=mCP94022.0 isoform=CRA_a"
FT                   /protein_id="EDL34164.1"
FT                   /translation="MFLVGLTGGIASGKSSVIQVFQQLGCAVIDVDVIARHVVQPGYPA
FT                   HRRIVEAFGTEVLLENGDIDRKVLGDLIFNQPDRRQLLNSITHPEIRKEMMKETFKYFL
FT                   RGYRYVILDIPLLFETKKLLKYMKHTVVVYCDRDTQLARLMKRNNLNREDAEARINAQL
FT                   PLKDKARMANHVLDNSGEWSLTRRQAILLHAKLERSMEYLPLRLGFLTGLAGIASLLYL
FT                   LTRYLLPSP"
FT   CDS             complement(join(1617252..1617543,1619724..>1619845))
FT                   /codon_start=1
FT                   /gene="Dcakd"
FT                   /locus_tag="mCG_7448"
FT                   /product="dephospho-CoA kinase domain containing, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG7448.2 transcript_id=mCT6554.1
FT                   protein_id=mCP1168.0 isoform=CRA_b"
FT                   /protein_id="EDL34165.1"
FT                   /translation="PWEFCILSLSPGYRYVILDIPLLFETKKLLKYMKHTVVVYCDRDT
FT                   QLARLMKRNNLNREDAEARINAQLPLKDKARMANHVLDNSGEWSLTRRQAILLHAKLER
FT                   SMEYLPLRLGFLTGLAGIASLLYLLTRYLLPSP"
FT   gene            1621481..1623023
FT                   /locus_tag="mCG_148156"
FT                   /note="gene_id=mCG148156.0"
FT   mRNA            1621481..1623023
FT                   /locus_tag="mCG_148156"
FT                   /product="mCG148156"
FT                   /note="gene_id=mCG148156.0 transcript_id=mCT188419.0
FT                   created on 13-JAN-2004"
FT   CDS             1622419..1622664
FT                   /codon_start=1
FT                   /locus_tag="mCG_148156"
FT                   /product="mCG148156"
FT                   /note="gene_id=mCG148156.0 transcript_id=mCT188419.0
FT                   protein_id=mCP109334.0"
FT                   /protein_id="EDL34166.1"
FT                   /translation="MKNKQKNLQGKRRPGHSKKTESNDGSTGDAAVHSPCRAMTSTSIT
FT                   AQPSCWNTWMTELLPEAMPPVSPTRNIFPGERRQAR"
FT   assembly_gap    1629736..1629755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1630776..1630795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1635861..1635880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1637433..1637452
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1641193..1643340
FT                   /estimated_length=2148
FT                   /gap_type="unknown"
FT   assembly_gap    1645266..1645390
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   gene            complement(1650803..>1657239)
FT                   /locus_tag="mCG_1042073"
FT                   /note="gene_id=mCG1042073.0"
FT   mRNA            complement(join(1650803..1650841,1651162..1651205,
FT                   1654233..1654357,1654434..1654464,1656267..1656428,
FT                   1657156..>1657239))
FT                   /locus_tag="mCG_1042073"
FT                   /product="mCG1042073"
FT                   /note="gene_id=mCG1042073.0 transcript_id=mCT159777.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(1650816..1650841,1651162..1651205,
FT                   1654233..1654357,1654434..1654464,1656267..>1656367))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042073"
FT                   /product="mCG1042073"
FT                   /note="gene_id=mCG1042073.0 transcript_id=mCT159777.0
FT                   protein_id=mCP75467.0"
FT                   /protein_id="EDL34167.1"
FT                   /translation="ICIYLLCALCKASPSHQSHCWIQATSKDESVIARSPAEGVAQIKS
FT                   PERCVLSCLDLSFLWPLCLKISMPRSRSECCVFQPQEGDHRASFEWKYICSDERPKPRG
FT                   QLCF"
FT   assembly_gap    1650846..1651145
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    1652874..1652955
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    1653449..1653657
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   gene            1657352..1694267
FT                   /gene="Nmt1"
FT                   /locus_tag="mCG_19151"
FT                   /note="gene_id=mCG19151.2"
FT   mRNA            join(1657352..1657709,1672139..1672247,1675350..1675494,
FT                   1680561..1680679,1683551..1683642,1684736..1684852,
FT                   1685718..1685888,1686558..1686666,1688431..1688601,
FT                   1692438..1692467,1693222..1693359,1694212..1694267)
FT                   /gene="Nmt1"
FT                   /locus_tag="mCG_19151"
FT                   /product="N-myristoyltransferase 1"
FT                   /note="gene_id=mCG19151.2 transcript_id=mCT17742.2 created
FT                   on 23-JUL-2002"
FT   CDS             join(1657579..1657709,1672139..1672247,1675350..1675494,
FT                   1680561..1680679,1683551..1683642,1684736..1684852,
FT                   1685718..1685888,1686558..1686666,1688431..1688601,
FT                   1692438..1692467,1693222..1693359,1694212..1694232)
FT                   /codon_start=1
FT                   /gene="Nmt1"
FT                   /locus_tag="mCG_19151"
FT                   /product="N-myristoyltransferase 1"
FT                   /note="gene_id=mCG19151.2 transcript_id=mCT17742.2
FT                   protein_id=mCP14660.1"
FT                   /protein_id="EDL34168.1"
FT                   /translation="MADESETAVKLPAPSLPLMMEGNGNGHEHCSDCENEEDNSHNRSG
FT                   LSPANDTGAKKKKKKQKKKKEKGSDMESTQDQPVKMTSLPAERIQEIQKAIELFSVGQG
FT                   PAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDL
FT                   GDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKL
FT                   VGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVY
FT                   TAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRP
FT                   MEKKDIPVVHQLLSRYLKQFHLTPVMNQEEVEHWFYPQENIIDTFVVEMSDALVLAKMK
FT                   GFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ"
FT   assembly_gap    1660086..1660105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1662089..1662668
FT                   /estimated_length=580
FT                   /gap_type="unknown"
FT   assembly_gap    1692149..1692436
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   gene            complement(1698768..1720947)
FT                   /gene="Plcd3"
FT                   /locus_tag="mCG_19166"
FT                   /note="gene_id=mCG19166.2"
FT   mRNA            complement(join(1698768..1699393,1699474..1699623,
FT                   1699719..1699854,1700105..1700271,1702193..1702309,
FT                   1703024..1703174,1703322..1703468,1705179..1705331,
FT                   1705947..1706091,1706226..1706427,1706704..1706932,
FT                   1708005..1708134,1708657..1708885,1708975..1709137,
FT                   1720720..1720947))
FT                   /gene="Plcd3"
FT                   /locus_tag="mCG_19166"
FT                   /product="phospholipase C, delta 3"
FT                   /note="gene_id=mCG19166.2 transcript_id=mCT17870.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(1699305..1699393,1699474..1699623,
FT                   1699719..1699854,1700105..1700271,1702193..1702309,
FT                   1703024..1703174,1703322..1703468,1705179..1705331,
FT                   1705947..1706091,1706226..1706427,1706704..1706932,
FT                   1708005..1708134,1708657..1708885,1708975..1709125))
FT                   /codon_start=1
FT                   /gene="Plcd3"
FT                   /locus_tag="mCG_19166"
FT                   /product="phospholipase C, delta 3"
FT                   /note="gene_id=mCG19166.2 transcript_id=mCT17870.2
FT                   protein_id=mCP14643.2"
FT                   /protein_id="EDL34169.1"
FT                   /translation="MRMSKPCCGAPDSSRSAHARGTRQRLYRLQEDGLSVWFQRRIPRA
FT                   ASKHIFFVQHIEAVREGHQSEGLRRFGGAFAPACCLTIAFKGRRKNLDLAAPTAEEAQR
FT                   WVRGLAKLRARLDAMSQRERLDHWIHSYLHRADSDQDSKMSFKEIKSLLRMVNVDMNDM
FT                   YAYRLFKECDHSNNERLEGAEIEAFLRRLLKRPELEEIFRRYSGEDRVLSASELLEFLE
FT                   DQGEDGATLACAQQLIQTYELNETAKQHELMTLDGFMMYLLSPEGAALNVAHTCVFQDM
FT                   GQPLAHYFISSSHNTYLTDSQIGGTSSTEAYIRAFAQGCRCVELDCWEGPGGEPVIYHG
FT                   HTLTSKILFRDVIQAVRDHAFTSSPYPVILSLENHCGLEQQAVMARHLRSILGDMLVTQ
FT                   ALDSQNPEELPSPEQLKGRILVKGKKLPAARSEDGRILSDREEEEEEEEEAEEALEAAE
FT                   QRSRAKQISPELSALAVYCCATRLRTLDPSPGPPQSCTVGSLSERKARKFTREAGTSFV
FT                   RHNTQQLTRVYPLGLRMNSANYNPQEMWNSGCQLVALNFQTPGYEMDLNTGRFLINGQC
FT                   GYVLKPAYLRQLNTTFDPECPGPPRTTLAIQVLTAQQLPKLNAEKPSSIVDPLVRVEIH
FT                   GVPEDCAQKETDYVLNNGFNPCWEQTLQFRLRAPELVLVRFVVEDYDTTSPNDFVGQST
FT                   LPLSSLKQGYRHIHLLSKDGASLAPATLFVHIRIQNS"
FT   assembly_gap    1709245..1709409
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   gene            <1721033..1731542
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /note="gene_id=mCG19167.3"
FT   mRNA            join(<1721033..1721129,1722023..1722437,1722867..1723003,
FT                   1723459..1723518,1723779..1723899,1724149..1724235,
FT                   1724591..1724824,1725441..1725580,1730885..1731542)
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   transcript variant mCT193198"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT193198.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1721050..1721129,1722023..1722437,1722576..1722710,
FT                   1722867..1722985,1723241..1723361,1723434..1723518,
FT                   1723779..1723899,1724149..1724235,1724591..1724824,
FT                   1725441..1725580,1730885..1731542)
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   transcript variant mCT17871"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT17871.2 created
FT                   on 05-SEP-2002"
FT   mRNA            join(<1722023..1722437,1722867..1722985,1723241..1723361,
FT                   1723434..1723518,1723779..1723899,1724149..1724235,
FT                   1724591..1724824,1725441..1725580,1730885..1731525)
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   transcript variant mCT193197"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT193197.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1722359..1722437,1722576..1722710,1722867..1722985,
FT                   1723434..1723518,1723779..1723899,1724149..1724235,
FT                   1724591..1724824,1725441..1725580,1730885..1731542)
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   transcript variant mCT172763"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT172763.0 created
FT                   on 05-SEP-2002"
FT   CDS             join(<1722380..1722437,1722867..1723003,1723459..1723518,
FT                   1723779..1723899,1724149..1724235,1724591..1724824,
FT                   1725441..1725580,1730885..1731004)
FT                   /codon_start=1
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT193198.0
FT                   protein_id=mCP114154.0 isoform=CRA_c"
FT                   /protein_id="EDL34172.1"
FT                   /translation="LCIPPYPCPSGTRGQSEASESLQSRAPELEAAWVPRRKSPTVKNS
FT                   SRQQSASFRTCLRMVSLYRSMSREEAMSAYISEMKLVAQKVIDTVPLGEVAEDMFGYFE
FT                   PLYQVIPDMPRPPETFLRRATGWKEPLVQREDQAAPEPSCVPKEPVPPSPESRPPRDLD
FT                   LEVFCDSVEQLEPELVRLPVLSPVAAEPELCHLPPGIWDSSAQQVWAEQKEAAGRELTT
FT                   RSSPESTGEKEGLGGGLIGPQELDTWLVGTVRAMQESMKDVHRRLQSLESKPQPLKQRS
FT                   PRTRPWPLGLSVPTLLFFILWPFVVQWLFRQFRTQKR"
FT   CDS             join(<1722883..1722985,1723241..1723361,1723434..1723518,
FT                   1723779..1723899,1724149..1724235,1724591..1724824,
FT                   1725441..1725580,1730885..1731004)
FT                   /codon_start=1
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT193197.0
FT                   protein_id=mCP114153.0 isoform=CRA_b"
FT                   /protein_id="EDL34171.1"
FT                   /translation="GSRARSSMGTEKEEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEML
FT                   RFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNRLGKMSREEAMSAYISEMKLVAQKV
FT                   IDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRATGWKEPLVQREDQAAPEPSCV
FT                   PKEPVPPSPESRPPRDLDLEVFCDSVEQLEPELVRLPVLSPVAAEPELCHLPPGIWDSS
FT                   AQQVWAEQKEAAGRELTTRSSPESTGEKEGLGGGLIGPQELDTWLVGTVRAMQESMKDV
FT                   HRRLQSLESKPQPLKQRSPRTRPWPLGLSVPTLLFFILWPFVVQWLFRQFRTQKR"
FT   CDS             join(1722904..1722985,1723241..1723361,1723434..1723518,
FT                   1723779..1723899,1724149..1724235,1724591..1724824,
FT                   1725441..1725580,1730885..1731004)
FT                   /codon_start=1
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT17871.2
FT                   protein_id=mCP14667.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q80X94"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR022408"
FT                   /db_xref="MGI:MGI:1914381"
FT                   /db_xref="UniProtKB/TrEMBL:Q80X94"
FT                   /protein_id="EDL34170.1"
FT                   /translation="MGTEKEEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYK
FT                   QATMGPCLVPRPGFWDPIGRYKWDAWNRLGKMSREEAMSAYISEMKLVAQKVIDTVPLG
FT                   EVAEDMFGYFEPLYQVIPDMPRPPETFLRRATGWKEPLVQREDQAAPEPSCVPKEPVPP
FT                   SPESRPPRDLDLEVFCDSVEQLEPELVRLPVLSPVAAEPELCHLPPGIWDSSAQQVWAE
FT                   QKEAAGRELTTRSSPESTGEKEGLGGGLIGPQELDTWLVGTVRAMQESMKDVHRRLQSL
FT                   ESKPQPLKQRSPRTRPWPLGLSVPTLLFFILWPFVVQWLFRQFRTQKR"
FT   CDS             join(1723459..1723518,1723779..1723899,1724149..1724235,
FT                   1724591..1724824,1725441..1725580,1730885..1731004)
FT                   /codon_start=1
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT172763.0
FT                   protein_id=mCP95682.0 isoform=CRA_d"
FT                   /protein_id="EDL34173.1"
FT                   /translation="MSREEAMSAYISEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI
FT                   PDMPRPPETFLRRATGWKEPLVQREDQAAPEPSCVPKEPVPPSPESRPPRDLDLEVFCD
FT                   SVEQLEPELVRLPVLSPVAAEPELCHLPPGIWDSSAQQVWAEQKEAAGRELTTRSSPES
FT                   TGEKEGLGGGLIGPQELDTWLVGTVRAMQESMKDVHRRLQSLESKPQPLKQRSPRTRPW
FT                   PLGLSVPTLLFFILWPFVVQWLFRQFRTQKR"
FT   gene            1735595..1739064
FT                   /gene="Hexim1"
FT                   /locus_tag="mCG_19165"
FT                   /note="gene_id=mCG19165.2"
FT   mRNA            1735595..1739064
FT                   /gene="Hexim1"
FT                   /locus_tag="mCG_19165"
FT                   /product="hexamethylene bis-acetamide inducible 1,
FT                   transcript variant mCT17869"
FT                   /note="gene_id=mCG19165.2 transcript_id=mCT17869.2 created
FT                   on 23-JUL-2002"
FT   mRNA            join(1735595..1737490,1737537..1739064)
FT                   /gene="Hexim1"
FT                   /locus_tag="mCG_19165"
FT                   /product="hexamethylene bis-acetamide inducible 1,
FT                   transcript variant mCT171084"
FT                   /note="gene_id=mCG19165.2 transcript_id=mCT171084.0 created
FT                   on 23-JUL-2002"
FT   CDS             1736265..1737335
FT                   /codon_start=1
FT                   /gene="Hexim1"
FT                   /locus_tag="mCG_19165"
FT                   /product="hexamethylene bis-acetamide inducible 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19165.2 transcript_id=mCT17869.2
FT                   protein_id=mCP14653.1 isoform=CRA_a"
FT                   /protein_id="EDL34174.1"
FT                   /translation="MAEPLLTEHQHQPQTSNCTGAAVVHEEHTSERPPSAEERVPKEDS
FT                   RWQSRASLQSGSRPGQEGEGGLKHQLPPLQTNACPELSSLEKGEKGQNGEDLSTGGASP
FT                   SAEGEPMSESLVQPGHDSEATKQEAPAAGGEEPWGQQQRQLGKKKHRRRPSKKKRHWKP
FT                   YYKLTWEEKKKFDEKQSLRASRVRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLY
FT                   PKRAAAKSDDTSDEDFVEEAGEEDGGSDGMGGDGSEFLQRDFSETYERYHAESLQNMSK
FT                   QELIKEYLELEKCLSRKEDENNRLRLESKRLGGVDARVRELELELDRLRAENLQLLTEN
FT                   ELHRQQERAPLSKFGD"
FT   CDS             1736265..1737335
FT                   /codon_start=1
FT                   /gene="Hexim1"
FT                   /locus_tag="mCG_19165"
FT                   /product="hexamethylene bis-acetamide inducible 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19165.2 transcript_id=mCT171084.0
FT                   protein_id=mCP94002.0 isoform=CRA_a"
FT                   /protein_id="EDL34175.1"
FT                   /translation="MAEPLLTEHQHQPQTSNCTGAAVVHEEHTSERPPSAEERVPKEDS
FT                   RWQSRASLQSGSRPGQEGEGGLKHQLPPLQTNACPELSSLEKGEKGQNGEDLSTGGASP
FT                   SAEGEPMSESLVQPGHDSEATKQEAPAAGGEEPWGQQQRQLGKKKHRRRPSKKKRHWKP
FT                   YYKLTWEEKKKFDEKQSLRASRVRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLY
FT                   PKRAAAKSDDTSDEDFVEEAGEEDGGSDGMGGDGSEFLQRDFSETYERYHAESLQNMSK
FT                   QELIKEYLELEKCLSRKEDENNRLRLESKRLGGVDARVRELELELDRLRAENLQLLTEN
FT                   ELHRQQERAPLSKFGD"
FT   assembly_gap    1752436..1755200
FT                   /estimated_length=2765
FT                   /gap_type="unknown"
FT   assembly_gap    1756335..1756548
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   gene            <1757645..1759355
FT                   /locus_tag="mCG_19152"
FT                   /note="gene_id=mCG19152.2"
FT   mRNA            <1757645..1759355
FT                   /locus_tag="mCG_19152"
FT                   /product="mCG19152"
FT                   /note="gene_id=mCG19152.2 transcript_id=mCT17743.2 created
FT                   on 06-SEP-2002"
FT   CDS             <1757645..1758523
FT                   /codon_start=1
FT                   /locus_tag="mCG_19152"
FT                   /product="mCG19152"
FT                   /note="gene_id=mCG19152.2 transcript_id=mCT17743.2
FT                   protein_id=mCP14670.2"
FT                   /protein_id="EDL34176.1"
FT                   /translation="TSGGLRSPQIAHEPHDFGGSQLLPSGQEIQSEDEGTVPAGDGSSC
FT                   NIRGSRTQSPGGCSVEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASR
FT                   VREEMFAKGQPLAPYNTTQFLMNDRDLEEPNLDVLHGPSHSGSGGENEAGDSDGQGRAH
FT                   GEFQQRDFSEAYERYHTESLQGRSKQELVRDYLDLERRLSQAEQETRRLRQLQGCSSRQ
FT                   PCQQVEELAAEVERLRTENQRLRQENEMWNREGGYCDQEKPASEGTPWPKGEAPFQTHT
FT                   GQLGHREAGDR"
FT   assembly_gap    1760838..1763033
FT                   /estimated_length=2196
FT                   /gap_type="unknown"
FT   assembly_gap    1765337..1765356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1782396..1782677
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    1783624..1784758
FT                   /estimated_length=1135
FT                   /gap_type="unknown"
FT   assembly_gap    1790562..1790707
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   gene            1790708..1821416
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /note="gene_id=mCG19154.2"
FT   mRNA            join(1790708..1790989,1799067..1799150,1800433..1800546,
FT                   1801259..1801332,1801636..1801719,1802192..1802317,
FT                   1805170..1805278,1805960..1806036,1806694..1806787,
FT                   1812500..1812574,1812870..1812980,1814600..1814749,
FT                   1815264..1815365,1815535..1815787,1815981..1816268,
FT                   1816461..1816585,1817158..1817360,1817791..1818025,
FT                   1818142..1818210,1818793..1818873,1818948..1819077,
FT                   1819217..1819380,1819610..1819711,1819847..1819927,
FT                   1820190..1820310,1821004..1821416)
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /product="formin-like 1, transcript variant mCT171079"
FT                   /note="gene_id=mCG19154.2 transcript_id=mCT171079.0 created
FT                   on 23-JUL-2002"
FT   mRNA            join(1790708..1790989,1799067..1799150,1800433..1800546,
FT                   1801259..1801332,1801636..1801719,1802192..1802317,
FT                   1805170..1805278,1805960..1806036,1806694..1806787,
FT                   1812500..1812574,1812870..1812980,1814600..1814749,
FT                   1815264..1815365,1815535..1815787,1815981..1816268,
FT                   1816461..1816585,1817158..1817360,1817791..1818025,
FT                   1818142..1818210,1818793..1818873,1818948..1819077,
FT                   1819217..1819380,1819610..1819711,1819847..1819927,
FT                   1820190..1820310,1820655..>1820746)
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /product="formin-like 1, transcript variant mCT17746"
FT                   /note="gene_id=mCG19154.2 transcript_id=mCT17746.2 created
FT                   on 23-JUL-2002"
FT   CDS             join(1790861..1790989,1799067..1799150,1800433..1800546,
FT                   1801259..1801332,1801636..1801719,1802192..1802317,
FT                   1805170..1805278,1805960..1806036,1806694..1806787,
FT                   1812500..1812574,1812870..1812980,1814600..1814749,
FT                   1815264..1815365,1815535..1815787,1815981..1816268,
FT                   1816461..1816585,1817158..1817360,1817791..1818025,
FT                   1818142..1818210,1818793..1818873,1818948..1819077,
FT                   1819217..1819380,1819610..1819711,1819847..1819927,
FT                   1820190..1820310,1821004..1821107)
FT                   /codon_start=1
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /product="formin-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG19154.2 transcript_id=mCT171079.0
FT                   protein_id=mCP93997.0 isoform=CRA_b"
FT                   /protein_id="EDL34178.1"
FT                   /translation="MGNAAGSAEQPAGPTASPPKQPAVPKQPMPAAGELEERFTRVLNC
FT                   MNLPPDKVQLLSQYDNEKKWELICDQERFQVKNPPAAYIQKLKSYLDTGGVSRKVASDW
FT                   MSNLGFKRRVQESTQVLRELETSLRTNHIGWVQEFLNEENRGLDVLLEYLAFAQCSVAY
FT                   DMESTDSVASGAEKSKPLDQSVEDLSKAPPSSVPKSRLTIKLTPAHSRKALRNSRIVSQ
FT                   KDDVHVCIMCLRAIMNYQSGFSLVMNHPACVNEIALSLNNKSPRTKALVLELLAAVCLV
FT                   RGGHDIILAAFDNFKEVCGEQHRFEKLMEYFRHEDSNIDFMVACMQFINIVVHSVENMN
FT                   FRVFLQYEFTHLGLDLYLERLRLTESDKLQVQIQAYLDNVFDVGTLLEETETKNAVLEH
FT                   MEELQEQVATLTERLRDTENDSMAKIAELEKQLSQARKELETLRERFSESTPMGTSRRI
FT                   PEPEKVPVPTVVRPSALELKVEELEEKGLIRILRGPGDVVSIEILPGAAATPSGDDAQA
FT                   PRVSTDSPSTAESIPEAASPPPPPPPPPPPLPNLQSQQEAPPSAPPLAPPLPGCAEPPP
FT                   APPLPGDLPPPPPPPPLGTDGPVPPPPPPPPGGPPDILGGQGPDIGPGVKAKKPIQTKF
FT                   RMPLLNWVALKPSQITGTVFTELNDEKVLQELDMNDFEEHFKTKSQGPCLDISALKGKA
FT                   SQKAPTKTILIEANRAKNLAITLRKGNLGADRICQAIETYDLQTLSLDFLELLTRFLPT
FT                   DYERSLIARFEKEQRPMEELSEEDRFMLRFSRIQRLPERMNTLTFLGNFPDTAQLLMPQ
FT                   LNAIIAASMSIKSSDKLRQILEIVLAFGNYMNSSKRGAAYGFRLQSLDALLEMKSTDRK
FT                   QTLLHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDSVLGDVRSLQRGLELTQREFVR
FT                   QDDCLVLKEFLRANSPTMDKLLADSKTAQEAYESVVEYFGENPKTTSPSMFFSLFSRFT
FT                   KAYKKAEQEVEQWKKEAAADTSGREEPPTPKSPPKARRQQMDLISELKRKQQKEPLIYE
FT                   SDRDGAIEDIITDLRNQPYIRADTGRRSARRRPPGPPLPVTTDLAL"
FT   CDS             join(1790861..1790989,1799067..1799150,1800433..1800546,
FT                   1801259..1801332,1801636..1801719,1802192..1802317,
FT                   1805170..1805278,1805960..1806036,1806694..1806787,
FT                   1812500..1812574,1812870..1812980,1814600..1814749,
FT                   1815264..1815365,1815535..1815787,1815981..1816268,
FT                   1816461..1816585,1817158..1817360,1817791..1818025,
FT                   1818142..1818210,1818793..1818873,1818948..1819077,
FT                   1819217..1819380,1819610..1819711,1819847..1819927,
FT                   1820190..1820310,1820655..1820746)
FT                   /codon_start=1
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /product="formin-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG19154.2 transcript_id=mCT17746.2
FT                   protein_id=mCP14678.2 isoform=CRA_c"
FT                   /db_xref="GOA:A2AB60"
FT                   /db_xref="InterPro:IPR010472"
FT                   /db_xref="InterPro:IPR010473"
FT                   /db_xref="InterPro:IPR014767"
FT                   /db_xref="InterPro:IPR014768"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027657"
FT                   /db_xref="MGI:MGI:1888994"
FT                   /db_xref="UniProtKB/TrEMBL:A2AB60"
FT                   /protein_id="EDL34179.1"
FT                   /translation="MGNAAGSAEQPAGPTASPPKQPAVPKQPMPAAGELEERFTRVLNC
FT                   MNLPPDKVQLLSQYDNEKKWELICDQERFQVKNPPAAYIQKLKSYLDTGGVSRKVASDW
FT                   MSNLGFKRRVQESTQVLRELETSLRTNHIGWVQEFLNEENRGLDVLLEYLAFAQCSVAY
FT                   DMESTDSVASGAEKSKPLDQSVEDLSKAPPSSVPKSRLTIKLTPAHSRKALRNSRIVSQ
FT                   KDDVHVCIMCLRAIMNYQSGFSLVMNHPACVNEIALSLNNKSPRTKALVLELLAAVCLV
FT                   RGGHDIILAAFDNFKEVCGEQHRFEKLMEYFRHEDSNIDFMVACMQFINIVVHSVENMN
FT                   FRVFLQYEFTHLGLDLYLERLRLTESDKLQVQIQAYLDNVFDVGTLLEETETKNAVLEH
FT                   MEELQEQVATLTERLRDTENDSMAKIAELEKQLSQARKELETLRERFSESTPMGTSRRI
FT                   PEPEKVPVPTVVRPSALELKVEELEEKGLIRILRGPGDVVSIEILPGAAATPSGDDAQA
FT                   PRVSTDSPSTAESIPEAASPPPPPPPPPPPLPNLQSQQEAPPSAPPLAPPLPGCAEPPP
FT                   APPLPGDLPPPPPPPPLGTDGPVPPPPPPPPGGPPDILGGQGPDIGPGVKAKKPIQTKF
FT                   RMPLLNWVALKPSQITGTVFTELNDEKVLQELDMNDFEEHFKTKSQGPCLDISALKGKA
FT                   SQKAPTKTILIEANRAKNLAITLRKGNLGADRICQAIETYDLQTLSLDFLELLTRFLPT
FT                   DYERSLIARFEKEQRPMEELSEEDRFMLRFSRIQRLPERMNTLTFLGNFPDTAQLLMPQ
FT                   LNAIIAASMSIKSSDKLRQILEIVLAFGNYMNSSKRGAAYGFRLQSLDALLEMKSTDRK
FT                   QTLLHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDSVLGDVRSLQRGLELTQREFVR
FT                   QDDCLVLKEFLRANSPTMDKLLADSKTAQEAYESVVEYFGENPKTTSPSMFFSLFSRFT
FT                   KAYKKAEQEVEQWKKEAAADTSGREEPPTPKSPPKARRQQMDLISELKRKQQKEPLIYE
FT                   SDRDGAIEDIITVLKTVPFTARTGKRTSRLLCEASLGEEMTL"
FT   assembly_gap    1806236..1806255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1807371..1807390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1808807..1808826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<1808982..1809063,1809189..1809282,1812500..1812574,
FT                   1812870..1813232)
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /product="formin-like 1, transcript variant mCT132879"
FT                   /note="gene_id=mCG19154.2 transcript_id=mCT132879.1 created
FT                   on 23-JUL-2002"
FT   CDS             join(<1808984..1809063,1809189..1809282,1812500..1812574,
FT                   1812870..1813004)
FT                   /codon_start=1
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /product="formin-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG19154.2 transcript_id=mCT132879.1
FT                   protein_id=mCP75504.1 isoform=CRA_a"
FT                   /protein_id="EDL34177.1"
FT                   /translation="QSGFSLVMNHPACVNEIALSLNNKSPRTKALVLELLAAVCLVRGG
FT                   HDIILAAFDNFKEVCGEQHRFEKLMEYFRHEDSNIDFMVACMQFINIVVHSVENMNFRV
FT                   FLQYEFTHLGLDLYLEVSLVPHP"
FT   assembly_gap    1815839..1815858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1821240..1824282)
FT                   /locus_tag="mCG_141021"
FT                   /note="gene_id=mCG141021.1"
FT   mRNA            complement(join(1821240..1821639,1821839..1821991,
FT                   1822168..1822343,1822584..1822704,1822789..1822860,
FT                   1823311..1823454,1823616..1823695,1823784..1823998,
FT                   1824237..1824282))
FT                   /locus_tag="mCG_141021"
FT                   /product="mCG141021, transcript variant mCT172748"
FT                   /note="gene_id=mCG141021.1 transcript_id=mCT172748.1
FT                   created on 04-APR-2003"
FT   CDS             complement(join(1821482..1821639,1821839..1821991,
FT                   1822168..1822343,1822584..1822704,1822789..1822860,
FT                   1823311..1823454,1823616..1823695,1823784..1823854))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141021"
FT                   /product="mCG141021, isoform CRA_b"
FT                   /note="gene_id=mCG141021.1 transcript_id=mCT172748.1
FT                   protein_id=mCP95667.1 isoform=CRA_b"
FT                   /protein_id="EDL34181.1"
FT                   /translation="MRDLKNPSEANQPYWSGPDDRSQRYYMSNFFLRSSSADDSLLPLT
FT                   PRQLAAFQDIFKLFSCSPTGTVDMQSMKIALRNAGIQLGPQEMCEALRLADLDGDGIVS
FT                   FKDFLGVLTDNHRLAQCMGQMKGNRVGEPPGLQTLFLEVLFKLLSQGFVPPKSRQEVTS
FT                   YYFKKQQALRMSLCARNRARQGRPARAHTGLTFFCQAARLNGLSSSQLARSLHTLCRAG
FT                   GRSPYTQIPNLAGRPRPERKARVPGSDVRLPKPQQPGRPKLPPNLGPLSKGPLRPPAGL
FT                   TSQPLEQMRPSKLASSPPTLVQKHPSSPSPACFQRCAMKSLYK"
FT   mRNA            complement(join(<1822811..1822860,1823311..1823454,
FT                   1823616..1823662,1823784..1824008,1824237..1824282))
FT                   /locus_tag="mCG_141021"
FT                   /product="mCG141021, transcript variant mCT181663"
FT                   /note="gene_id=mCG141021.1 transcript_id=mCT181663.0
FT                   created on 04-APR-2003"
FT   CDS             complement(join(<1822811..1822860,1823311..1823454,
FT                   1823616..1823662,1823784..1823854))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141021"
FT                   /product="mCG141021, isoform CRA_a"
FT                   /note="gene_id=mCG141021.1 transcript_id=mCT181663.0
FT                   protein_id=mCP104585.0 isoform=CRA_a"
FT                   /protein_id="EDL34180.1"
FT                   /translation="MRDLKNPSEANQPYWSGPDDRSQSSADDSLLPLTPRQLAAFQDIF
FT                   KLFSCSPTGTVDMQSMKIALRNAGIQLGPQEMCEALRLADLDGDGIVSFKDFLGVLTDN
FT                   "
FT   assembly_gap    1826344..1826363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1829593..1829612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1831708..1842018)
FT                   /gene="4933400C05Rik"
FT                   /locus_tag="mCG_141022"
FT                   /note="gene_id=mCG141022.0"
FT   mRNA            complement(join(1831708..1831824,1832342..1833126,
FT                   1833389..1833452,1834319..1834373,1841927..1842018))
FT                   /gene="4933400C05Rik"
FT                   /locus_tag="mCG_141022"
FT                   /product="RIKEN cDNA 4933400C05"
FT                   /note="gene_id=mCG141022.0 transcript_id=mCT172749.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(1831737..1831824,1832342..1833126,
FT                   1833389..1833452,1834319..1834373,1841927..1841939))
FT                   /codon_start=1
FT                   /gene="4933400C05Rik"
FT                   /locus_tag="mCG_141022"
FT                   /product="RIKEN cDNA 4933400C05"
FT                   /note="gene_id=mCG141022.0 transcript_id=mCT172749.0
FT                   protein_id=mCP95668.0"
FT                   /db_xref="GOA:Q8C5V0"
FT                   /db_xref="InterPro:IPR029297"
FT                   /db_xref="MGI:MGI:3045340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C5V0"
FT                   /protein_id="EDL34182.1"
FT                   /translation="MGVTGISTFPCCGKDSVDIVERQSDHHRHHHHHTHEENEDEDTEV
FT                   EAELPRTEPPPKVDPELGPVPQLEEMEPELPSKTTPETEGDSYTESPEQQNYRMESLKP
FT                   YEEEEMGGRYRSIPVQTSKHLFWSNKLIQASEHSLQKALEKHHRSPQEKSISISQVYTE
FT                   CTQPPSSPPVSRPTTPTAIGLADLINFASSLAVASSSNMALPNLENMIKGTSEKSQNTS
FT                   LDFCQPVQAIKFAQATQITQISSEKQDESPKSMAHKSWTRETRNVACSYLDINQAGLKT
FT                   ATIQGEVKFVQTPIASPQLQEAKEDSVPGTKKGNPLLLKIHFKLSSPQPQRND"
FT   gene            complement(1844390..1891009)
FT                   /gene="Map3k14"
FT                   /locus_tag="mCG_19156"
FT                   /note="gene_id=mCG19156.2"
FT   mRNA            complement(join(1844390..1844774,1845084..1845184,
FT                   1847960..1848104,1848748..1848854,1849004..1849336,
FT                   1850701..1850851,1851246..1851409,1854056..1854160,
FT                   1854750..1854881,1855075..1855204,1861203..1861340,
FT                   1862639..1863259,1863339..1863549,1864745..1864814,
FT                   1865872..1866146,1890957..1891009))
FT                   /gene="Map3k14"
FT                   /locus_tag="mCG_19156"
FT                   /product="mitogen-activated protein kinase kinase kinase
FT                   14, transcript variant mCT17748"
FT                   /note="gene_id=mCG19156.2 transcript_id=mCT17748.2 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(1844390..1844774,1845084..1845184,
FT                   1847960..1848104,1848748..1848854,1849004..1849336,
FT                   1850701..1850851,1851246..1851409,1854056..1854160,
FT                   1854750..1854881,1855075..1855204,1861203..1861340,
FT                   1862639..1863259,1863339..1863841))
FT                   /gene="Map3k14"
FT                   /locus_tag="mCG_19156"
FT                   /product="mitogen-activated protein kinase kinase kinase
FT                   14, transcript variant mCT171080"
FT                   /note="gene_id=mCG19156.2 transcript_id=mCT171080.0 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(1844610..1844774,1845084..1845184,
FT                   1847960..1848104,1848748..1848854,1849004..1849336,
FT                   1850701..1850851,1851246..1851409,1854056..1854160,
FT                   1854750..1854881,1855075..1855204,1861203..1861340,
FT                   1862639..1863259,1863339..1863549,1864745..1864814,
FT                   1865872..1866127))
FT                   /codon_start=1
FT                   /gene="Map3k14"
FT                   /locus_tag="mCG_19156"
FT                   /product="mitogen-activated protein kinase kinase kinase
FT                   14, isoform CRA_a"
FT                   /note="gene_id=mCG19156.2 transcript_id=mCT17748.2
FT                   protein_id=mCP14606.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q544K4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017425"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1858204"
FT                   /db_xref="UniProtKB/TrEMBL:Q544K4"
FT                   /protein_id="EDL34183.1"
FT                   /translation="MAVMEVACPGTPGSAVGQQKELAKAKEKTQSLGKKQSCIFKLEAV
FT                   EKSPVFCGKWEILNDVITKGTAKDGSEGGPPAISIIAQAECENSQEFSPTFSERIFIAG
FT                   SQQYSQSESLDQIPNNVAHATEGKMARVCRRGKRHGKARKKRRKKRSKSLAQAGVALAK
FT                   PLPRTPEQESCTIPVQEDESPLGNLYARNVSQFTKPLGGPGLGHLCFKKQDEGLRPVLP
FT                   RPELHKLISPLQCLNHVWKLHHPQATGPRPHPTHPFPYSGMPHPFPFYPLEPWKPYMLD
FT                   SAVLDKLAGVSGQRPLPGPPHLSQLAHGDSQKPLPGPHLESSCPSRGALEKVPVEEYLV
FT                   HALQGSVSSGQAHSLASLAKTWSSGSAKLQRLGPETEDNEGVLLTEKLKPVDYEYREEV
FT                   HWMTHQPRVGRGSFGEVHRMKDKQTGFQCAVKKVRLEVFRVEELVACAGLSSPRIVPLY
FT                   GAVREGPWVNIFMELLEGGSLGQLIKQMGCLPEDRALYYLGQALEGLEYLHTRRILHGD
FT                   VKADNVLLSSDGSRAALCDFGHALCLQPDGLGKSLLTGDYIPGTETHMAPEVVMGKPCD
FT                   AKVDIWSSCCMMLHMLNGCHPWTQYFRGPLCLKIASEPPPIREIPPSCAPLTAQAIQEG
FT                   LRKEPVHRASAMELRRKVGKALQEVGGLKSPWKGEYKEPRPPPQDQATCHQTLPTPPRE
FT                   NPPAKANTDGAPEPQPPLPPEPPEPSKAPALNLSKEESGTWEPLPLSSLDPATAKGPSF
FT                   PDRRATLPELELQQLEIELFLNSLSQPFSLEEQEQILSCLSIDSLSLSDDSEKNPSKAS
FT                   QSSRDTLSSGVHSWNSQAEARTCSCSTALARGRPTDIPSYFNGVKVQIQSLNGEHLHIR
FT                   EFHRVKVGDIATGISSQIPATAFSLVTKDGQPVCYDMEVPDSGIDLQCTLAPDGSFAWT
FT                   WRVKHGQLENRP"
FT   CDS             complement(join(1844610..1844774,1845084..1845184,
FT                   1847960..1848104,1848748..1848854,1849004..1849336,
FT                   1850701..1850851,1851246..1851409,1854056..1854160,
FT                   1854750..1854881,1855075..1855204,1861203..1861340,
FT                   1862639..1863259,1863339..1863575))
FT                   /codon_start=1
FT                   /gene="Map3k14"
FT                   /locus_tag="mCG_19156"
FT                   /product="mitogen-activated protein kinase kinase kinase
FT                   14, isoform CRA_b"
FT                   /note="gene_id=mCG19156.2 transcript_id=mCT171080.0
FT                   protein_id=mCP93998.0 isoform=CRA_b"
FT                   /protein_id="EDL34184.1"
FT                   /translation="MWLCPSFDSQSESLDQIPNNVAHATEGKMARVCRRGKRHGKARKK
FT                   RRKKRSKSLAQAGVALAKPLPRTPEQESCTIPVQEDESPLGNLYARNVSQFTKPLGGPG
FT                   LGHLCFKKQDEGLRPVLPRPELHKLISPLQCLNHVWKLHHPQATGPRPHPTHPFPYSGM
FT                   PHPFPFYPLEPWKPYMLDSAVLDKLAGVSGQRPLPGPPHLSQLAHGDSQKPLPGPHLES
FT                   SCPSRGALEKVPVEEYLVHALQGSVSSGQAHSLASLAKTWSSGSAKLQRLGPETEDNEG
FT                   VLLTEKLKPVDYEYREEVHWMTHQPRVGRGSFGEVHRMKDKQTGFQCAVKKVRLEVFRV
FT                   EELVACAGLSSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLIKQMGCLPEDRALYYLG
FT                   QALEGLEYLHTRRILHGDVKADNVLLSSDGSRAALCDFGHALCLQPDGLGKSLLTGDYI
FT                   PGTETHMAPEVVMGKPCDAKVDIWSSCCMMLHMLNGCHPWTQYFRGPLCLKIASEPPPI
FT                   REIPPSCAPLTAQAIQEGLRKEPVHRASAMELRRKVGKALQEVGGLKSPWKGEYKEPRP
FT                   PPQDQATCHQTLPTPPRENPPAKANTDGAPEPQPPLPPEPPEPSKAPALNLSKEESGTW
FT                   EPLPLSSLDPATAKGPSFPDRRATLPELELQQLEIELFLNSLSQPFSLEEQEQILSCLS
FT                   IDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWNSQAEARTCSCSTALARGRPTDIPSYF
FT                   NGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPATAFSLVTKDGQPVCYDMEVPD
FT                   SGIDLQCTLAPDGSFAWTWRVKHGQLENRP"
FT   assembly_gap    1846445..1846590
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    1865321..1865340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1883162..1883181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1915490..1915691
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    1923976..1927048
FT                   /estimated_length=3073
FT                   /gap_type="unknown"
FT   assembly_gap    1933835..1934383
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   assembly_gap    1935844..1935863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1943915..1943934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1949037..1988203
FT                   /locus_tag="mCG_1051085"
FT                   /note="gene_id=mCG1051085.0"
FT   mRNA            join(1949037..1949068,1967386..1967408,1986220..1988203)
FT                   /locus_tag="mCG_1051085"
FT                   /product="mCG1051085"
FT                   /note="gene_id=mCG1051085.0 transcript_id=mCT194874.0
FT                   created on 27-JAN-2005"
FT   assembly_gap    1951778..1951797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1952222..1965811)
FT                   /locus_tag="mCG_140724"
FT                   /note="gene_id=mCG140724.0"
FT   mRNA            complement(join(1952222..1954159,1954270..1954375,
FT                   1954464..1954598,1954690..1954767,1954955..1955053,
FT                   1955126..1955248,1955373..1955478,1956316..1956414,
FT                   1959422..1959512,1959803..1959870,1960140..1960223,
FT                   1960311..1960391,1960570..1960752,1961100..1961519,
FT                   1965621..1965811))
FT                   /locus_tag="mCG_140724"
FT                   /product="mCG140724"
FT                   /note="gene_id=mCG140724.0 transcript_id=mCT171078.0
FT                   created on 23-JUL-2002"
FT   CDS             complement(join(1953982..1954159,1954270..1954375,
FT                   1954464..1954598,1954690..1954767,1954955..1955053,
FT                   1955126..1955248,1955373..1955478,1956316..1956414,
FT                   1959422..1959512,1959803..1959870,1960140..1960223,
FT                   1960311..1960391,1960570..1960752,1961100..1961519,
FT                   1965621..1965677))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140724"
FT                   /product="mCG140724"
FT                   /note="gene_id=mCG140724.0 transcript_id=mCT171078.0
FT                   protein_id=mCP93996.0"
FT                   /protein_id="EDL34186.1"
FT                   /translation="MVDMISKLVRRQSRALRAQVDDPPEPVYANVERQPRATSPRSAAA
FT                   PPRLSPVWETHTDTGTGRPYYYNPDTGVTTWESPFETPEGTTSPATSRASVGSGESLET
FT                   EWGQYWDEESRRVFFYNPLTGETAWEDETEELEEDHQEQLEMQPSLSPRSPGQQRPPTP
FT                   ETDYPELLASYPEEDYSPVGSFSDPGPASPLVAPPGWSCQITPDKQMLYTNQFTQEQWV
FT                   RLEDQHGKPYFYNPEDSSVQWELPQVPIPAPRSVRKSSQDSDTPAQASPPEEKIKTLDK
FT                   AGVLHRTKTVDKGKRLRKKHWSTSWTVLEGGVLTFFKDSKTSAAGGLLRSRDGSEYLIQ
FT                   HDSEAIISTWHKAIAEGISELSADLLQGEEGEPSSADFGSSERLGSWREEDVRQNAASP
FT                   SLSPGGLESDLSRVRHKLRKFLQRRPTLQSLRDKGYIKDQVFGCALAQLCERERSPVPR
FT                   FVQQCIRTVEARGLDIDGLYRISGNLATIQKLRYKVDHDERLDLDDGRWEDVHVITGAL
FT                   KLFFRELPEPLFPFSHFHQFIAAIKLQDPAQRSRCVRDLVRTLPAPNQDTLRLLIQHLC
FT                   RVIEHGEQNRMTVQNVAIVFGPTLLRPEMEEASMPMTMVFQNQVVELILHQCADIFPPH
FT                   "
FT   assembly_gap    1976736..1976810
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   gene            complement(1980532..1984785)
FT                   /gene="5730442P18Rik"
FT                   /locus_tag="mCG_140725"
FT                   /note="gene_id=mCG140725.0"
FT   mRNA            complement(join(1980532..1982082,1983551..1983678,
FT                   1984616..1984785))
FT                   /gene="5730442P18Rik"
FT                   /locus_tag="mCG_140725"
FT                   /product="RIKEN cDNA 5730442P18"
FT                   /note="gene_id=mCG140725.0 transcript_id=mCT171076.0
FT                   created on 30-AUG-2002"
FT   CDS             complement(1981333..1982064)
FT                   /codon_start=1
FT                   /gene="5730442P18Rik"
FT                   /locus_tag="mCG_140725"
FT                   /product="RIKEN cDNA 5730442P18"
FT                   /note="gene_id=mCG140725.0 transcript_id=mCT171076.0
FT                   protein_id=mCP93995.0"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR015767"
FT                   /db_xref="MGI:MGI:1916903"
FT                   /db_xref="UniProtKB/TrEMBL:A2AKN5"
FT                   /protein_id="EDL34187.1"
FT                   /translation="MAADVEGDVYVLVEHPFEYTGKDGRRIAIQPNERYRLLRRSTEHW
FT                   WHVRREPGGRPFYLPAQYVRELPALGDPAPAPQPSVPQQRPAVPEPLAYDYRFVSTPVG
FT                   ADGSSAEPRGRASSLCGPARQRTGGQRNSLAPGGPACLYVRPAAPVRPAQSLDDLARGG
FT                   TAPPAGLLGSAGHFKASSVAGSWVCPRPLAPSDSENVYEAIPDLRCPPRAESPKQVGRC
FT                   ERGGRREVTVQQSLDAFFFFN"
FT   assembly_gap    1983141..1983160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1984924..1985996
FT                   /locus_tag="mCG_148181"
FT                   /note="gene_id=mCG148181.0"
FT   mRNA            join(1984924..1985148,1985665..1985996)
FT                   /locus_tag="mCG_148181"
FT                   /product="mCG148181"
FT                   /note="gene_id=mCG148181.0 transcript_id=mCT188444.0
FT                   created on 13-JAN-2004"
FT   CDS             1985681..1985869
FT                   /codon_start=1
FT                   /locus_tag="mCG_148181"
FT                   /product="mCG148181"
FT                   /note="gene_id=mCG148181.0 transcript_id=mCT188444.0
FT                   protein_id=mCP109358.0"
FT                   /protein_id="EDL34188.1"
FT                   /translation="MRTPVCPSPSRQGKGETALRGTVLKVERQPKTAAAAAQVPGASPG
FT                   PATPNLQIQFLSLCSEP"
FT   assembly_gap    1986056..1986213
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   gene            complement(1986416..>1998840)
FT                   /locus_tag="mCG_140726"
FT                   /note="gene_id=mCG140726.0"
FT   mRNA            complement(join(1986416..1988319,1988924..1989081,
FT                   1989434..1989497,1992188..1992381,1995266..1995411,
FT                   1997920..>1998840))
FT                   /locus_tag="mCG_140726"
FT                   /product="mCG140726"
FT                   /note="gene_id=mCG140726.0 transcript_id=mCT171077.0
FT                   created on 23-JUL-2002"
FT   CDS             1987666..1987896
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051085"
FT                   /product="mCG1051085"
FT                   /note="gene_id=mCG1051085.0 transcript_id=mCT194874.0
FT                   protein_id=mCP115903.0"
FT                   /protein_id="EDL34185.1"
FT                   /translation="MTLALLAVCARKGRGKAPSPDRLTQQRPVHPAPCLPGLGLLSPIW
FT                   SGEGLYFLGDLGRSRIKKYFLFNYEGGKNLP"
FT   CDS             complement(join(1988208..1988319,1988924..1989081,
FT                   1989434..1989497,1992188..1992381,1995266..1995411,
FT                   1997920..>1998838))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140726"
FT                   /product="mCG140726"
FT                   /note="gene_id=mCG140726.0 transcript_id=mCT171077.0
FT                   protein_id=mCP93994.0"
FT                   /protein_id="EDL34189.1"
FT                   /translation="LSNPFRGLMKLGTVARRGAMGIWKEFFCELSPLEFRLYLSDEERT
FT                   CVESCSLLRCEAVGPAHSDGRFELVFSGKKLALRASSQDEAEDWLDRVREALQKVRPQQ
FT                   EDEWVNIQYPDQAEDAPEAPPDSLPPYSTLLPEPAGAQGMQLDWTSAQVPEPDAIKESL
FT                   LYLYADRTWVPYIFSLSLESLKCFRVRNNEKMLSDSHGVETIRDILPDTSLGGPAFFKI
FT                   ITAKAVLKLQAKNTEEATHWRDLVRKVLASYLESAEEAVTLGGSLDEKCQEVLKFATRE
FT                   NGFLLQYLVAIPTEKGLDSQGCFCAGCSRQIGFSFVRPKLCAFSGLYYCDFCHQDDASV
FT                   IPARIIHNWDLTKRPVCRQALKFLAQIRAQPLINLQLVNASLYEHVERMHLIGRSREQL
FT                   KLLGDYLGLCRSGALKELCKRLSHRNYLLESPHRFSVADLQQIAEGVYEGFLKALIEFA
FT                   SQHVYHCDLCTQRGFICQICHHQDIIFPFEFDTTVRCAECRTVFHQSCQAVVRKGCPRC
FT                   ARRRKYQEQNVVS"
FT   gene            complement(<2001354..>2033891)
FT                   /locus_tag="mCG_118451"
FT                   /note="gene_id=mCG118451.1"
FT   mRNA            complement(join(<2001354..2001680,2008262..2008652,
FT                   2015952..2016578,2018291..2018538,2025074..2025137,
FT                   2033767..>2033891))
FT                   /locus_tag="mCG_118451"
FT                   /product="mCG118451"
FT                   /note="gene_id=mCG118451.1 transcript_id=mCT119607.1
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(2001354..2001680,2008262..2008652,
FT                   2015952..2016578,2018291..2018538,2025074..2025137,
FT                   2033767..2033891))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118451"
FT                   /product="mCG118451"
FT                   /note="gene_id=mCG118451.1 transcript_id=mCT119607.1
FT                   protein_id=mCP75062.1"
FT                   /protein_id="EDL34190.1"
FT                   /translation="MASDAARRFLLSVPLEPQLLLGTEGGLASPGAPPPAPDPFGEAAA
FT                   RVEMLSVENGLDPRAAIQVIKKKLVGSVKALQKQHVSLDTVVTSEDGDANTMCSALEAV
FT                   FIHGLHAKHIRAEAGGKRKKHTHQKALPQPVFWPLLKAITHRHIVSDLEHLVFINTDVG
FT                   RCRAWLRLALNDGLMECYLKLLLQEPARLCEYYQPTALLRDAEEAEFLLSFLQGLTSLS
FT                   FELSYKSAILNEWTLTPLSLSGLCPLSELDPLTTSGAELQRKESLDSISHSSGSEDIEV
FT                   QHSGHKIRRNRKLTASSLSLDTASSSQLSCSLNSDSCLLQENGPKSPDHSEEPMSYDSD
FT                   LGMANTDDPDRSLQEVLSEFSKAQVNSAPSSGPNQEPDTPMFQTPLSLHSLATSTHLHF
FT                   EGSEELFPAHKSSGTSSGGHKHQLLPQETPDEKQLGTAQAGPAQSTSDQQPSSPVGGAA
FT                   GQGSGPWKALEYGRVGPKLVVSSPTSPKGKSWISEDDFCRPPQEPALKSAAGLCTSPVQ
FT                   DTPESRAALHGPFSQGPRKSCSLGALDKACVPSQACGNAQPAPAPAPAPAPAPAPAPGV
FT                   TQDHKNFCVVHRRQMGR"
FT   assembly_gap    2030889..2031883
FT                   /estimated_length=995
FT                   /gap_type="unknown"
FT   assembly_gap    2041886..2042267
FT                   /estimated_length=382
FT                   /gap_type="unknown"
FT   assembly_gap    2053083..2053102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2053957..2054048
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    2071907..2071926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2101999..2102018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2132048..2132132
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    2205210..2205229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2246990..2247091
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   gene            complement(2253174..2261215)
FT                   /gene="Lyzl6"
FT                   /locus_tag="mCG_118452"
FT                   /note="gene_id=mCG118452.0"
FT   mRNA            complement(join(2253174..2253743,2256249..2256327,
FT                   2257327..2257485,2259108..2259293,2261158..2261215))
FT                   /gene="Lyzl6"
FT                   /locus_tag="mCG_118452"
FT                   /product="lysozyme-like 6, transcript variant mCT119608"
FT                   /note="gene_id=mCG118452.0 transcript_id=mCT119608.0
FT                   created on 06-SEP-2002"
FT   mRNA            complement(join(2253175..2253743,2254380..2254469,
FT                   2256249..2256327,2257327..2257485,2259108..2259293,
FT                   2261158..2261215))
FT                   /gene="Lyzl6"
FT                   /locus_tag="mCG_118452"
FT                   /product="lysozyme-like 6, transcript variant mCT172755"
FT                   /note="gene_id=mCG118452.0 transcript_id=mCT172755.0
FT                   created on 06-SEP-2002"
FT   mRNA            complement(join(2253429..2253743,2256249..2256327,
FT                   2257327..2257485,2259108..2259293,2261068..>2261208))
FT                   /gene="Lyzl6"
FT                   /locus_tag="mCG_118452"
FT                   /product="lysozyme-like 6, transcript variant mCT193229"
FT                   /note="gene_id=mCG118452.0 transcript_id=mCT193229.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(2253674..2253743,2256249..2256327,
FT                   2257327..2257485,2259108..2259293,2261068..>2261077))
FT                   /codon_start=1
FT                   /gene="Lyzl6"
FT                   /locus_tag="mCG_118452"
FT                   /product="lysozyme-like 6, isoform CRA_b"
FT                   /note="gene_id=mCG118452.0 transcript_id=mCT193229.0
FT                   protein_id=mCP114196.0 isoform=CRA_b"
FT                   /protein_id="EDL34192.1"
FT                   /translation="GQRDPPGSQRLPSALSPWTMLKALFICVASCLLVVNDGNIIHRCS
FT                   LAKILYEEDLDGFEGYSLPDWLCLAFVESNFNISKVNENVDGSFDYGIFQINSRYWCND
FT                   YQSHSENFCHVDCQELLSPNLISTIHCAKKIVSGPGGMKNWVEWKLHCLGRPLSYWMTG
FT                   CHLG"
FT   CDS             complement(join(2253674..2253743,2256249..2256327,
FT                   2257327..2257485,2259108..2259246))
FT                   /codon_start=1
FT                   /gene="Lyzl6"
FT                   /locus_tag="mCG_118452"
FT                   /product="lysozyme-like 6, isoform CRA_c"
FT                   /note="gene_id=mCG118452.0 transcript_id=mCT119608.0
FT                   protein_id=mCP75120.1 isoform=CRA_c"
FT                   /db_xref="GOA:A0A077S2U3"
FT                   /db_xref="InterPro:IPR000974"
FT                   /db_xref="InterPro:IPR001916"
FT                   /db_xref="InterPro:IPR019799"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR030063"
FT                   /db_xref="MGI:MGI:1916694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A077S2U3"
FT                   /protein_id="EDL34193.1"
FT                   /translation="MLKALFICVASCLLVVNDGNIIHRCSLAKILYEEDLDGFEGYSLP
FT                   DWLCLAFVESNFNISKVNENVDGSFDYGIFQINSRYWCNDYQSHSENFCHVDCQELLSP
FT                   NLISTIHCAKKIVSGPGGMKNWVEWKLHCLGRPLSYWMTGCHLG"
FT   CDS             complement(join(2254469,2256249..2256327,2257327..2257485,
FT                   2259108..2259246))
FT                   /codon_start=1
FT                   /gene="Lyzl6"
FT                   /locus_tag="mCG_118452"
FT                   /product="lysozyme-like 6, isoform CRA_a"
FT                   /note="gene_id=mCG118452.0 transcript_id=mCT172755.0
FT                   protein_id=mCP95674.0 isoform=CRA_a"
FT                   /protein_id="EDL34191.1"
FT                   /translation="MLKALFICVASCLLVVNDGNIIHRCSLAKILYEEDLDGFEGYSLP
FT                   DWLCLAFVESNFNISKVNENVDGSFDYGIFQINSRYWCNDYQSHSENFCHVDCQELLSP
FT                   NLISTIHCAKKIVSGPGGMKN"
FT   gene            <2261303..2271379
FT                   /locus_tag="mCG_1042076"
FT                   /note="gene_id=mCG1042076.0"
FT   mRNA            join(<2261303..2261645,2269497..2269590,2270975..2271379)
FT                   /locus_tag="mCG_1042076"
FT                   /product="mCG1042076"
FT                   /note="gene_id=mCG1042076.0 transcript_id=mCT159780.0
FT                   created on 06-SEP-2002"
FT   assembly_gap    2266903..2267249
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   CDS             <2271087..2271332
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042076"
FT                   /product="mCG1042076"
FT                   /note="gene_id=mCG1042076.0 transcript_id=mCT159780.0
FT                   protein_id=mCP75481.0"
FT                   /protein_id="EDL34194.1"
FT                   /translation="AKEYRSISLKKFWCQKQSTDCLSQILAVQNSMYATVGKTLHSRTQ
FT                   IETTRRRLYLGKDTGPPQTAGFCSFRGFFPTFADPC"
FT   gene            2271945..2272955
FT                   /locus_tag="mCG_1042003"
FT                   /note="gene_id=mCG1042003.1"
FT   mRNA            2271945..2272955
FT                   /locus_tag="mCG_1042003"
FT                   /product="mCG1042003"
FT                   /note="gene_id=mCG1042003.1 transcript_id=mCT159707.1
FT                   created on 06-SEP-2002"
FT   CDS             2272156..2272509
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042003"
FT                   /product="mCG1042003"
FT                   /note="gene_id=mCG1042003.1 transcript_id=mCT159707.1
FT                   protein_id=mCP75232.0"
FT                   /db_xref="GOA:B2RV63"
FT                   /db_xref="InterPro:IPR033357"
FT                   /db_xref="MGI:MGI:2144486"
FT                   /db_xref="UniProtKB/TrEMBL:B2RV63"
FT                   /protein_id="EDL34195.1"
FT                   /translation="MNVSFLNHSGLEEVGGDARATLGNRSHGLGTWLDCCPGGAPLTAS
FT                   DGVPAGLAPDERSLWVSRVAQIAVLCVLSLTVVFGVFFLGCNLLIKSESMINFLMQERR
FT                   PSKDVGAAILGLY"
FT   assembly_gap    2286401..2286593
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    2292620..2292639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2299342..2320432)
FT                   /gene="Gosr2"
FT                   /locus_tag="mCG_19158"
FT                   /note="gene_id=mCG19158.3"
FT   mRNA            complement(join(2299342..2301876,2309067..2309199,
FT                   2310010..2310118,2311740..2311804,2320148..2320416))
FT                   /gene="Gosr2"
FT                   /locus_tag="mCG_19158"
FT                   /product="golgi SNAP receptor complex member 2, transcript
FT                   variant mCT171351"
FT                   /note="gene_id=mCG19158.3 transcript_id=mCT171351.0 created
FT                   on 08-APR-2003"
FT   mRNA            complement(join(2299342..2301876,2306271..2306411,
FT                   2309067..2309199,2310010..2310118,2311740..2311804,
FT                   2320148..2320416))
FT                   /gene="Gosr2"
FT                   /locus_tag="mCG_19158"
FT                   /product="golgi SNAP receptor complex member 2, transcript
FT                   variant mCT17749"
FT                   /note="gene_id=mCG19158.3 transcript_id=mCT17749.2 created
FT                   on 08-APR-2003"
FT   mRNA            complement(join(2299935..2301876,2306271..2306411,
FT                   2320148..2320432))
FT                   /gene="Gosr2"
FT                   /locus_tag="mCG_19158"
FT                   /product="golgi SNAP receptor complex member 2, transcript
FT                   variant mCT181676"
FT                   /note="gene_id=mCG19158.3 transcript_id=mCT181676.0 created
FT                   on 08-APR-2003"
FT   mRNA            complement(join(2301569..2301876,2306271..2306411,
FT                   2309067..2309199,2310010..2310118,2320148..>2320216))
FT                   /gene="Gosr2"
FT                   /locus_tag="mCG_19158"
FT                   /product="golgi SNAP receptor complex member 2, transcript
FT                   variant mCT181677"
FT                   /note="gene_id=mCG19158.3 transcript_id=mCT181677.0 created
FT                   on 08-APR-2003"
FT   CDS             complement(join(2301715..2301876,2309067..2309199,
FT                   2310010..2310118,2311740..2311804,2320148..2320176))
FT                   /codon_start=1
FT                   /gene="Gosr2"
FT                   /locus_tag="mCG_19158"
FT                   /product="golgi SNAP receptor complex member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19158.3 transcript_id=mCT171351.0
FT                   protein_id=mCP94270.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2A9I0"
FT                   /db_xref="MGI:MGI:1927204"
FT                   /db_xref="UniProtKB/TrEMBL:A2A9I0"
FT                   /protein_id="EDL34196.1"
FT                   /translation="MEPLYQQTNKQVQEIQSHMGRLERADKQSVHLVENEIQASIEQIF
FT                   SHLERLEILSSKEPLNRRQNAKLRVDQLKYDVQHLQTALRNFQHRRQVREQQERQRDEL
FT                   LSRTFTTNGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCAVMFLVVQY
FT                   LT"
FT   CDS             complement(join(2301715..2301876,2306271..2306411,
FT                   2309067..2309199,2310010..2310118,2311740..2311804,
FT                   2320148..2320176))
FT                   /codon_start=1
FT                   /gene="Gosr2"
FT                   /locus_tag="mCG_19158"
FT                   /product="golgi SNAP receptor complex member 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19158.3 transcript_id=mCT17749.2
FT                   protein_id=mCP14620.0 isoform=CRA_b"
FT                   /protein_id="EDL34197.1"
FT                   /translation="MEPLYQQTNKQVQEIQSHMGRLERADKQSVHLVENEIQASIEQIF
FT                   SHLERLEILSSKEPLNRRQNAKLRVDQLKYDVQHLQTALRNFQHRRQVREQQERQRDEL
FT                   LSRTFTTNDSDTTIPMDESLQFNSSLHNIHHGMDDLIGGGHSILEGLRAQRLTLKGTQK
FT                   KILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCAVMFLVVQYLT"
FT   CDS             complement(join(2301715..2301876,2306271..2306411,
FT                   2309067..2309199,2310010..>2310116))
FT                   /codon_start=1
FT                   /gene="Gosr2"
FT                   /locus_tag="mCG_19158"
FT                   /product="golgi SNAP receptor complex member 2, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG19158.3 transcript_id=mCT181677.0
FT                   protein_id=mCP104599.0 isoform=CRA_d"
FT                   /protein_id="EDL34199.1"
FT                   /translation="VENEIQASIEQIFSHLERLEILSSKEPLNRRQNAKLRVDQLKYDV
FT                   QHLQTALRNFQHRRQVREQQERQRDELLSRTFTTNDSDTTIPMDESLQFNSSLHNIHHG
FT                   MDDLIGGGHSILEGLRAQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIG
FT                   GMLLTCAVMFLVVQYLT"
FT   CDS             complement(join(2306294..2306411,2320148..2320176))
FT                   /codon_start=1
FT                   /gene="Gosr2"
FT                   /locus_tag="mCG_19158"
FT                   /product="golgi SNAP receptor complex member 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG19158.3 transcript_id=mCT181676.0
FT                   protein_id=mCP104598.0 isoform=CRA_c"
FT                   /protein_id="EDL34198.1"
FT                   /translation="MEPLYQQTNKTLTPPFPWMNHCSLTPPSTTFTTAWMTSLEAGTVF
FT                   WRD"
FT   assembly_gap    2317332..2317351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2331159..2331178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2336601..2336631
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    2343026..2343045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2344322..2344341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2345683..2345702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2348022..>2348640)
FT                   /locus_tag="mCG_1042077"
FT                   /note="gene_id=mCG1042077.1"
FT   mRNA            complement(join(2348022..2348230,2348547..>2348640))
FT                   /locus_tag="mCG_1042077"
FT                   /product="mCG1042077"
FT                   /note="gene_id=mCG1042077.1 transcript_id=mCT159781.1
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(2348089..2348230,2348547..>2348584))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042077"
FT                   /product="mCG1042077"
FT                   /note="gene_id=mCG1042077.1 transcript_id=mCT159781.1
FT                   protein_id=mCP75493.1"
FT                   /protein_id="EDL34200.1"
FT                   /translation="VGRGRVGRSLSSKSHSFTLLLEMVSPSRPGWLVTKSQGSSSARKT
FT                   RHAAPERLSVGSGD"
FT   gene            complement(<2355450..2374533)
FT                   /gene="Wnt9b"
FT                   /locus_tag="mCG_19155"
FT                   /note="gene_id=mCG19155.2"
FT   mRNA            complement(join(<2355450..2355923,2356670..2356935,
FT                   2358323..2358579,2374401..2374533))
FT                   /gene="Wnt9b"
FT                   /locus_tag="mCG_19155"
FT                   /product="wingless-type MMTV integration site 9B"
FT                   /note="gene_id=mCG19155.2 transcript_id=mCT17747.1 created
FT                   on 06-SEP-2002"
FT   CDS             complement(join(2355450..2355923,2356670..2356935,
FT                   2358323..2358579,2374401..2374483))
FT                   /codon_start=1
FT                   /gene="Wnt9b"
FT                   /locus_tag="mCG_19155"
FT                   /product="wingless-type MMTV integration site 9B"
FT                   /note="gene_id=mCG19155.2 transcript_id=mCT17747.1
FT                   protein_id=mCP14602.1"
FT                   /db_xref="GOA:Q2TBA6"
FT                   /db_xref="InterPro:IPR005817"
FT                   /db_xref="InterPro:IPR018161"
FT                   /db_xref="InterPro:IPR026535"
FT                   /db_xref="MGI:MGI:1197020"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TBA6"
FT                   /protein_id="EDL34201.1"
FT                   /translation="MRPAPALALAALCLLVLPAAAAAAAYFGLTGREVLTPFPGLGTAA
FT                   APAQAGAHLKQCDLLKLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSL
FT                   EGRTGLLQRGFKETAFLYAVSAAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGV
FT                   CGDNLKYSTKFLSNFLGPKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCA
FT                   VRTCWKQLSPFRETGQVLKLRYDTAVKVSSATNEALGRLELWAPAKPGGPAKGLAPRPG
FT                   DLVYMEDSPSFCRPSKYSPGTAGRVCSRDSSCSSLCCGRGYDTQSRMVVFSCHCQVQWC
FT                   CYVECQQCAQQELVYTCKR"
FT   assembly_gap    2389195..2389231
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            2399093..2442824
FT                   /gene="Wnt3"
FT                   /locus_tag="mCG_19162"
FT                   /note="gene_id=mCG19162.1"
FT   mRNA            join(2399093..2399217,2433017..2433258,2436195..2436460,
FT                   2437148..2437635,2440944..2442824)
FT                   /gene="Wnt3"
FT                   /locus_tag="mCG_19162"
FT                   /product="wingless-related MMTV integration site 3"
FT                   /note="gene_id=mCG19162.1 transcript_id=mCT17866.1 created
FT                   on 24-JUL-2002"
FT   CDS             join(2399138..2399217,2433017..2433258,2436195..2436460,
FT                   2437148..2437627)
FT                   /codon_start=1
FT                   /gene="Wnt3"
FT                   /locus_tag="mCG_19162"
FT                   /product="wingless-related MMTV integration site 3"
FT                   /note="gene_id=mCG19162.1 transcript_id=mCT17866.1
FT                   protein_id=mCP14625.1"
FT                   /db_xref="GOA:A2A649"
FT                   /db_xref="InterPro:IPR005817"
FT                   /db_xref="InterPro:IPR009141"
FT                   /db_xref="InterPro:IPR018161"
FT                   /db_xref="MGI:MGI:98955"
FT                   /db_xref="UniProtKB/TrEMBL:A2A649"
FT                   /protein_id="EDL34202.1"
FT                   /translation="MEPHLLGLLLGLLLSGTRVLAGYPIWWSLALGQQYTSLASQPLLC
FT                   GSIPGLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPV
FT                   LDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDAD
FT                   FGVLVSREFADARENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWW
FT                   AQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSP
FT                   NFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCVFHWCCYV
FT                   SCQECIRIYDVHTCK"
FT   gene            complement(2446635..2579656)
FT                   /gene="Nsf"
FT                   /locus_tag="mCG_19161"
FT                   /note="gene_id=mCG19161.2"
FT   mRNA            complement(join(2446635..2448126,2448606..2448661,
FT                   2452078..2452142,2452685..2452732,2453840..2453974,
FT                   2471747..2471826,2473367..2473433,2484267..2484400,
FT                   2487265..2487421,2488610..2488705,2497631..2497818,
FT                   2498063..2498137,2498617..2498782,2508213..2508412,
FT                   2535915..2536070,2538787..2538862,2539272..2539379,
FT                   2541977..2542143,2551646..2551685,2554242..2554341,
FT                   2556228..2556313,2579570..2579656))
FT                   /gene="Nsf"
FT                   /locus_tag="mCG_19161"
FT                   /product="N-ethylmaleimide sensitive fusion protein,
FT                   transcript variant mCT171081"
FT                   /note="gene_id=mCG19161.2 transcript_id=mCT171081.0 created
FT                   on 24-JUL-2002"
FT   mRNA            complement(join(2446635..2448126,2448606..2448661,
FT                   2452619..2452732,2453840..2453974,2471747..2471826,
FT                   2473367..2473433,2484267..2484400,2487265..2487421,
FT                   2488610..2488705,2497631..2497818,2498063..2498137,
FT                   2498617..2498782,2508213..2508412,2535915..2536070,
FT                   2538787..2538862,2539272..2539379,2541977..2542143,
FT                   2551646..2551685,2554242..2554341,2556228..2556313,
FT                   2579570..2579656))
FT                   /gene="Nsf"
FT                   /locus_tag="mCG_19161"
FT                   /product="N-ethylmaleimide sensitive fusion protein,
FT                   transcript variant mCT17750"
FT                   /note="gene_id=mCG19161.2 transcript_id=mCT17750.2 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(2448105..2448126,2448606..2448661,
FT                   2452619..2452732,2453840..2453974,2471747..2471826,
FT                   2473367..2473433,2484267..2484400,2487265..2487421,
FT                   2488610..2488705,2497631..2497818,2498063..2498137,
FT                   2498617..2498782,2508213..2508412,2535915..2536070,
FT                   2538787..2538862,2539272..2539379,2541977..2542143,
FT                   2551646..2551685,2554242..2554341,2556228..2556313,
FT                   2579570..2579581))
FT                   /codon_start=1
FT                   /gene="Nsf"
FT                   /locus_tag="mCG_19161"
FT                   /product="N-ethylmaleimide sensitive fusion protein,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19161.2 transcript_id=mCT17750.2
FT                   protein_id=mCP14613.2 isoform=CRA_b"
FT                   /protein_id="EDL34204.1"
FT                   /translation="MAGRTMQAARCPTDELSLSNCAVVNEKDFQSGQHVMVRTSPNHKY
FT                   IFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQK
FT                   KNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGE
FT                   PASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGG
FT                   LDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNARE
FT                   PKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSM
FT                   AGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPD
FT                   EKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIK
FT                   ASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRV
FT                   LDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGF
FT                   SETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPP
FT                   QGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTI
FT                   AQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALMREEGASPLDFD"
FT   CDS             complement(join(2452119..2452142,2452685..2452732,
FT                   2453840..2453974,2471747..2471826,2473367..2473433,
FT                   2484267..2484400,2487265..2487421,2488610..2488705,
FT                   2497631..2497818,2498063..2498137,2498617..2498782,
FT                   2508213..2508412,2535915..2536070,2538787..2538862,
FT                   2539272..2539379,2541977..2542143,2551646..2551685,
FT                   2554242..2554341,2556228..2556313,2579570..2579581))
FT                   /codon_start=1
FT                   /gene="Nsf"
FT                   /locus_tag="mCG_19161"
FT                   /product="N-ethylmaleimide sensitive fusion protein,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19161.2 transcript_id=mCT171081.0
FT                   protein_id=mCP93999.0 isoform=CRA_a"
FT                   /protein_id="EDL34203.1"
FT                   /translation="MAGRTMQAARCPTDELSLSNCAVVNEKDFQSGQHVMVRTSPNHKY
FT                   IFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQK
FT                   KNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGE
FT                   PASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGG
FT                   LDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNARE
FT                   PKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSM
FT                   AGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPD
FT                   EKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIK
FT                   ASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRV
FT                   LDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGF
FT                   SETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPP
FT                   QGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTI
FT                   AQQSKGRKSG"
FT   assembly_gap    2452198..2452217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2490782..2490801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2562725..2562824
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    2572109..2572128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2592431..2611148
FT                   /gene="Arf2"
FT                   /locus_tag="mCG_19164"
FT                   /note="gene_id=mCG19164.2"
FT   mRNA            join(2592431..2592521,2594788..2594954,2598662..2598772,
FT                   2607505..2607629,2609399..2611148)
FT                   /gene="Arf2"
FT                   /locus_tag="mCG_19164"
FT                   /product="ADP-ribosylation factor 2, transcript variant
FT                   mCT17868"
FT                   /note="gene_id=mCG19164.2 transcript_id=mCT17868.1 created
FT                   on 24-JUL-2002"
FT   mRNA            join(2592431..2592521,2594788..2594954,2598662..2598772,
FT                   2607505..2607709)
FT                   /gene="Arf2"
FT                   /locus_tag="mCG_19164"
FT                   /product="ADP-ribosylation factor 2, transcript variant
FT                   mCT171083"
FT                   /note="gene_id=mCG19164.2 transcript_id=mCT171083.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(2592561..2593071,2594788..2594954,2598662..2598772,
FT                   2607505..2607629,2609399..2611148)
FT                   /gene="Arf2"
FT                   /locus_tag="mCG_19164"
FT                   /product="ADP-ribosylation factor 2, transcript variant
FT                   mCT171082"
FT                   /note="gene_id=mCG19164.2 transcript_id=mCT171082.0 created
FT                   on 24-JUL-2002"
FT   CDS             join(2594807..2594954,2598662..2598772,2607505..2607629,
FT                   2609399..2609560)
FT                   /codon_start=1
FT                   /gene="Arf2"
FT                   /locus_tag="mCG_19164"
FT                   /product="ADP-ribosylation factor 2, isoform CRA_a"
FT                   /note="gene_id=mCG19164.2 transcript_id=mCT171082.0
FT                   protein_id=mCP94001.0 isoform=CRA_a"
FT                   /protein_id="EDL34205.1"
FT                   /translation="MGNVFEKLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTT
FT                   IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAR
FT                   EELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSG
FT                   DGLYEGLDWLSNQLKNQK"
FT   CDS             join(2594807..2594954,2598662..2598772,2607505..2607629,
FT                   2609399..2609560)
FT                   /codon_start=1
FT                   /gene="Arf2"
FT                   /locus_tag="mCG_19164"
FT                   /product="ADP-ribosylation factor 2, isoform CRA_a"
FT                   /note="gene_id=mCG19164.2 transcript_id=mCT17868.1
FT                   protein_id=mCP14635.1 isoform=CRA_a"
FT                   /protein_id="EDL34207.1"
FT                   /translation="MGNVFEKLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTT
FT                   IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAR
FT                   EELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSG
FT                   DGLYEGLDWLSNQLKNQK"
FT   CDS             join(2594807..2594954,2598662..2598772,2607505..2607659)
FT                   /codon_start=1
FT                   /gene="Arf2"
FT                   /locus_tag="mCG_19164"
FT                   /product="ADP-ribosylation factor 2, isoform CRA_b"
FT                   /note="gene_id=mCG19164.2 transcript_id=mCT171083.0
FT                   protein_id=mCP94000.0 isoform=CRA_b"
FT                   /protein_id="EDL34206.1"
FT                   /translation="MGNVFEKLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTT
FT                   IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAR
FT                   EELTRMLAEDELRDAVLLVFVNKQVCACWLSEH"
FT   assembly_gap    2614752..2614889
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    2638863..2638882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2663215..2663283
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    2667861..2667964
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    2676584..2676603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2684039..2684058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2708102..2708440
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    2745914..2745933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2754680..2754699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2755186..2755215
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   gene            2758735..2801723
FT                   /gene="Crhr1"
FT                   /locus_tag="mCG_11224"
FT                   /note="gene_id=mCG11224.2"
FT   mRNA            join(2758735..2759025,2779457..2779544,2785454..2785573,
FT                   2790007..2790092,2795255..2795361,2796032..2796152,
FT                   2796321..2796474,2796679..2796739,2799110..2799182,
FT                   2799507..2799592,2799796..2799931,2800090..2800131,
FT                   2800589..2801723)
FT                   /gene="Crhr1"
FT                   /locus_tag="mCG_11224"
FT                   /product="corticotropin releasing hormone receptor 1"
FT                   /note="gene_id=mCG11224.2 transcript_id=mCT11372.2 created
FT                   on 24-JUL-2002"
FT   CDS             join(2758993..2759025,2779457..2779544,2785454..2785573,
FT                   2790007..2790092,2795255..2795361,2796032..2796152,
FT                   2796321..2796474,2796679..2796739,2799110..2799182,
FT                   2799507..2799592,2799796..2799931,2800090..2800131,
FT                   2800589..2800729)
FT                   /codon_start=1
FT                   /gene="Crhr1"
FT                   /locus_tag="mCG_11224"
FT                   /product="corticotropin releasing hormone receptor 1"
FT                   /note="gene_id=mCG11224.2 transcript_id=mCT11372.2
FT                   protein_id=mCP14631.1"
FT                   /db_xref="GOA:Q3ZAT0"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003051"
FT                   /db_xref="InterPro:IPR003052"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="MGI:MGI:88498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAT0"
FT                   /protein_id="EDL34208.1"
FT                   /translation="MGQRPQLRLVKALLLLGLNPVSTSLQDQQCESLSLASNVSGLQCN
FT                   ASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQE
FT                   ILNEEKKSKVHYHIAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFI
FT                   LRNATWFVVQLTVSPEVHQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYS
FT                   TDRLRKWMFVCIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLL
FT                   INFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVS
FT                   RVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPT
FT                   SPTRVSFHSIKQSTAV"
FT   assembly_gap    2774588..2774607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2779673..2779859
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    2781275..2781378
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   gene            2812529..2814754
FT                   /gene="4933407P14Rik"
FT                   /locus_tag="mCG_1041994"
FT                   /note="gene_id=mCG1041994.1"
FT   mRNA            2812529..2814754
FT                   /gene="4933407P14Rik"
FT                   /locus_tag="mCG_1041994"
FT                   /product="RIKEN cDNA 4933407P14"
FT                   /note="gene_id=mCG1041994.1 transcript_id=mCT159698.1
FT                   created on 10-SEP-2002"
FT   CDS             2812579..2814651
FT                   /codon_start=1
FT                   /gene="4933407P14Rik"
FT                   /locus_tag="mCG_1041994"
FT                   /product="RIKEN cDNA 4933407P14"
FT                   /note="gene_id=mCG1041994.1 transcript_id=mCT159698.1
FT                   protein_id=mCP75126.1"
FT                   /protein_id="EDL34209.1"
FT                   /translation="MACLGSLHPLGSLLLLFLLLLLSPEARGEYGLVRVVSKNWSKDYC
FT                   VLYSSDYVNLPRDLHHAPLLSLHDGTKTPWCPDEDSFHQAQDSSPRQRPLHQTTTMVTR
FT                   GNCSFYAKGWLAQDQGAQGLLIVSRARNQQCSDTISKPQDPSKPWPALTIPVAVLRYTD
FT                   MLDIVSHTYGDTDVRVAMFAPLEPVTDYNMAIIFILAVGTVAAGGYWAGLMEANKLQRR
FT                   QAQRGGGLGGHNQQQTVAAERSQRAWEDDDFEDAPMDFTPAMTGAVVTMSCSIMILLYF
FT                   FYDCFVYVMIGIFSLGASTGLYSCLAPILCHLPLWRYQWVLPGQRVSVTWPLLLLAGLC
FT                   AMVTVLWVIHRNEDHWAWLLQDTLGVAYCLFVLRRVRLPTFKNCTLFLLALLAFDVFFV
FT                   FITPLFTKTGESIMVEVASGPADSSSHERLPMVLKVPRLSFSALTLCNQPFSILGFGDI
FT                   VVPGFLVAYCHRFDMQVQSRQVYYMACTVAYAVGLLVTFVAMILMQMGQPALLYLVSST
FT                   LLTSLAVATCRQEFTLFWTGQGRAKIPAEPVAQPCIASAVGSKMKLEDAKDSRTTNRFE
FT                   QAVDGESGDLESSTGDDMAEMVTLSEDEATSPEGHSESSEGWSDTNLDPNELPSGSPMA
FT                   LEAMLIPLIQPIPHPSELGHIRTQSRVHDSSLPWMGLHKRKGLKVKKSMSAQAPL"
FT   assembly_gap    2816019..2816108
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    2827678..2831539
FT                   /estimated_length=3862
FT                   /gap_type="unknown"
FT   gene            2860999..2968309
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /note="gene_id=mCG11217.2"
FT   mRNA            join(2860999..2861258,2912416..2912528,2937217..2937266,
FT                   2941444..2941576,2945073..2945338,2957088..2957169,
FT                   2958164..2958276,2963711..2963918,2964842..2968309)
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, transcript
FT                   variant mCT171068"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT171068.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(2860999..2861258,2917229..2917341,2921978..2922064,
FT                   2924762..2924848,2929715..2929780,2937217..2937266,
FT                   2941444..2941576,2945073..2945338,2953895..2953987,
FT                   2957088..2957169,2958164..2958276,2963711..2968309)
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, transcript
FT                   variant mCT171069"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT171069.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(2860999..2861258,2917229..2917341,2929715..2929780,
FT                   2937217..2937266,2941444..2941576,2945073..2945338,
FT                   2953895..2953987,2957088..2957169,2958164..2958276,
FT                   2963711..2968309)
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, transcript
FT                   variant mCT11364"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT11364.1 created
FT                   on 24-JUL-2002"
FT   mRNA            join(2860999..2861258,2917229..2917341,2929715..2929780,
FT                   2937217..2937266,2941444..2941576,2945073..2945338,
FT                   2957088..2957169,2958164..2958276,2963711..2968309)
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, transcript
FT                   variant mCT171067"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT171067.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(2860999..2861258,2917229..2917341,2937217..2937266,
FT                   2941444..2941576,2945073..2945338,2953895..2953987,
FT                   2957088..2957169,2958164..2958276,2963711..2968309)
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, transcript
FT                   variant mCT171070"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT171070.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(<2861087..2861258,2912416..2912528,2929715..2929780,
FT                   2937217..2937266,2941444..2941576,2945073..2945338,
FT                   2957088..2957169,2958164..2958276,2963711..2963918,
FT                   2964842..2965810)
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, transcript
FT                   variant mCT193227"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT193227.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<2861087..2861258,2912416..2912528,2929715..2929780,
FT                   2937217..2937266,2941444..2941576,2945073..2945338,
FT                   2957088..2957169,2958164..2958276,2963711..2963980)
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, transcript
FT                   variant mCT193226"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT193226.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<2861113..2861258,2912416..2912528,2929715..2929780,
FT                   2937217..2937266,2941444..2941576,2945073..2945338,
FT                   2953895..2953987,2957088..2957169,2958164..2958276,
FT                   2963711..2964199)
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, transcript
FT                   variant mCT193228"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT193228.0 created
FT                   on 09-MAR-2004"
FT   assembly_gap    2880922..2880941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<2912423..2912528,2929715..2929780,2937217..2937266,
FT                   2941444..2941576,2945073..2945338,2957088..2957169,
FT                   2958164..2958276,2963711..2963918,2964842..2964918)
FT                   /codon_start=1
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT193227.0
FT                   protein_id=mCP114194.0 isoform=CRA_f"
FT                   /protein_id="EDL34215.1"
FT                   /translation="TSMADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKAEEAGIGDTP
FT                   NQEDQAAGHVTQARVASKDRTGNDEKKAKGADGKTGAKIATPRGAASPAQKGTSNATRI
FT                   PAKTTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVR
FT                   TPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTS
FT                   KCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFR
FT                   ENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAK
FT                   QGKAALLSSQVWNYSHDLATITDLGL"
FT   CDS             join(<2912423..2912528,2929715..2929780,2937217..2937266,
FT                   2941444..2941576,2945073..2945338,2953895..2953987,
FT                   2957088..2957169,2958164..2958276,2963711..2963926)
FT                   /codon_start=1
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, isoform
FT                   CRA_g"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT193228.0
FT                   protein_id=mCP114195.0 isoform=CRA_g"
FT                   /protein_id="EDL34216.1"
FT                   /translation="TSMADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKAEEAGIGDTP
FT                   NQEDQAAGHVTQARVASKDRTGNDEKKAKGADGKTGAKIATPRGAASPAQKGTSNATRI
FT                   PAKTTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVR
FT                   TPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQS
FT                   KCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKD
FT                   RVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRH
FT                   LSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL"
FT   CDS             join(<2912423..2912528,2929715..2929780,2937217..2937266,
FT                   2941444..2941576,2945073..2945338,2957088..2957169,
FT                   2958164..2958276,2963711..2963926)
FT                   /codon_start=1
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT193226.0
FT                   protein_id=mCP114193.0 isoform=CRA_e"
FT                   /protein_id="EDL34214.1"
FT                   /translation="TSMADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKAEEAGIGDTP
FT                   NQEDQAAGHVTQARVASKDRTGNDEKKAKGADGKTGAKIATPRGAASPAQKGTSNATRI
FT                   PAKTTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVR
FT                   TPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTS
FT                   KCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFR
FT                   ENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAK
FT                   QGL"
FT   CDS             join(2912429..2912528,2937217..2937266,2941444..2941576,
FT                   2945073..2945338,2957088..2957169,2958164..2958276,
FT                   2963711..2963918,2964842..2964918)
FT                   /codon_start=1
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, isoform
FT                   CRA_h"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT171068.0
FT                   protein_id=mCP93986.0 isoform=CRA_h"
FT                   /protein_id="EDL34217.1"
FT                   /translation="MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKARVASKDRTGND
FT                   EKKAKGADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTPSPKTPPGSGEPPKSGERS
FT                   GYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLK
FT                   NVRSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKL
FT                   DFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDT
FT                   SPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGKAALLSSQVWNYSHDLATITDL
FT                   GL"
FT   assembly_gap    2913634..2913934
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   CDS             join(2917242..2917341,2921978..2922064,2924762..2924848,
FT                   2929715..2929780,2937217..2937266,2941444..2941576,
FT                   2945073..2945338,2953895..2953987,2957088..2957169,
FT                   2958164..2958276,2963711..2963926)
FT                   /codon_start=1
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT171069.0
FT                   protein_id=mCP93988.0 isoform=CRA_c"
FT                   /protein_id="EDL34212.1"
FT                   /translation="MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKESPPQPPADDGA
FT                   EEPGSETSDAKSTPTAEDVTAPLVDERAPDKQAAAQPHTEIPEGITAEEAGIGDTPNQE
FT                   DQAAGHVTQARVASKDRTGNDEKKAKGADGKTGAKIATPRGAASPAQKGTSNATRIPAK
FT                   TTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPP
FT                   KSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCG
FT                   SKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQ
FT                   SKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSN
FT                   VSSTGSIDMVDSPQLATLADEVSASLAKQGL"
FT   CDS             join(2917242..2917341,2929715..2929780,2937217..2937266,
FT                   2941444..2941576,2945073..2945338,2953895..2953987,
FT                   2957088..2957169,2958164..2958276,2963711..2963926)
FT                   /codon_start=1
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT11364.1
FT                   protein_id=mCP14641.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q547J4"
FT                   /db_xref="InterPro:IPR001084"
FT                   /db_xref="InterPro:IPR002955"
FT                   /db_xref="InterPro:IPR027324"
FT                   /db_xref="MGI:MGI:97180"
FT                   /db_xref="UniProtKB/TrEMBL:Q547J4"
FT                   /protein_id="EDL34210.1"
FT                   /translation="MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKAEEAGIGDTPNQ
FT                   EDQAAGHVTQARVASKDRTGNDEKKAKGADGKTGAKIATPRGAASPAQKGTSNATRIPA
FT                   KTTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTP
FT                   PKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKC
FT                   GSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRV
FT                   QSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLS
FT                   NVSSTGSIDMVDSPQLATLADEVSASLAKQGL"
FT   CDS             join(2917242..2917341,2929715..2929780,2937217..2937266,
FT                   2941444..2941576,2945073..2945338,2957088..2957169,
FT                   2958164..2958276,2963711..2963926)
FT                   /codon_start=1
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT171067.0
FT                   protein_id=mCP93987.0 isoform=CRA_b"
FT                   /protein_id="EDL34211.1"
FT                   /translation="MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKAEEAGIGDTPNQ
FT                   EDQAAGHVTQARVASKDRTGNDEKKAKGADGKTGAKIATPRGAASPAQKGTSNATRIPA
FT                   KTTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTP
FT                   PKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKC
FT                   GSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFREN
FT                   AKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQG
FT                   L"
FT   CDS             join(2917242..2917341,2937217..2937266,2941444..2941576,
FT                   2945073..2945338,2953895..2953987,2957088..2957169,
FT                   2958164..2958276,2963711..2963926)
FT                   /codon_start=1
FT                   /gene="Mapt"
FT                   /locus_tag="mCG_11217"
FT                   /product="microtubule-associated protein tau, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG11217.2 transcript_id=mCT171070.0
FT                   protein_id=mCP93985.0 isoform=CRA_d"
FT                   /protein_id="EDL34213.1"
FT                   /translation="MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKARVASKDRTGND
FT                   EKKAKGADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTPSPKTPPGSGEPPKSGERS
FT                   GYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLK
FT                   NVRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPV
FT                   DLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIE
FT                   THKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADE
FT                   VSASLAKQGL"
FT   gene            complement(2969235..3107274)
FT                   /locus_tag="mCG_141096"
FT                   /note="gene_id=mCG141096.0"
FT   mRNA            complement(join(2969235..2970940,2971182..2971434,
FT                   2971956..2972068,2972284..2972341,2975668..2975789,
FT                   2979921..2980069,2980417..2980605,2981049..2981231,
FT                   2988046..2988211,2994267..2994384,2994793..2994867,
FT                   2995472..2995587,3006612..3006710,3016578..3016719,
FT                   3061875..3063246,3064378..3064426))
FT                   /locus_tag="mCG_141096"
FT                   /product="mCG141096, transcript variant mCT173094"
FT                   /note="gene_id=mCG141096.0 transcript_id=mCT173094.0
FT                   created on 10-SEP-2002"
FT   mRNA            complement(join(2969236..2970940,2971182..2971434,
FT                   2971956..2972068,2972284..2972341,2975668..2975789,
FT                   2979921..2980069,2981049..2981231,2988046..2988211,
FT                   2994267..2994384,2994793..2994867,2995472..2995587,
FT                   3016578..3016719,3061875..3063246,3105535..3105648,
FT                   3107230..3107274))
FT                   /locus_tag="mCG_141096"
FT                   /product="mCG141096, transcript variant mCT173095"
FT                   /note="gene_id=mCG141096.0 transcript_id=mCT173095.0
FT                   created on 10-SEP-2002"
FT   mRNA            complement(join(2969290..2970940,2971182..2971434,
FT                   2971956..2972068,2972284..2972341,2975668..2975789,
FT                   2979921..2980069,2981049..2981231,2988046..2988211,
FT                   2994267..2994459,2995472..2995587,3006612..3006710,
FT                   3016578..3016719,3061875..3063246,3105535..3105648,
FT                   3106525..3106800))
FT                   /locus_tag="mCG_141096"
FT                   /product="mCG141096, transcript variant mCT193220"
FT                   /note="gene_id=mCG141096.0 transcript_id=mCT193220.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(2970713..2970940,2971182..2971434,
FT                   2971956..2972068,2972284..2972341,2975668..2975789,
FT                   2979921..2980069,2981049..2981231,2988046..2988211,
FT                   2994267..2994384,2994793..2994867,2995472..2995587,
FT                   3016578..3016719,3061875..3063163))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141096"
FT                   /product="mCG141096, isoform CRA_b"
FT                   /note="gene_id=mCG141096.0 transcript_id=mCT173095.0
FT                   protein_id=mCP96013.0 isoform=CRA_b"
FT                   /protein_id="EDL34219.1"
FT                   /translation="MAAMAPALTDAAAEAHHIRFKLAPPSSTLSPGSAENNGNANILIS
FT                   ANGTKRKAIAAEDPSLDFRNNPTKEDLGKLQPLVASYLCSDVTSVPAKESLKLQGVFSK
FT                   QTVLKSHPLLSQSYELRAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTK
FT                   SSTHSDHDNSSSLNGGKRSLTSSSLQGGEVGGPDSGNLKGGMTNCTLPHRSLDIQHTTL
FT                   YSNNSTANKSSVNSMDQPALQGSSRLSPSTDSSSNLTNVKLEVKKSPLSSILFSALDSD
FT                   TRITALLRRQADIEIRARRLQKRLQVVQAKQVERHLQHQLGGFLETTLSKLPNLESLRS
FT                   RSQLMLTRKAEAALRKAASESATSEGLSNFLKSDSISEELERFTASGIANLRCSEQAFD
FT                   SDVTDSSSGGESDIEEEELTRADPEQCHVPLKRRSEWRWAADRAAIVSRWNWLQAHVSD
FT                   LEYRIRQQTDIYKQIRANKIESVSQPSENHGILVSNITESLSTKSCGAPRPVNGVVNSL
FT                   QPVLADQVPGDSSDAEEQLHKKQRLNLVSSSDGTCVAARTRPVLTCKKRRLVRPSSIVP
FT                   LSKKVHRNVRSGCDVNPSCALCGSGSVNTMPPEIHYEAPLLERLSQLDSCVHPVLAFPD
FT                   DVPTSLHFQSMLKSQWQNKPFDKIKPTKKFSLKHRATMPCSLSDPVRKDRHKLVNSFLT
FT                   TAMLKHHTDMSSPSYLTATHHPPHSPLVRQLSTSSDTSTPTSSGSQVAASTSQPVRRRR
FT                   GESSFDINNIVIPMSVAATTRVEKLQYKEILTPSWREVDVQSLKGSPDEENEEIEDLSD
FT                   AAFAALHAKCEEMERARWLWTTSVPPQRRGSRSYRSSDGRTTPQLGSANPSTPQPASPD
FT                   VSSSHSLSEFSHGQSPRSPISPELHSAPLTPVARDSLRHLASEDTRCSTPELGLDEQSV
FT                   QPWERRTFPLAYSPQAECEEQLDAQDTAARCTRRTSGSKTGREAEVAPTSPPVVPLKSR
FT                   HLAATVTAQRPAHR"
FT   CDS             complement(join(2970713..2970940,2971182..2971434,
FT                   2971956..2972068,2972284..2972341,2975668..2975789,
FT                   2979921..2980069,2981049..2981231,2988046..2988211,
FT                   2994267..2994459,2995472..2995587,3006612..3006710,
FT                   3016578..3016719,3061875..3063163))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141096"
FT                   /product="mCG141096, isoform CRA_c"
FT                   /note="gene_id=mCG141096.0 transcript_id=mCT193220.0
FT                   protein_id=mCP114211.0 isoform=CRA_c"
FT                   /protein_id="EDL34220.1"
FT                   /translation="MAAMAPALTDAAAEAHHIRFKLAPPSSTLSPGSAENNGNANILIS
FT                   ANGTKRKAIAAEDPSLDFRNNPTKEDLGKLQPLVASYLCSDVTSVPAKESLKLQGVFSK
FT                   QTVLKSHPLLSQSYELRAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTK
FT                   SSTHSDHDNSSSLNGGKRSLTSSSLQGGEVGGPDSGNLKGGMTNCTLPHRSLDIQHTTL
FT                   YSNNSTANKSSVNSMDQPALQGSSRLSPSTDSSSNLTNVKLEVKKSPLSSILFSALDSD
FT                   TRITALLRRQADIEIRARRLQKRLQVVQAKQVERHLQHQLGGFLETTLSKLPNLESLRS
FT                   RSQLMLTRKAEAALRKAASESATSEGLSNFLKSDSISEELERFTASGIANLRCSEQAFD
FT                   SDVTDSSSGGESDIEEEELTRADPEQCHVPLKRRSEWRWAADRAAIVSRWNWLQAHVSD
FT                   LEYRIRQQTDIYKQIRANKGLIVLGEAPFPDHTTDLLSLSSEVKTDHGRDKLIESVSQP
FT                   SENHGILVSNITESLSTKSCGAPRPVNGVVNSLQPVLADQVPGDSSDAEEQLHKKQRLN
FT                   LVSSSDGTCVAARTRPVLTCKKRRLVRPSSIVPLSKKVHRNVRSGCDVNPSCALCGSGS
FT                   VNTMPPEIHYEAPLLERLSQLDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKP
FT                   TKKFSLKHRATMPCSLSDPVRKDRHKLVNSFLTTAMLKHHTDMSSPSYLTATHHPPHSP
FT                   LVRQLSTSSDTSTPTSSGSQVAASTSQPVRRRRGESSFDINNIVIPMSVAATTRVEKLQ
FT                   YKEILTPSWREVDVQSLKGSPDEENEEIEDLSDAAFAALHAKCEEMERARWLWTTSVPP
FT                   QRRGSRSYRSSDGRTTPQLGSANPSTPQPASPDVSSSHSLSEFSHGQSPRSPISPELHS
FT                   APLTPVARDSLRHLASEDTRCSTPELGLDEQSVQPWERRTFPLAYSPQAECEEQLDAQD
FT                   TAARCTRRTSGSKTGREAEVAPTSPPVVPLKSRHLAATVTAQRPAHR"
FT   CDS             complement(join(2970713..2970940,2971182..2971434,
FT                   2971956..2972068,2972284..2972341,2975668..2975789,
FT                   2979921..2980069,2980417..2980605,2981049..2981231,
FT                   2988046..2988211,2994267..2994384,2994793..2994867,
FT                   2995472..2995587,3006612..3006710,3016578..3016719,
FT                   3061875..3063163))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141096"
FT                   /product="mCG141096, isoform CRA_a"
FT                   /note="gene_id=mCG141096.0 transcript_id=mCT173094.0
FT                   protein_id=mCP96014.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2A5Y4"
FT                   /db_xref="InterPro:IPR026180"
FT                   /db_xref="InterPro:IPR029332"
FT                   /db_xref="MGI:MGI:1923969"
FT                   /db_xref="UniProtKB/TrEMBL:A2A5Y4"
FT                   /protein_id="EDL34218.1"
FT                   /translation="MAAMAPALTDAAAEAHHIRFKLAPPSSTLSPGSAENNGNANILIS
FT                   ANGTKRKAIAAEDPSLDFRNNPTKEDLGKLQPLVASYLCSDVTSVPAKESLKLQGVFSK
FT                   QTVLKSHPLLSQSYELRAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTK
FT                   SSTHSDHDNSSSLNGGKRSLTSSSLQGGEVGGPDSGNLKGGMTNCTLPHRSLDIQHTTL
FT                   YSNNSTANKSSVNSMDQPALQGSSRLSPSTDSSSNLTNVKLEVKKSPLSSILFSALDSD
FT                   TRITALLRRQADIEIRARRLQKRLQVVQAKQVERHLQHQLGGFLETTLSKLPNLESLRS
FT                   RSQLMLTRKAEAALRKAASESATSEGLSNFLKSDSISEELERFTASGIANLRCSEQAFD
FT                   SDVTDSSSGGESDIEEEELTRADPEQCHVPLKRRSEWRWAADRAAIVSRWNWLQAHVSD
FT                   LEYRIRQQTDIYKQIRANKGLIVLGEAPFPDHTTDLLSLSSEVKTDHGRDKLIESVSQP
FT                   SENHGILVSNITESLSTKSCGAPRPVNGVVNSLQPVLADQVPGDSSDAEEQLHKKQRLN
FT                   LVSSSDGTCVAARTRPVLTCKKRRLVRPSSIVPLSKKVHRNVRSGCDVNPSCALCGSGS
FT                   VNTMPPEIHYEAPLLERLSQLDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKP
FT                   TKKFSLKHRATMPCSLSDPVRKDRHKLVNSFLTTAKLCHQQTRPDRTHRQHLDGVGAVP
FT                   MVERVTAPKAERLLHLPPPVHDPTHSKMRLRDHSSERSEVLKHHTDMSSPSYLTATHHP
FT                   PHSPLVRQLSTSSDTSTPTSSGSQVAASTSQPVRRRRGESSFDINNIVIPMSVAATTRV
FT                   EKLQYKEILTPSWREVDVQSLKGSPDEENEEIEDLSDAAFAALHAKCEEMERARWLWTT
FT                   SVPPQRRGSRSYRSSDGRTTPQLGSANPSTPQPASPDVSSSHSLSEFSHGQSPRSPISP
FT                   ELHSAPLTPVARDSLRHLASEDTRCSTPELGLDEQSVQPWERRTFPLAYSPQAECEEQL
FT                   DAQDTAARCTRRTSGSKTGREAEVAPTSPPVVPLKSRHLAATVTAQRPAHR"
FT   assembly_gap    2973511..2974716
FT                   /estimated_length=1206
FT                   /gap_type="unknown"
FT   assembly_gap    2994652..2994671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3079939..3080122
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    3104471..3104525
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    3105789..3105808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3106896..3106915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3134181..3134218
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    3134703..3134816
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   gene            complement(3140435..3188222)
FT                   /locus_tag="mCG_11216"
FT                   /note="gene_id=mCG11216.1"
FT   mRNA            complement(join(3140435..3143587,3145045..3145201,
FT                   3146254..3146328,3148078..3148206,3150669..3150786,
FT                   3153145..3153353,3155148..3155300,3158436..3158608,
FT                   3159153..3159360,3160495..3160594,3163824..3163939,
FT                   3164636..3164750,3166036..3166247,3166351..3166505,
FT                   3167114..3167211,3169478..3169603,3172488..3172635,
FT                   3174303..3174378,3188068..3188222))
FT                   /locus_tag="mCG_11216"
FT                   /product="mCG11216"
FT                   /note="gene_id=mCG11216.1 transcript_id=mCT11366.2 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(3143505..3143587,3145045..3145201,
FT                   3146254..3146328,3148078..3148206,3150669..3150786,
FT                   3153145..3153353,3155148..3155300,3158436..3158608,
FT                   3159153..3159360,3160495..3160594,3163824..3163939,
FT                   3164636..3164750,3166036..3166247,3166351..3166505,
FT                   3167114..3167211,3169478..3169603,3172488..3172635,
FT                   3174303..3174378,3188068..3188094))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11216"
FT                   /product="mCG11216"
FT                   /note="gene_id=mCG11216.1 transcript_id=mCT11366.2
FT                   protein_id=mCP14608.2"
FT                   /db_xref="GOA:A2A6Q5"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:102685"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2A6Q5"
FT                   /protein_id="EDL34221.1"
FT                   /translation="MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLA
FT                   TCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHD
FT                   DLVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPD
FT                   PDQTFKLTSLQNFSSCLPNTCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNS
FT                   KYSLNTDSSVSYIDSTVISPDNVPLGPGTAILSKQVQNKPKTGRSLLGGPTALSPLTPS
FT                   FGILPLETPSPGDGSYLQNYTNTPSVIDVAPTGAPTKKSVARMGQTGTKSVFSQSGNSR
FT                   EVTPVLVAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKM
FT                   KFPPKIPNRKTKSKTNKGGLTQPSINDSLEITKLDSSIISEGKITTVTPQIQAFNLQKA
FT                   AAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYSTGWVLCQIGRAYFELSEYM
FT                   QAERIFSEVRRIESFRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGN
FT                   CFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRH
FT                   YNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLN
FT                   KAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQ
FT                   THLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDA
FT                   DDTQLHAAESDEF"
FT   assembly_gap    3149855..3149938
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    3195772..3196457
FT                   /estimated_length=686
FT                   /gap_type="unknown"
FT   gene            complement(3196621..>3203454)
FT                   /locus_tag="mCG_146062"
FT                   /note="gene_id=mCG146062.0"
FT   mRNA            complement(join(3196621..3196744,3199361..3199515,
FT                   3203241..>3203454))
FT                   /locus_tag="mCG_146062"
FT                   /product="mCG146062"
FT                   /note="gene_id=mCG146062.0 transcript_id=mCT186165.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(3199430..3199515,3203241..>3203373))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146062"
FT                   /product="mCG146062"
FT                   /note="gene_id=mCG146062.0 transcript_id=mCT186165.0
FT                   protein_id=mCP107576.0"
FT                   /protein_id="EDL34222.1"
FT                   /translation="DLGWRSLTRCCSEGISEDRHSSSTISGTTPSAVTVSDADDTFVLA
FT                   EYNPTVQRITCLQAIPRLMDIWADFDS"
FT   gene            3211327..3212609
FT                   /locus_tag="mCG_11222"
FT                   /note="gene_id=mCG11222.2"
FT   mRNA            3211327..3212609
FT                   /locus_tag="mCG_11222"
FT                   /product="mCG11222"
FT                   /note="gene_id=mCG11222.2 transcript_id=mCT11370.2 created
FT                   on 10-SEP-2002"
FT   CDS             3211333..3211683
FT                   /codon_start=1
FT                   /locus_tag="mCG_11222"
FT                   /product="mCG11222"
FT                   /note="gene_id=mCG11222.2 transcript_id=mCT11370.2
FT                   protein_id=mCP14614.1"
FT                   /db_xref="GOA:B2RQ11"
FT                   /db_xref="InterPro:IPR018737"
FT                   /db_xref="MGI:MGI:3045391"
FT                   /db_xref="UniProtKB/TrEMBL:B2RQ11"
FT                   /protein_id="EDL34223.1"
FT                   /translation="MGWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAAS
FT                   FKSPITSSPPKWMAEIERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTR
FT                   GKFLNILEKPKK"
FT   gene            3213232..3225046
FT                   /gene="Myl4"
FT                   /locus_tag="mCG_11219"
FT                   /note="gene_id=mCG11219.2"
FT   mRNA            join(3213232..3213327,3215246..3215399,3218227..3218254,
FT                   3221810..3221959,3222271..3222444,3222769..3222846,
FT                   3223559..3223603,3224918..3225030)
FT                   /gene="Myl4"
FT                   /locus_tag="mCG_11219"
FT                   /product="myosin, light polypeptide 4, transcript variant
FT                   mCT171072"
FT                   /note="gene_id=mCG11219.2 transcript_id=mCT171072.0 created
FT                   on 24-JUL-2002"
FT   assembly_gap    3213704..3213723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3214645..3214970
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   mRNA            join(3215211..3215399,3218227..3218254,3221810..3221959,
FT                   3222271..3222444,3222769..3222846,3223559..3223603,
FT                   3224918..3225046)
FT                   /gene="Myl4"
FT                   /locus_tag="mCG_11219"
FT                   /product="myosin, light polypeptide 4, transcript variant
FT                   mCT11365"
FT                   /note="gene_id=mCG11219.2 transcript_id=mCT11365.1 created
FT                   on 24-JUL-2002"
FT   mRNA            join(3215237..3215399,3218227..3218254,3219819..3219854,
FT                   3221810..3221959,3222271..3222444,3222769..3222846,
FT                   3223559..3223603,3224918..3225043)
FT                   /gene="Myl4"
FT                   /locus_tag="mCG_11219"
FT                   /product="myosin, light polypeptide 4, transcript variant
FT                   mCT171071"
FT                   /note="gene_id=mCG11219.2 transcript_id=mCT171071.0 created
FT                   on 24-JUL-2002"
FT   CDS             join(3215277..3215399,3218227..3218254,3219819..3219854,
FT                   3221810..3221959,3222271..3222444,3222769..3222846,
FT                   3223559..3223587)
FT                   /codon_start=1
FT                   /gene="Myl4"
FT                   /locus_tag="mCG_11219"
FT                   /product="myosin, light polypeptide 4, isoform CRA_a"
FT                   /note="gene_id=mCG11219.2 transcript_id=mCT171071.0
FT                   protein_id=mCP93989.0 isoform=CRA_a"
FT                   /protein_id="EDL34224.1"
FT                   /translation="MPPKKPEPKKEAAKPAAAPAPAASAAPEPLKDSAFDPKSVKIDFS
FT                   ADQIEVSHLPIGEAVAAEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLR
FT                   VLGKPKPEEMSSKTLDFEMFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAEL
FT                   RHVLATLGEKMSEAEVEQLLSGQEDANGCINYEAFVKHIMSG"
FT   CDS             join(3215277..3215399,3218227..3218254,3221810..3221959,
FT                   3222271..3222444,3222769..3222846,3223559..3223587)
FT                   /codon_start=1
FT                   /gene="Myl4"
FT                   /locus_tag="mCG_11219"
FT                   /product="myosin, light polypeptide 4, isoform CRA_b"
FT                   /note="gene_id=mCG11219.2 transcript_id=mCT171072.0
FT                   protein_id=mCP93990.0 isoform=CRA_b"
FT                   /protein_id="EDL34225.1"
FT                   /translation="MPPKKPEPKKEAAKPAAAPAPAASAAPEPLKDSAFDPKSVKIDFS
FT                   ADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMSS
FT                   KTLDFEMFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMS
FT                   EAEVEQLLSGQEDANGCINYEAFVKHIMSG"
FT   CDS             join(3215277..3215399,3218227..3218254,3221810..3221959,
FT                   3222271..3222444,3222769..3222846,3223559..3223587)
FT                   /codon_start=1
FT                   /gene="Myl4"
FT                   /locus_tag="mCG_11219"
FT                   /product="myosin, light polypeptide 4, isoform CRA_b"
FT                   /note="gene_id=mCG11219.2 transcript_id=mCT11365.1
FT                   protein_id=mCP14665.0 isoform=CRA_b"
FT                   /protein_id="EDL34226.1"
FT                   /translation="MPPKKPEPKKEAAKPAAAPAPAASAAPEPLKDSAFDPKSVKIDFS
FT                   ADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMSS
FT                   KTLDFEMFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMS
FT                   EAEVEQLLSGQEDANGCINYEAFVKHIMSG"
FT   assembly_gap    3234131..3234297
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    3241480..3241872
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    3243455..3243630
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   gene            3246207..3299856
FT                   /gene="Itgb3"
FT                   /locus_tag="mCG_11220"
FT                   /note="gene_id=mCG11220.2"
FT   mRNA            join(3246207..3246315,3261677..3261762,3270484..3270679,
FT                   3271694..3271946,3275345..3275507,3276116..3276277,
FT                   3278622..3278717,3279331..3279420,3280514..3280648,
FT                   3281906..3282335,3290770..3290992,3292083..3292183,
FT                   3294361..3294480,3297501..3297667,3299153..3299856)
FT                   /gene="Itgb3"
FT                   /locus_tag="mCG_11220"
FT                   /product="integrin beta 3"
FT                   /note="gene_id=mCG11220.2 transcript_id=mCT11368.2 created
FT                   on 24-JUL-2002"
FT   CDS             join(3246240..3246315,3261677..3261762,3270484..3270679,
FT                   3271694..3271946,3275345..3275507,3276116..3276277,
FT                   3278622..3278717,3279331..3279420,3280514..3280648,
FT                   3281906..3282335,3290770..3290992,3292083..3292183,
FT                   3294361..3294480,3297501..3297667,3299153..3299218)
FT                   /codon_start=1
FT                   /gene="Itgb3"
FT                   /locus_tag="mCG_11220"
FT                   /product="integrin beta 3"
FT                   /note="gene_id=mCG11220.2 transcript_id=mCT11368.2
FT                   protein_id=mCP14669.2"
FT                   /db_xref="GOA:O54890"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002369"
FT                   /db_xref="InterPro:IPR012896"
FT                   /db_xref="InterPro:IPR013111"
FT                   /db_xref="InterPro:IPR014836"
FT                   /db_xref="InterPro:IPR015812"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027068"
FT                   /db_xref="InterPro:IPR032695"
FT                   /db_xref="MGI:MGI:96612"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54890"
FT                   /protein_id="EDL34227.1"
FT                   /translation="MRAQWPGQLWAALLALGALAGVVVGESNICTTRGVNSCQQCLAVS
FT                   PVCAWCSDETLSQGSPRCNLKENLLKDNCAPESIEFPVSEAQILEARPLSSKGSGSSAQ
FT                   ITQVSPQRIALRLRPDDSKIFSLQVRQVEDYPVDIYYLMDLSFSMKDDLSSIQTLGTKL
FT                   ASQMRKLTSNLRIGFGAFVDKPVSPYMYISPPQAIKNPCYNMKNACLPMFGYKHVLTLT
FT                   DQVSRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHI
FT                   ALDGRLAGIVLPNDGHCHIGTDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVV
FT                   SLYQNYSELIPGTTVGVLSDDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATC
FT                   LNNEVIPGLKSCVGLKIGDTVSFSIEAKVRGCPQEKEQSFTIKPVGFKDSLTVQVTFDC
FT                   DCACQAFAQPSSPRCNNGNGTFECGVCRCDQGWLGSMCECSEEDYRPSQQEECSPKEGQ
FT                   PICSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCNCGDCVCDS
FT                   DWTGYYCNCTTRTDTCMSTNGLLCSGRGNCECGSCVCVQPGSYGDTCEKCPTCPDACSF
FT                   KKECVECKKFNRGTLHEENTCSRYCRDDIEQVKELTDTGKNAVNCTYKNEDDCVVRFQY
FT                   YEDTSGRAVLYVVEEPECPKGPDILVVLLSVMGAILLIGLATLLIWKLLITIHDRKEFA
FT                   KFEEERARAKWDTANNPLYKEATSTFTNITYRGT"
FT   assembly_gap    3255531..3256580
FT                   /estimated_length=1050
FT                   /gap_type="unknown"
FT   assembly_gap    3263354..3263425
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    3287879..3288121
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    3293485..3293504
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3302011..3302552)
FT                   /locus_tag="mCG_1042085"
FT                   /note="gene_id=mCG1042085.1"
FT   mRNA            complement(3302011..3302552)
FT                   /locus_tag="mCG_1042085"
FT                   /product="mCG1042085"
FT                   /note="gene_id=mCG1042085.1 transcript_id=mCT159789.1
FT                   created on 10-SEP-2002"
FT   CDS             complement(3302270..3302464)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042085"
FT                   /product="mCG1042085"
FT                   /note="gene_id=mCG1042085.1 transcript_id=mCT159789.1
FT                   protein_id=mCP75172.1"
FT                   /protein_id="EDL34228.1"
FT                   /translation="MDKDSDVAVGSFRTTVSEGKNGNRATCQAFSVSSCCPQTETGPKP
FT                   PVRERAQPLCAAYSFPAQF"
FT   assembly_gap    3303424..3304391
FT                   /estimated_length=968
FT                   /gap_type="unknown"
FT   assembly_gap    3305572..3305816
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    3307577..3307970
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    3309821..3309840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3313017..3314169
FT                   /estimated_length=1153
FT                   /gap_type="unknown"
FT   assembly_gap    3333941..3334071
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    3336594..3336826
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    3360937..3361050
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    3369712..3370172
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    3371451..3371765
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    3378119..3378163
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    3380826..3381256
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    3421872..3421891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3423208..3423472
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    3425397..3425416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3440724..3441084
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    3442238..3444292
FT                   /estimated_length=2055
FT                   /gap_type="unknown"
FT   assembly_gap    3445382..3446291
FT                   /estimated_length=910
FT                   /gap_type="unknown"
FT   assembly_gap    3469132..3469151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3470200..3470219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3472023..3472042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3484427..3484446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3492057..3492934
FT                   /estimated_length=878
FT                   /gap_type="unknown"
FT   assembly_gap    3519147..3519166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3532004..3532594
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    3546386..3546405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3552781..3552858
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    3557361..3558397
FT                   /estimated_length=1037
FT                   /gap_type="unknown"
FT   assembly_gap    3567371..3567782
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    3575474..3575549
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    3618470..3618489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3623695..3623729
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    3661019..3661038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3667300..3667812
FT                   /estimated_length=513
FT                   /gap_type="unknown"
FT   assembly_gap    3678550..3679406
FT                   /estimated_length=857
FT                   /gap_type="unknown"
FT   assembly_gap    3684358..3684377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3692633..3692772
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    3694924..3694943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3710893..3711097
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   gene            3734929..3760247
FT                   /locus_tag="mCG_4811"
FT                   /note="gene_id=mCG4811.2"
FT   mRNA            join(3734929..3735214,3736280..3736364,3738554..3738630,
FT                   3742623..3742766,3744923..3744994,3749056..3749176,
FT                   3751478..3751659,3751960..3752144,3754499..3754621,
FT                   3759779..3760247)
FT                   /locus_tag="mCG_4811"
FT                   /product="mCG4811"
FT                   /note="gene_id=mCG4811.2 transcript_id=mCT3808.2 created on
FT                   04-APR-2003"
FT   CDS             join(3736297..3736364,3738554..3738630,3742623..3742766,
FT                   3744923..3744994,3749056..3749176,3751478..3751659,
FT                   3751960..3752144,3754499..3754621,3759779..3760105)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4811"
FT                   /product="mCG4811"
FT                   /note="gene_id=mCG4811.2 transcript_id=mCT3808.2
FT                   protein_id=mCP14687.1"
FT                   /protein_id="EDL34229.1"
FT                   /translation="MAVSEIKATMKLKPLKAPVFHKRDKDLRGSFSDHLKHKESKLSPA
FT                   QLEAFRNAYNFFTKDRTGCIDSHGLISTIAKLGMNLNTYDIYNELKCADLDRDGKINFS
FT                   DFINVLTDKKLFLKAVVPEKKICLDLANNPGILLFEILSKFVETSSLHRKDIIELVSYF
FT                   RKRFQESHSEIMWSSYGRRGLKSEICSPPRSSTAAFANSARISIMKERDLYKFLEALKR
FT                   CNLRTDSPYSKIPVFPLFPDVDGTVMGKPFKDTQKIEMLRRKEPLTFFEDYFFNKRDWK
FT                   TQAMNVKPLKSASGYSDDILAIDHLFKKKQHWTVTDAAAIKQHVKKATESYNLGIALDH
FT                   RKEMLNLWKKIRGDLVGIESNNESFYNTFSTYTWSWNVCQELLSAKDLRLHDASMNKSS
FT                   PSNSGLSSPSDFSESDPETGRKRKRKSSRGFRQ"
FT   assembly_gap    3757021..3757185
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   gene            3769182..3783095
FT                   /gene="Mettl2"
FT                   /locus_tag="mCG_4812"
FT                   /note="gene_id=mCG4812.1"
FT   mRNA            join(3769182..3769312,3769482..3769573,3771446..3771780,
FT                   3773152..3773201,3774278..3774338,3775146..3775285,
FT                   3778043..3778149,3780424..3780489,3782263..3783095)
FT                   /gene="Mettl2"
FT                   /locus_tag="mCG_4812"
FT                   /product="methyltransferase like 2, transcript variant
FT                   mCT3804"
FT                   /note="gene_id=mCG4812.1 transcript_id=mCT3804.2 created on
FT                   13-SEP-2002"
FT   mRNA            join(<3769183..3770147,3771446..3771780,3773152..3773201,
FT                   3774278..3774338,3775146..3775285,3778043..3778149,
FT                   3780424..3780489,3782263..3782723)
FT                   /gene="Mettl2"
FT                   /locus_tag="mCG_4812"
FT                   /product="methyltransferase like 2, transcript variant
FT                   mCT193201"
FT                   /note="gene_id=mCG4812.1 transcript_id=mCT193201.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(3769203..3769312,3769482..3769573,3771446..3771780,
FT                   3773152..3773201,3774278..3774338,3775146..3775285,
FT                   3778043..3778149,3780424..3780489,3782263..3782471)
FT                   /codon_start=1
FT                   /gene="Mettl2"
FT                   /locus_tag="mCG_4812"
FT                   /product="methyltransferase like 2, isoform CRA_c"
FT                   /note="gene_id=mCG4812.1 transcript_id=mCT3804.2
FT                   protein_id=mCP14611.2 isoform=CRA_c"
FT                   /protein_id="EDL34232.1"
FT                   /translation="MAASFPEGVPETEDGKRPQFGHRFLSDPARVFHHNAWDNVKWSEE
FT                   QAAAAERKVQENSSPLVCPEKQVDYEVNAHKYWDDFYRIHENGFFKDRHWLFTEFPELA
FT                   PSHSHLTGVPLEKQRSDVCEDGPGLTAEQHKCSCASPGCETQVPPLEEPVTQKLGHLEI
FT                   SGEEFPGSSATYRILEVGCGVGNTVFPILQTNNNPNLFVYCCDFSATAIELLKTNSQYD
FT                   PSRCYAFVHDLCDEDQSYPVPEDSLDVIVLIFVLSAIVPDKMQKAISKLSRLLKPGGVM
FT                   LLRDYGRYDMAQLRFKKGQCLSGNFYVRGDGTRVYFFTQGELDTLFTAAGLEKVQNLVD
FT                   RRLQVNRGKQLTMYRVWIQCKYSKPLALRSSQHVPIPHATESSSHSGLL"
FT   mRNA            join(<3769516..3769573,3773152..3773201,3774278..3774338,
FT                   3775146..3775285,3778043..3778149,3780424..3780489,
FT                   3782263..>3782387)
FT                   /gene="Mettl2"
FT                   /locus_tag="mCG_4812"
FT                   /product="methyltransferase like 2, transcript variant
FT                   mCT193200"
FT                   /note="gene_id=mCG4812.1 transcript_id=mCT193200.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3769517..3769573,3773152..3773201,3774278..3774338,
FT                   3775146..3775285,3778043..3778149,3780424..3780489,
FT                   3782263..>3782387)
FT                   /codon_start=1
FT                   /gene="Mettl2"
FT                   /locus_tag="mCG_4812"
FT                   /product="methyltransferase like 2, isoform CRA_a"
FT                   /note="gene_id=mCG4812.1 transcript_id=mCT193200.0
FT                   protein_id=mCP114172.0 isoform=CRA_a"
FT                   /protein_id="EDL34230.1"
FT                   /translation="RRRGKCRRTAPRWCARRSKVGCGVGNTVFPILQTNNNPNLFVYCC
FT                   DFSATAIELLKTNSQYDPSRCYAFVHDLCDEDQSYPVPEDSLDVIVLIFVLSAIVPDKM
FT                   QKAISKLSRLLKPGGVMLLRDYGRYDMAQLRFKKGQCLSGNFYVRGDGTRVYFFTQGEL
FT                   DTLFTAAGLEKVQNLVDRRLQVNRGKQLTMYRVWIQCKY"
FT   CDS             join(<3770147..3770147,3771446..3771780,3773152..3773201,
FT                   3774278..3774338,3775146..3775285,3778043..3778149,
FT                   3780424..3780489,3782263..3782471)
FT                   /codon_start=1
FT                   /gene="Mettl2"
FT                   /locus_tag="mCG_4812"
FT                   /product="methyltransferase like 2, isoform CRA_b"
FT                   /note="gene_id=mCG4812.1 transcript_id=mCT193201.0
FT                   protein_id=mCP114173.0 isoform=CRA_b"
FT                   /protein_id="EDL34231.1"
FT                   /translation="VDYEVNAHKYWDDFYRIHENGFFKDRHWLFTEFPELAPSHSHLTG
FT                   VPLEKQRSDVCEDGPGLTAEQHKCSCASPGCETQVPPLEEPVTQKLGHLEISGEEFPGS
FT                   SATYRILEVGCGVGNTVFPILQTNNNPNLFVYCCDFSATAIELLKTNSQYDPSRCYAFV
FT                   HDLCDEDQSYPVPEDSLDVIVLIFVLSAIVPDKMQKAISKLSRLLKPGGVMLLRDYGRY
FT                   DMAQLRFKKGQCLSGNFYVRGDGTRVYFFTQGELDTLFTAAGLEKVQNLVDRRLQVNRG
FT                   KQLTMYRVWIQCKYSKPLALRSSQHVPIPHATESSSHSGLL"
FT   assembly_gap    3792529..3792548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3794849..3794918
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    3803046..3803065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3807280..3809241)
FT                   /pseudo
FT                   /locus_tag="mCG_4814"
FT                   /note="gene_id=mCG4814.1"
FT   mRNA            complement(3807280..3809241)
FT                   /pseudo
FT                   /locus_tag="mCG_4814"
FT                   /note="gene_id=mCG4814.1 transcript_id=mCT3802.2 created on
FT                   13-SEP-2002"
FT   assembly_gap    3810553..3810666
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    3811761..3811940
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   gene            3821402..3924585
FT                   /gene="Tlk2"
FT                   /locus_tag="mCG_4813"
FT                   /note="gene_id=mCG4813.1"
FT   mRNA            join(3821402..3821941,3823088..3823186,3827021..3827103,
FT                   3850165..3850236,3851637..3851706,3852579..3852622,
FT                   3863967..3864134,3883065..3883160,3884273..3884365,
FT                   3889488..3889598,3890173..3890309,3892204..3892356,
FT                   3896004..3896070,3897683..3897780,3899587..3899668,
FT                   3902833..3902924,3909701..3909790,3912174..3912343,
FT                   3913532..3913670,3918241..3918352,3921522..3921629,
FT                   3923494..3924585)
FT                   /gene="Tlk2"
FT                   /locus_tag="mCG_4813"
FT                   /product="tousled-like kinase 2 (Arabidopsis), transcript
FT                   variant mCT3803"
FT                   /note="gene_id=mCG4813.1 transcript_id=mCT3803.1 created on
FT                   24-JUL-2002"
FT   assembly_gap    3824033..3825020
FT                   /estimated_length=988
FT                   /gap_type="unknown"
FT   mRNA            join(<3827019..3827103,3850165..3850236,3851637..3851706,
FT                   3863967..3864134,3883065..3883160,3884273..3884365,
FT                   3889488..3889598,3890173..3890309,3892204..3892356,
FT                   3896004..3896070,3897683..3897780,3899587..3899668,
FT                   3902833..3902924,3909701..3909790,3912174..3912343,
FT                   3913532..3913670,3918241..3918352,3921522..3921629,
FT                   3923494..3924585)
FT                   /gene="Tlk2"
FT                   /locus_tag="mCG_4813"
FT                   /product="tousled-like kinase 2 (Arabidopsis), transcript
FT                   variant mCT193206"
FT                   /note="gene_id=mCG4813.1 transcript_id=mCT193206.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(3827019..3827103,3850165..3850236,3851637..3851706,
FT                   3852579..3852622,3853330..3853425,3863967..3864134,
FT                   3883065..3883160,3884273..3884365,3889488..3889598,
FT                   3890173..3890309,3892204..3892356,3896004..3896070,
FT                   3897683..3897780,3899587..3899668,3902833..3902924,
FT                   3909701..3909790,3912174..3912343,3913532..3913670,
FT                   3918241..3918981)
FT                   /gene="Tlk2"
FT                   /locus_tag="mCG_4813"
FT                   /product="tousled-like kinase 2 (Arabidopsis), transcript
FT                   variant mCT171237"
FT                   /note="gene_id=mCG4813.1 transcript_id=mCT171237.0 created
FT                   on 24-JUL-2002"
FT   CDS             join(3827026..3827103,3850165..3850236,3851637..3851706,
FT                   3852579..3852622,3863967..3864134,3883065..3883160,
FT                   3884273..3884365,3889488..3889598,3890173..3890309,
FT                   3892204..3892356,3896004..3896070,3897683..3897780,
FT                   3899587..3899668,3902833..3902924,3909701..3909790,
FT                   3912174..3912343,3913532..3913670,3918241..3918352,
FT                   3921522..3921629,3923494..3923667)
FT                   /codon_start=1
FT                   /gene="Tlk2"
FT                   /locus_tag="mCG_4813"
FT                   /product="tousled-like kinase 2 (Arabidopsis), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG4813.1 transcript_id=mCT3803.1
FT                   protein_id=mCP14609.1 isoform=CRA_c"
FT                   /protein_id="EDL34235.1"
FT                   /translation="MEELHSLDPRRQELLEARFTGVGVSKGPLNSESSNQSLCSVGSLS
FT                   DKEVETPEKKQNDQRNRKRKAEPYDTSQGKGTPRGHKISDYFERRAEQPLYGLDGSAAK
FT                   EASEEQSALPTLMSVMLAKPRLDTEQLAPRGAGLCFTFVSAQQNSPSSTGSGNTEHSCS
FT                   SQKQISIQHRQTQSDLTIEKISALENSKNSDLEKKEGRIDDLLRANCDLRRQIDEQQKM
FT                   LEKYKERLNRCVTMSKKLLIEKSKQEKMACRDKSMQDRLRLGHFTTVRHGASFTEQWTD
FT                   GYAFQNLIKQQERINSQREEIERQRKMLAKRKPPAMGQAPPATNEQKQRKSKTNGAENE
FT                   TLTLAEYHEQEEIFKLRLGHLKKEEAEIQAELERLERVRNLHIRELKRIHNEDNSQFKD
FT                   HPTLNDRYLLLHLLGRGGFSEVYKAFDLTEQRYVAVKIHQLNKNWRDEKKENYHKHACR
FT                   EYRIHKELDHPRIVKLYDYFSLDTDSFCTVLEYCEGNDLDFYLKQHKLMSEKEARSIIM
FT                   QIVNALKYLNEIKPPIIHYDLKPGNILLVNGTACGEIKITDFGLSKIMDDDSYNSVDGM
FT                   ELTSQGAGTYWYLPPECFVVGKEPPKISNKVDVWSVGVIFYQCLYGRKPFGHNQSQQDI
FT                   LQENTILKATEVQFPPKPVVTPEAKAFIRRCLAYRKEDRIDVQQLACDPYLLPHIRKSV
FT                   STSSPAGAAIASTSGASNNSSSN"
FT   CDS             join(3827026..3827103,3850165..3850236,3851637..3851706,
FT                   3852579..3852622,3853330..3853425,3863967..3864134,
FT                   3883065..3883160,3884273..3884365,3889488..3889598,
FT                   3890173..3890309,3892204..3892356,3896004..3896070,
FT                   3897683..3897780,3899587..3899668,3902833..3902924,
FT                   3909701..3909790,3912174..3912343,3913532..3913670,
FT                   3918241..3918475)
FT                   /codon_start=1
FT                   /gene="Tlk2"
FT                   /locus_tag="mCG_4813"
FT                   /product="tousled-like kinase 2 (Arabidopsis), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4813.1 transcript_id=mCT171237.0
FT                   protein_id=mCP94155.0 isoform=CRA_a"
FT                   /protein_id="EDL34233.1"
FT                   /translation="MEELHSLDPRRQELLEARFTGVGVSKGPLNSESSNQSLCSVGSLS
FT                   DKEVETPEKKQNDQRNRKRKAEPYDTSQGKGTPRGHKISDYFEFAGGSGPGTSPGRSVP
FT                   PVARSSPQHSLSNPLPRRAEQPLYGLDGSAAKEASEEQSALPTLMSVMLAKPRLDTEQL
FT                   APRGAGLCFTFVSAQQNSPSSTGSGNTEHSCSSQKQISIQHRQTQSDLTIEKISALENS
FT                   KNSDLEKKEGRIDDLLRANCDLRRQIDEQQKMLEKYKERLNRCVTMSKKLLIEKSKQEK
FT                   MACRDKSMQDRLRLGHFTTVRHGASFTEQWTDGYAFQNLIKQQERINSQREEIERQRKM
FT                   LAKRKPPAMGQAPPATNEQKQRKSKTNGAENETLTLAEYHEQEEIFKLRLGHLKKEEAE
FT                   IQAELERLERVRNLHIRELKRIHNEDNSQFKDHPTLNDRYLLLHLLGRGGFSEVYKAFD
FT                   LTEQRYVAVKIHQLNKNWRDEKKENYHKHACREYRIHKELDHPRIVKLYDYFSLDTDSF
FT                   CTVLEYCEGNDLDFYLKQHKLMSEKEARSIIMQIVNALKYLNEIKPPIIHYDLKPGNIL
FT                   LVNGTACGEIKITDFGLSKIMDDDSYNSVDGMELTSQGAGTYWYLPPECFVVGKEPPKI
FT                   SNKVDVWSVGVIFYQCLYGRKVRKKAVEQPGAIPTTSLGFFFAVNHWNPESSGLKKIQT
FT                   SQ"
FT   assembly_gap    3832769..3833915
FT                   /estimated_length=1147
FT                   /gap_type="unknown"
FT   assembly_gap    3846263..3846467
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   CDS             join(<3850235..3850236,3851637..3851706,3863967..3864134,
FT                   3883065..3883160,3884273..3884365,3889488..3889598,
FT                   3890173..3890309,3892204..3892356,3896004..3896070,
FT                   3897683..3897780,3899587..3899668,3902833..3902924,
FT                   3909701..3909790,3912174..3912343,3913532..3913670,
FT                   3918241..3918352,3921522..3921629,3923494..3923667)
FT                   /codon_start=1
FT                   /gene="Tlk2"
FT                   /locus_tag="mCG_4813"
FT                   /product="tousled-like kinase 2 (Arabidopsis), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4813.1 transcript_id=mCT193206.0
FT                   protein_id=mCP114174.0 isoform=CRA_b"
FT                   /protein_id="EDL34234.1"
FT                   /translation="RLLRKSRMTSEIGKGKPSHMTLAKRRAEQPLYGLDGSAAKEASEE
FT                   QSALPTLMSVMLAKPRLDTEQLAPRGAGLCFTFVSAQQNSPSSTGSGNTEHSCSSQKQI
FT                   SIQHRQTQSDLTIEKISALENSKNSDLEKKEGRIDDLLRANCDLRRQIDEQQKMLEKYK
FT                   ERLNRCVTMSKKLLIEKSKQEKMACRDKSMQDRLRLGHFTTVRHGASFTEQWTDGYAFQ
FT                   NLIKQQERINSQREEIERQRKMLAKRKPPAMGQAPPATNEQKQRKSKTNGAENETLTLA
FT                   EYHEQEEIFKLRLGHLKKEEAEIQAELERLERVRNLHIRELKRIHNEDNSQFKDHPTLN
FT                   DRYLLLHLLGRGGFSEVYKAFDLTEQRYVAVKIHQLNKNWRDEKKENYHKHACREYRIH
FT                   KELDHPRIVKLYDYFSLDTDSFCTVLEYCEGNDLDFYLKQHKLMSEKEARSIIMQIVNA
FT                   LKYLNEIKPPIIHYDLKPGNILLVNGTACGEIKITDFGLSKIMDDDSYNSVDGMELTSQ
FT                   GAGTYWYLPPECFVVGKEPPKISNKVDVWSVGVIFYQCLYGRKPFGHNQSQQDILQENT
FT                   ILKATEVQFPPKPVVTPEAKAFIRRCLAYRKEDRIDVQQLACDPYLLPHIRKSVSTSSP
FT                   AGAAIASTSGASNNSSSN"
FT   assembly_gap    3868875..3869291
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   assembly_gap    3874683..3874821
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    3895259..3895278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3913058..3913177
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    3917273..3917292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3935065..3994731
FT                   /gene="Mrc2"
FT                   /locus_tag="mCG_4815"
FT                   /note="gene_id=mCG4815.2"
FT   mRNA            join(3935065..3935312,3968499..3968900,3971025..3971198,
FT                   3971330..3971494,3971716..3971829,3972278..3972421,
FT                   3974937..3975125,3975289..3975443,3976677..3976784,
FT                   3979305..3979420,3979793..3979941,3980797..3981014,
FT                   3981965..3982107,3983495..3983597,3983815..3983953,
FT                   3984075..3984110,3984371..3984531,3984628..3984695,
FT                   3986370..3986470,3986739..3986881,3989494..3989608,
FT                   3989714..3989877,3990004..3990112,3990513..3990751,
FT                   3990877..3991045,3991138..3991284,3991585..3991704,
FT                   3991876..3992055,3992846..3992872,3992977..3994731)
FT                   /gene="Mrc2"
FT                   /locus_tag="mCG_4815"
FT                   /product="mannose receptor, C type 2, transcript variant
FT                   mCT3809"
FT                   /note="gene_id=mCG4815.2 transcript_id=mCT3809.1 created on
FT                   24-JUL-2002"
FT   mRNA            join(<3935079..3935312,3968499..3968900,3971025..3971198,
FT                   3971330..3971494,3971716..3971829,3972278..3972421,
FT                   3974937..3975125,3975289..3975443,3976677..3976784,
FT                   3979305..3979420,3979793..3979941,3980797..3981014,
FT                   3981965..3982107,3983495..3983597,3983815..3983953,
FT                   3984075..3984110,3984371..3984531,3984628..3984695,
FT                   3986370..3986470,3986739..3987154)
FT                   /gene="Mrc2"
FT                   /locus_tag="mCG_4815"
FT                   /product="mannose receptor, C type 2, transcript variant
FT                   mCT193208"
FT                   /note="gene_id=mCG4815.2 transcript_id=mCT193208.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3935081..3935312,3968499..3968900,3971025..3971198,
FT                   3971330..3971494,3971716..3971829,3972278..3972421,
FT                   3974937..3975125,3975289..3975443,3976677..3976784,
FT                   3979305..3979420,3979793..3979941,3980797..3981014,
FT                   3981965..3982107,3983495..3983597,3983815..3983953,
FT                   3984075..3984110,3984371..3984531,3984628..3984695,
FT                   3986370..3986470,3986739..3987100)
FT                   /codon_start=1
FT                   /gene="Mrc2"
FT                   /locus_tag="mCG_4815"
FT                   /product="mannose receptor, C type 2, isoform CRA_a"
FT                   /note="gene_id=mCG4815.2 transcript_id=mCT193208.0
FT                   protein_id=mCP114175.0 isoform=CRA_a"
FT                   /protein_id="EDL34236.1"
FT                   /translation="TRRRMRSPRRRSSEHSARAVSARSPAVRPPYSRPPSAAGMVPIRP
FT                   ALAPWPRHLLRCVLLLGGLRLGHPADSAAALLEPDVFLIFSQGMQGCLEAQGVQVRVTP
FT                   VCNASLPAQRWKWVSRNRLFNLGATQCLGTGWPVTNTTVSLGMYECDREALSLRWQCRT
FT                   LGDQLSLLLGARASNASKPGTLERGDQTRSGHWNIYGSEEDLCARPYYEVYTIQGNSHG
FT                   KPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWDKDQ
FT                   LTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGLND
FT                   LDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKK
FT                   KPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSI
FT                   HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLE
FT                   DCVTIWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGED
FT                   QVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLS
FT                   GDEVIYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPEL
FT                   PGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLA
FT                   SYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFAR
FT                   SRHDDDDIRGCAVLDLASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQ
FT                   EAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQHWWIGLH
FT                   TLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTARQEDWGDQRCHTALPYICK
FT                   RSNSSGETQPQDLPPSALGGCPSGWNQFLNKVGSWEGTRRVRGEDGNRCWLSLRHPPSC
FT                   SATPFICPHTPLCANESEVPWKVAQCWSTREQNYLNTLVSFLDQ"
FT   CDS             join(3935198..3935312,3968499..3968900,3971025..3971198,
FT                   3971330..3971494,3971716..3971829,3972278..3972421,
FT                   3974937..3975125,3975289..3975443,3976677..3976784,
FT                   3979305..3979420,3979793..3979941,3980797..3981014,
FT                   3981965..3982107,3983495..3983597,3983815..3983953,
FT                   3984075..3984110,3984371..3984531,3984628..3984695,
FT                   3986370..3986470,3986739..3986881,3989494..3989608,
FT                   3989714..3989877,3990004..3990112,3990513..3990751,
FT                   3990877..3991045,3991138..3991284,3991585..3991704,
FT                   3991876..3992055,3992846..3992872,3992977..3993203)
FT                   /codon_start=1
FT                   /gene="Mrc2"
FT                   /locus_tag="mCG_4815"
FT                   /product="mannose receptor, C type 2, isoform CRA_b"
FT                   /note="gene_id=mCG4815.2 transcript_id=mCT3809.1
FT                   protein_id=mCP14626.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q14AX9"
FT                   /db_xref="InterPro:IPR000562"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR001304"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR018378"
FT                   /db_xref="MGI:MGI:107818"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AX9"
FT                   /protein_id="EDL34237.1"
FT                   /translation="MVPIRPALAPWPRHLLRCVLLLGGLRLGHPADSAAALLEPDVFLI
FT                   FSQGMQGCLEAQGVQVRVTPVCNASLPAQRWKWVSRNRLFNLGATQCLGTGWPVTNTTV
FT                   SLGMYECDREALSLRWQCRTLGDQLSLLLGARASNASKPGTLERGDQTRSGHWNIYGSE
FT                   EDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDE
FT                   RWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQ
FT                   TYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTE
FT                   SSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEK
FT                   RSWQESKRACLRGGGDLLSIHSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGS
FT                   LVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEED
FT                   HGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEG
FT                   EYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCT
FT                   SFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKK
FT                   SWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPR
FT                   EGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAVLDLASLQWVPMQCQTQLDWICKIPRG
FT                   VDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFL
FT                   GQNLQKLSSDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMT
FT                   ARQEDWGDQRCHTALPYICKRSNSSGETQPQDLPPSALGGCPSGWNQFLNKCFQIQGQD
FT                   PQDRVKWSEAQFSCEQQEAQLVTIANPLEQAFITASLPNVTFDLWIGLHASQRDFQWIE
FT                   QEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQ
FT                   KGTDPSLSPSPAATPPAPGAELSYLNHTFRLLQKPLRWKDALLLCESRNASLAHVPDPY
FT                   TQAFLTQAARGLQTPLWIGLASEEGSRRYSWLSEEPLNYVSWQDEEPQHSGGCAYVDVD
FT                   GTWRTTSCDTKLQGAVCGVSRGPPPRRINYRGSCPQGLADSSWIPFREHCYSFHMEVLL
FT                   GHKEALQRCQKAGGTVLSILDEMENVFVWEHLQTAEAQSRGAWLGMNFNPKGGTLVWQD
FT                   NTAVNYSNWGPPGLGPSMLSHNSCYWIQSSSGLWRPGACTNITMGVVCKLPRVEENSFL
FT                   PSAALPESPVALVVVLTAVLLLLALMTAALILYRRRQSAERGSFEGARYSRSSHSGPAE
FT                   ATEKNILVSDMEMNEQQE"
FT   assembly_gap    3937195..3937214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3939876..3939895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3949163..3949230
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    3950850..3951388
FT                   /estimated_length=539
FT                   /gap_type="unknown"
FT   assembly_gap    3953649..3953708
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    3955425..3956042
FT                   /estimated_length=618
FT                   /gap_type="unknown"
FT   assembly_gap    3961485..3961504
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3982985..3983277
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   gene            complement(4004112..4032979)
FT                   /locus_tag="mCG_4818"
FT                   /note="gene_id=mCG4818.2"
FT   mRNA            complement(join(4004112..4004513,4007824..4007866,
FT                   4015146..4015259,4025431..4025540,4028687..4028856,
FT                   4032862..4032968))
FT                   /locus_tag="mCG_4818"
FT                   /product="mCG4818, transcript variant mCT173104"
FT                   /note="gene_id=mCG4818.2 transcript_id=mCT173104.0 created
FT                   on 13-SEP-2002"
FT   CDS             complement(join(4004458..4004513,4007824..4007866,
FT                   4015146..4015259,4025431..4025540,4028687..4028856,
FT                   4032862..4032923))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4818"
FT                   /product="mCG4818, isoform CRA_a"
FT                   /note="gene_id=mCG4818.2 transcript_id=mCT173104.0
FT                   protein_id=mCP96023.0 isoform=CRA_a"
FT                   /protein_id="EDL34238.1"
FT                   /translation="MDEKATEIKADPEKLRKLQESLLEEDSEEEEGDLCRICQIAGGSP
FT                   ANPLLEPCGCVGSLQFVHQECLKKWLKVKITSGADLGTVKTCEMCKQGLLVDLDDFNMT
FT                   EFYHKHQQSRAQSELMNSGLYLVLLLHLYEQRFAELMALNYRRASRERLSRNYPQPRPE
FT                   ENESSESGDGNASNIYPGRVI"
FT   assembly_gap    4005988..4006041
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   gene            <4006559..4033921
FT                   /locus_tag="mCG_144858"
FT                   /note="gene_id=mCG144858.0"
FT   mRNA            join(<4006559..4006897,4022329..4022529,4023989..4024158,
FT                   4033015..4033921)
FT                   /locus_tag="mCG_144858"
FT                   /product="mCG144858"
FT                   /note="gene_id=mCG144858.0 transcript_id=mCT184282.0
FT                   created on 05-JUN-2003"
FT   mRNA            complement(join(4007398..4007866,4015146..4015259,
FT                   4025431..4025540,4028687..4028856,4032862..4032979))
FT                   /locus_tag="mCG_4818"
FT                   /product="mCG4818, transcript variant mCT3811"
FT                   /note="gene_id=mCG4818.2 transcript_id=mCT3811.1 created on
FT                   13-SEP-2002"
FT   CDS             complement(join(4007774..4007866,4015146..4015259,
FT                   4025431..4025540,4028687..4028856,4032862..4032923))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4818"
FT                   /product="mCG4818, isoform CRA_b"
FT                   /note="gene_id=mCG4818.2 transcript_id=mCT3811.1
FT                   protein_id=mCP14683.2 isoform=CRA_b"
FT                   /protein_id="EDL34239.1"
FT                   /translation="MDEKATEIKADPEKLRKLQESLLEEDSEEEEGDLCRICQIAGGSP
FT                   ANPLLEPCGCVGSLQFVHQECLKKWLKVKITSGADLGTVKTCEMCKQGLLVDLDDFNMT
FT                   EFYHKHQQSRAQSELMNSGLYLVLLLHLYEQRFAELMALNYRRASRERLSRNYPQPRPE
FT                   ENESRFGGASCPAPSKGAC"
FT   CDS             <4033466..4033765
FT                   /codon_start=1
FT                   /locus_tag="mCG_144858"
FT                   /product="mCG144858"
FT                   /note="gene_id=mCG144858.0 transcript_id=mCT184282.0
FT                   protein_id=mCP105787.0"
FT                   /protein_id="EDL34240.1"
FT                   /translation="TADLSSTVPPLDTSSALTWITPSDFASPRTGVFSSWSPLGFSLAN
FT                   SLGNLVSWSILCPGEGCFVAGSVVLVFLGDPGLGSLHLREFPLRFSAFSSTFLF"
FT   gene            complement(4044979..4096242)
FT                   /locus_tag="mCG_4822"
FT                   /note="gene_id=mCG4822.2"
FT   mRNA            complement(join(4044979..4045530,4051905..4052076,
FT                   4075710..4075772,4090591..4090697,4093777..4093858,
FT                   4095992..4096242))
FT                   /locus_tag="mCG_4822"
FT                   /product="mCG4822, transcript variant mCT3801"
FT                   /note="gene_id=mCG4822.2 transcript_id=mCT3801.2 created on
FT                   10-APR-2003"
FT   mRNA            complement(join(4044984..4045530,4051905..4052076,
FT                   4075656..4075772,4090591..4090697,4093777..4093858,
FT                   4095992..4096242))
FT                   /locus_tag="mCG_4822"
FT                   /product="mCG4822, transcript variant mCT181801"
FT                   /note="gene_id=mCG4822.2 transcript_id=mCT181801.0 created
FT                   on 10-APR-2003"
FT   CDS             complement(join(4045196..4045530,4051905..4052076,
FT                   4075710..4075772,4090591..4090680))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4822"
FT                   /product="mCG4822, isoform CRA_b"
FT                   /note="gene_id=mCG4822.2 transcript_id=mCT3801.2
FT                   protein_id=mCP14636.2 isoform=CRA_b"
FT                   /protein_id="EDL34242.1"
FT                   /translation="MLHETRDRQKFVSDVQYLRDMQHKVDSEYQACLKRQENKKEPNEK
FT                   KQEQLWSSCEEDSRSEARLSTKTSSAKCEPRLPAIDQASVKQKHKGTMTLKKSEKVSPS
FT                   KPSPGDSSEQPLFCVEYSPYCSVFAFSPTQQPNTNYCCLLLPLVPPAAQGAQSPSTSLP
FT                   PAIFPTFSTPPSSPLSPLLGSPASLCYFPVSQPTPAETPVLCLPGPRRPSKIYLIW"
FT   CDS             complement(join(4045196..4045530,4051905..4052076,
FT                   4075656..4075772,4090591..4090680))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4822"
FT                   /product="mCG4822, isoform CRA_a"
FT                   /note="gene_id=mCG4822.2 transcript_id=mCT181801.0
FT                   protein_id=mCP104723.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q497L7"
FT                   /db_xref="MGI:MGI:2443469"
FT                   /db_xref="UniProtKB/TrEMBL:Q497L7"
FT                   /protein_id="EDL34241.1"
FT                   /translation="MLHETRDRQKFVSDVQYLRDMQHKVDSEYQACLKRQENKKEPNEK
FT                   KQEQLWVRDTSDRSRFSSGSSCKQSSCEEDSRSEARLSTKTSSAKCEPRLPAIDQASVK
FT                   QKHKGTMTLKKSEKVSPSKPSPGDSSEQPLFCVEYSPYCSVFAFSPTQQPNTNYCCLLL
FT                   PLVPPAAQGAQSPSTSLPPAIFPTFSTPPSSPLSPLLGSPASLCYFPVSQPTPAETPVL
FT                   CLPGPRRPSKIYLIW"
FT   assembly_gap    4046000..4046019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(<4052014..4052076,4075656..4075772,
FT                   4090591..4090697,4093777..4093858,4094645..4094811))
FT                   /locus_tag="mCG_4822"
FT                   /product="mCG4822, transcript variant mCT181802"
FT                   /note="gene_id=mCG4822.2 transcript_id=mCT181802.0 created
FT                   on 10-APR-2003"
FT   CDS             complement(join(<4052014..4052076,4075656..4075772,
FT                   4090591..4090680))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4822"
FT                   /product="mCG4822, isoform CRA_c"
FT                   /note="gene_id=mCG4822.2 transcript_id=mCT181802.0
FT                   protein_id=mCP104724.0 isoform=CRA_c"
FT                   /protein_id="EDL34243.1"
FT                   /translation="MLHETRDRQKFVSDVQYLRDMQHKVDSEYQACLKRQENKKEPNEK
FT                   KQEQLWVRDTSDRSRFSSGSSCKQSSCEEDSRSEARLSTKTSSAK"
FT   assembly_gap    4056339..4056358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4068173..4068505
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    4077739..4077929
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    4078957..4078976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4080356..4080375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4099333..4099491
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    4132102..4132121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4185341..4185360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4209795..4209814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4226779..4226798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4228927..4229375
FT                   /estimated_length=449
FT                   /gap_type="unknown"
FT   gene            4229376..4355265
FT                   /locus_tag="mCG_141099"
FT                   /note="gene_id=mCG141099.0"
FT   mRNA            join(4229376..4229620,4264374..4264463,4312857..4312928,
FT                   4354777..4355265)
FT                   /locus_tag="mCG_141099"
FT                   /product="mCG141099"
FT                   /note="gene_id=mCG141099.0 transcript_id=mCT173098.0
FT                   created on 13-SEP-2002"
FT   assembly_gap    4237016..4237037
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   CDS             join(4264397..4264463,4312857..4312928,4354777..4354976)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141099"
FT                   /product="mCG141099"
FT                   /note="gene_id=mCG141099.0 transcript_id=mCT173098.0
FT                   protein_id=mCP96017.0"
FT                   /protein_id="EDL34244.1"
FT                   /translation="MFRNSLKMLLTGGKSSRKNRSSDGGSEEPPDRRQSSVDSRQSRSG
FT                   QGGISTESDCAFEPDYAVPPLPVSEGMQHIRIMEGMSRSLPSSPLLTHQSISVRLQPVK
FT                   KLTGKEFT"
FT   assembly_gap    4280726..4280745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4282369..4282534
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    4317418..4317437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4343342..4354327
FT                   /estimated_length=10986
FT                   /gap_type="unknown"
FT   gene            <4375338..4376224
FT                   /locus_tag="mCG_1042090"
FT                   /note="gene_id=mCG1042090.0"
FT   mRNA            join(<4375338..4375880,4375905..4376224)
FT                   /locus_tag="mCG_1042090"
FT                   /product="mCG1042090"
FT                   /note="gene_id=mCG1042090.0 transcript_id=mCT159794.1
FT                   created on 13-SEP-2002"
FT   CDS             <4375504..4375635
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042090"
FT                   /product="mCG1042090"
FT                   /note="gene_id=mCG1042090.0 transcript_id=mCT159794.1
FT                   protein_id=mCP75199.0"
FT                   /protein_id="EDL34245.1"
FT                   /translation="YGKNLDQKAKFIPSVSLTKTFITNMLTILLNTQEYGNTNNKLH"
FT   assembly_gap    4397010..4397097
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   gene            <4400305..4566635
FT                   /locus_tag="mCG_120711"
FT                   /note="gene_id=mCG120711.0"
FT   mRNA            join(<4400305..4400415,4418202..4418350,4421335..4421521,
FT                   4439917..4440180,4451842..4451967,4476325..4476606,
FT                   4481998..4482131,4498783..4499014,4505294..4505460,
FT                   4508544..4509151,4527724..4527832,4537290..4537412,
FT                   4537912..4538148,4541129..4541314,4543505..4543598,
FT                   4550454..4550587,4551662..4551785,4554373..4554548,
FT                   4554818..4554950,4555502..4555531,4556353..4556444,
FT                   4558375..4558521,4561493..4561593,4563290..4566635)
FT                   /locus_tag="mCG_120711"
FT                   /product="mCG120711"
FT                   /note="gene_id=mCG120711.0 transcript_id=mCT121903.1
FT                   created on 13-SEP-2002"
FT   CDS             join(<4400307..4400415,4418202..4418350,4421335..4421521,
FT                   4439917..4440180,4451842..4451967,4476325..4476606,
FT                   4481998..4482131,4498783..4499014,4505294..4505460,
FT                   4508544..4509151,4527724..4527832,4537290..4537412,
FT                   4537912..4538148,4541129..4541314,4543505..4543598,
FT                   4550454..4550587,4551662..4551785,4554373..4554548,
FT                   4554818..4554950,4555502..4555531,4556353..4556444,
FT                   4558375..4558521,4561493..4561593,4563290..4565258)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120711"
FT                   /product="mCG120711"
FT                   /note="gene_id=mCG120711.0 transcript_id=mCT121903.1
FT                   protein_id=mCP75184.1"
FT                   /protein_id="EDL34246.1"
FT                   /translation="PLRKAKFVESPRIPESELGSPTLTSAQKLDVDAYCPGDVEQELGP
FT                   PPSVDEAANTLMTRLGFLLGEKVTEVQPSDQYSMEVQDENQTSAITQRISPCSTLTSST
FT                   ASPPASSPCSTLPPVSTNAAAKDCSYGAVTSPTSTLESRDSGIIATLTNYSENMERTKY
FT                   VGEGSKELGSGGNLKPWQSQKSSMDSCLYRVDENMAASTYSLNKIPERNLETVLSQSVQ
FT                   SIPLYLMPRPNSVAATSSAHLEDLAYLDEQRHTPLRTSLRMPRQSLSGARTQQDLRVRF
FT                   APYRPPDISLKPLLFEVPSITTESVFVGRDWVFHEIDAQLQSSNASVNQGVVIVGNIGF
FT                   GKTAIISRLVALSCHGTRMRQIASDSPHASPKHVDANRELPLTQAPSAHSSITSGSCPG
FT                   TPEMRRRQEEAMRRLASQVVAYHYCQADNAYTCLVPEFVHNVAALLCRSPQLTAYREQL
FT                   LREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIILIDGLNEAEFHK
FT                   PDYGDTIVSFLSKMIGNFPSWLKLIVTVRTSLQEITKLLPFHRIFLDRLEENEAIDQDL
FT                   QAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHLKTLSQGSYLYLKLTFDLIEKGYL
FT                   VLKSSSYKVVPVSLSEVYLLQCNMKFPTQSSFDRVMPLLNVAVASLHPLTDEHIFQAIN
FT                   AGSIEGTLEWEDFQQRMENLSMFLIKRRDMTRMFVHPSFREWLIWREEGEKTKFLCDPR
FT                   SGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLWISYSTE
FT                   GLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEMVALLL
FT                   EFGANVDASSESGLTPLGYAAAAGFLSIVVLLCKKRAKVDHLDKNGQCALVHAALRGHL
FT                   EVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGYTEIVSYLLDLPEKDEEEVER
FT                   AQINSFDSLWGETALTAAAGRGKLDVCRLLLEQGAAVAQPNRRGAVPLFSTVRQGHWQI
FT                   VDLLLTHGADVNMADKQGRTPLMMAASEGHLGTVDFLLAQGASIALMDKEGLTALSWAC
FT                   LKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFYGDAEVVQFLVDHGAMIEHVDYSGM
FT                   RPLDRAVGCRNTSVVVTLLKKGAKIGCQTLPSRPRGPATWAMATSKPDIMIILLSKLME
FT                   EGDMFYKKGKVKEAAQRYQYALKKFPREGFGEDLKTFRELKVSLLLNLSRCRRKMNDFG
FT                   MAEEFATKALELKPKSYEAYYARARAKRSSRQFAAALEDLKEAIKLCPNNREIQRLLMR
FT                   VEEECRQMQQQQQQQPPPPPQQPPQELPEEETEPEPQHEDIYSVQDIFEEEYLEQDVEN
FT                   VSIGLQTEARPSQGLPVIQSPPSSPAHRDSAYISSSPLGSHQVFDFRSNSSVGSPTRQG
FT                   YQSTSPALSPTHQNSHYRPSPPHTSPAHQGASYRFSPPPVGGQSKEYPSPPPSPLRRGP
FT                   QYRASPPAESMSVYRSQSGSPVRYQQETNVSQLPGRPKSPLSKMAQRPYQMPQLPVAVP
FT                   QQGLRLQPAKAQIVRSNQPSSAVHSSTVIPTGAYGQVAHSMASKYQSSQGDMGVSQSRL
FT                   VYQGSIGGIVGDGRPVQHVQASLSAGAICQHGGLTKEDLPQRPSSAYRGGMRYSQTPQI
FT                   GRSQSASYYPVCHSKLDLERSSSQLGSPDVSHLIRRPISVNPNEIKPHPPTPRPLLHSQ
FT                   SVGLRFSPSSNSISSTSNLTPTFRPSSSIQQMEIPLKPAYDRSCDELSPVSPTQGGYPS
FT                   EPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPP
FT                   SSISNIAFYNKTNNAQNGHLLEDDYYSPHGMLANGSRGDLLERVSQASSYPDVKVARTL
FT                   PVAQAYQDNLYRQLSRDSRQGQTSPIKPKRPFVESNV"
FT   gene            4414821..4417547
FT                   /pseudo
FT                   /locus_tag="mCG_4817"
FT                   /note="gene_id=mCG4817.2"
FT   mRNA            4414821..4417547
FT                   /pseudo
FT                   /locus_tag="mCG_4817"
FT                   /note="gene_id=mCG4817.2 transcript_id=mCT3796.2 created on
FT                   13-SEP-2002"
FT   assembly_gap    4559800..4559819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4575244..4594875)
FT                   /gene="Cyb561"
FT                   /locus_tag="mCG_4819"
FT                   /note="gene_id=mCG4819.2"
FT   mRNA            complement(join(4575244..4577110,4577295..4577452,
FT                   4577725..4577828,4578098..4578196,4579172..4579383,
FT                   4585651..4586027))
FT                   /gene="Cyb561"
FT                   /locus_tag="mCG_4819"
FT                   /product="cytochrome b-561, transcript variant mCT3797"
FT                   /note="gene_id=mCG4819.2 transcript_id=mCT3797.2 created on
FT                   31-JUL-2002"
FT   mRNA            complement(join(4575247..4577110,4577295..4577452,
FT                   4577725..4577828,4578098..4578196,4579172..4579383,
FT                   4594586..4594875))
FT                   /gene="Cyb561"
FT                   /locus_tag="mCG_4819"
FT                   /product="cytochrome b-561, transcript variant mCT171352"
FT                   /note="gene_id=mCG4819.2 transcript_id=mCT171352.0 created
FT                   on 31-JUL-2002"
FT   mRNA            complement(join(4575247..4577110,4577295..4577452,
FT                   4577725..4577828,4578098..4578196,4579172..4579383,
FT                   4581640..4581704,4585651..4586027))
FT                   /gene="Cyb561"
FT                   /locus_tag="mCG_4819"
FT                   /product="cytochrome b-561, transcript variant mCT171353"
FT                   /note="gene_id=mCG4819.2 transcript_id=mCT171353.0 created
FT                   on 31-JUL-2002"
FT   mRNA            complement(join(4575247..4577110,4577295..4577452,
FT                   4577725..4577828,4578098..4578196,4579172..4579383,
FT                   4581640..4581918,4585651..4586027))
FT                   /gene="Cyb561"
FT                   /locus_tag="mCG_4819"
FT                   /product="cytochrome b-561, transcript variant mCT171354"
FT                   /note="gene_id=mCG4819.2 transcript_id=mCT171354.0 created
FT                   on 31-JUL-2002"
FT   CDS             complement(join(4576918..4577110,4577295..4577452,
FT                   4577725..4577828,4578098..4578196,4579172..4579383,
FT                   4594586..4594686))
FT                   /codon_start=1
FT                   /gene="Cyb561"
FT                   /locus_tag="mCG_4819"
FT                   /product="cytochrome b-561, isoform CRA_a"
FT                   /note="gene_id=mCG4819.2 transcript_id=mCT171352.0
FT                   protein_id=mCP94273.0 isoform=CRA_a"
FT                   /protein_id="EDL34247.1"
FT                   /translation="MSSRLFRGWLSRQSTLKGGRGMPLTEGTRSNRLSWGLRMEHSSAS
FT                   VPAALPYYVAFSQLLGLTVVAVTGAWLGLYRGGIAWESSLQFNVHPLCMVIGMIFLQGD
FT                   ALLVYRVFRREAKRTTKILHGLLHVFAFIIALVGLVAVFDYHKKKGYADLYSLHSWCGI
FT                   LVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQHIFFGATIFLFSVGTALLGLKEALLF
FT                   KLGSKYSTFEPEGVLANVLGLLLVCFGVVVLYILAQADWKRPSQAEEQALSMDFKTLTE
FT                   GDSPSPQ"
FT   CDS             complement(join(4576918..4577110,4577295..4577452,
FT                   4577725..4577828,4578098..4578196,4579172..4579383,
FT                   4581640..4581704,4585651..4585743))
FT                   /codon_start=1
FT                   /gene="Cyb561"
FT                   /locus_tag="mCG_4819"
FT                   /product="cytochrome b-561, isoform CRA_b"
FT                   /note="gene_id=mCG4819.2 transcript_id=mCT171353.0
FT                   protein_id=mCP94271.0 isoform=CRA_b"
FT                   /protein_id="EDL34248.1"
FT                   /translation="MATPSRRGSWNLPSVRGAARGRAQAWRRRDKEQGRRHFPREHRGT
FT                   NLEQNPRGWGLRMEHSSASVPAALPYYVAFSQLLGLTVVAVTGAWLGLYRGGIAWESSL
FT                   QFNVHPLCMVIGMIFLQGDALLVYRVFRREAKRTTKILHGLLHVFAFIIALVGLVAVFD
FT                   YHKKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQHIFFGAT
FT                   IFLFSVGTALLGLKEALLFKLGSKYSTFEPEGVLANVLGLLLVCFGVVVLYILAQADWK
FT                   RPSQAEEQALSMDFKTLTEGDSPSPQ"
FT   CDS             complement(join(4576918..4577110,4577295..4577452,
FT                   4577725..4577828,4578098..4578196,4579172..4579370))
FT                   /codon_start=1
FT                   /gene="Cyb561"
FT                   /locus_tag="mCG_4819"
FT                   /product="cytochrome b-561, isoform CRA_c"
FT                   /note="gene_id=mCG4819.2 transcript_id=mCT171354.0
FT                   protein_id=mCP94272.0 isoform=CRA_c"
FT                   /protein_id="EDL34249.1"
FT                   /translation="MEHSSASVPAALPYYVAFSQLLGLTVVAVTGAWLGLYRGGIAWES
FT                   SLQFNVHPLCMVIGMIFLQGDALLVYRVFRREAKRTTKILHGLLHVFAFIIALVGLVAV
FT                   FDYHKKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQHIFFG
FT                   ATIFLFSVGTALLGLKEALLFKLGSKYSTFEPEGVLANVLGLLLVCFGVVVLYILAQAD
FT                   WKRPSQAEEQALSMDFKTLTEGDSPSPQ"
FT   CDS             complement(join(4576918..4577110,4577295..4577452,
FT                   4577725..4577828,4578098..4578196,4579172..4579370))
FT                   /codon_start=1
FT                   /gene="Cyb561"
FT                   /locus_tag="mCG_4819"
FT                   /product="cytochrome b-561, isoform CRA_c"
FT                   /note="gene_id=mCG4819.2 transcript_id=mCT3797.2
FT                   protein_id=mCP14676.2 isoform=CRA_c"
FT                   /protein_id="EDL34250.1"
FT                   /translation="MEHSSASVPAALPYYVAFSQLLGLTVVAVTGAWLGLYRGGIAWES
FT                   SLQFNVHPLCMVIGMIFLQGDALLVYRVFRREAKRTTKILHGLLHVFAFIIALVGLVAV
FT                   FDYHKKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQHIFFG
FT                   ATIFLFSVGTALLGLKEALLFKLGSKYSTFEPEGVLANVLGLLLVCFGVVVLYILAQAD
FT                   WKRPSQAEEQALSMDFKTLTEGDSPSPQ"
FT   gene            4586251..4586789
FT                   /locus_tag="mCG_1042091"
FT                   /note="gene_id=mCG1042091.1"
FT   mRNA            4586251..4586789
FT                   /locus_tag="mCG_1042091"
FT                   /product="mCG1042091"
FT                   /note="gene_id=mCG1042091.1 transcript_id=mCT159795.1
FT                   created on 13-SEP-2002"
FT   CDS             4586420..4586662
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042091"
FT                   /product="mCG1042091"
FT                   /note="gene_id=mCG1042091.1 transcript_id=mCT159795.1
FT                   protein_id=mCP75204.1"
FT                   /protein_id="EDL34251.1"
FT                   /translation="MLRIDKSLAQTSYKLGTKGSFLLDAWPDSRRGGEKWGILPCEAKH
FT                   DCEGSPWNTSACWELPTGRSQNWGGGSFLEGGYAV"
FT   assembly_gap    4598202..4598417
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   gene            complement(4606977..>4627059)
FT                   /locus_tag="mCG_146063"
FT                   /note="gene_id=mCG146063.0"
FT   mRNA            complement(join(4606977..4607945,4613794..4613909,
FT                   4626902..>4627059))
FT                   /locus_tag="mCG_146063"
FT                   /product="mCG146063"
FT                   /note="gene_id=mCG146063.0 transcript_id=mCT186166.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(4607417..>4607614)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146063"
FT                   /product="mCG146063"
FT                   /note="gene_id=mCG146063.0 transcript_id=mCT186166.0
FT                   protein_id=mCP107577.0"
FT                   /protein_id="EDL34252.1"
FT                   /translation="STGLSTMPYFWGSGYRLYQSALFSVGFPELSMHLSQRREHKGDMN
FT                   DWRSSTCPWQGAPGLCKSDL"
FT   gene            4609327..4631348
FT                   /gene="Ace"
FT                   /locus_tag="mCG_4821"
FT                   /note="gene_id=mCG4821.1"
FT   mRNA            join(4609327..4609614,4610276..4610443,4611070..4611163,
FT                   4611922..4612065,4612661..4612852,4613386..4613483,
FT                   4613730..4613902,4614230..4614453,4614757..4614901,
FT                   4615144..4615242,4615469..4615591,4616032..4616243,
FT                   4616901..4617037,4617910..4618068,4618317..4618404,
FT                   4620534..4620677,4620845..4621036,4622862..4622959,
FT                   4623132..4623304,4626409..4626632,4626937..4627081,
FT                   4627354..4627452,4629403..4629525,4629816..4630003,
FT                   4630189..4631348)
FT                   /gene="Ace"
FT                   /locus_tag="mCG_4821"
FT                   /product="angiotensin I converting enzyme
FT                   (peptidyl-dipeptidase A) 1, transcript variant mCT3800"
FT                   /note="gene_id=mCG4821.1 transcript_id=mCT3800.2 created on
FT                   13-SEP-2002"
FT   mRNA            join(4609328..4609614,4610276..4610443,4611070..4611163,
FT                   4611922..4612065,4612661..4612852,4613386..4613483,
FT                   4613730..4613902,4614230..4614453,4614757..4614901,
FT                   4615144..4615242,4615469..4615591,4616032..4616243,
FT                   4616901..4617037,4617910..4618068,4618317..4618404,
FT                   4620845..4621036,4622862..4622959,4623132..4623304,
FT                   4626409..4626632,4626937..4627081,4627354..4627452,
FT                   4629403..4629525,4629816..4630003,4630189..4631288)
FT                   /gene="Ace"
FT                   /locus_tag="mCG_4821"
FT                   /product="angiotensin I converting enzyme
FT                   (peptidyl-dipeptidase A) 1, transcript variant mCT173105"
FT                   /note="gene_id=mCG4821.1 transcript_id=mCT173105.0 created
FT                   on 13-SEP-2002"
FT   CDS             join(4609351..4609614,4610276..4610443,4611070..4611163,
FT                   4611922..4612065,4612661..4612852,4613386..4613483,
FT                   4613730..4613902,4614230..4614453,4614757..4614901,
FT                   4615144..4615242,4615469..4615591,4616032..4616243,
FT                   4616901..4617037,4617910..4618068,4618317..4618404,
FT                   4620534..4620677,4620845..4621036,4622862..4622959,
FT                   4623132..4623304,4626409..4626632,4626937..4627081,
FT                   4627354..4627452,4629403..4629525,4629816..4630003,
FT                   4630189..4630421)
FT                   /codon_start=1
FT                   /gene="Ace"
FT                   /locus_tag="mCG_4821"
FT                   /product="angiotensin I converting enzyme
FT                   (peptidyl-dipeptidase A) 1, isoform CRA_c"
FT                   /note="gene_id=mCG4821.1 transcript_id=mCT3800.2
FT                   protein_id=mCP14680.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q3TU20"
FT                   /db_xref="InterPro:IPR001548"
FT                   /db_xref="MGI:MGI:87874"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TU20"
FT                   /protein_id="EDL34255.1"
FT                   /translation="MGAASGQRGRWPLSPPLLMLSLLVLLLQPSPAPALDPGLQPGNFS
FT                   PDEAGAQLFAESYNSSAEVVMFQSTVASWAHDTNITEENARRQEEAALVSQEFAEVWGK
FT                   KAKELYESIWQNFTDSKLRRIIGSIRTLGPANLPLAQRQQYNSLLSNMSRIYSTGKVCF
FT                   PNKTATCWSLDPELTNILASSRSYAKLLFAWEGWHDAVGIPLKPLYQDFTAISNEAYRQ
FT                   DDFSDTGAFWRSWYESPSFEESLEHIYHQLEPLYLNLHAYVRRALHRRYGDKYVNLRGP
FT                   IPAHLLGDMWAQSWENIYDMVVPFPDKPNLDVTSTMVQKGWNATHMFRVSEEFFTSLGL
FT                   SPMPPEFWAESMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTRVTMEQLATVHHEMGH
FT                   VQYYLQYKDLHVSLRRGANPGFHEAIGDVLALSVSTPAHLHKIGLLDHVTNDIESDINY
FT                   LLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVARNETH
FT                   FDAGAKFHIPNVTPYIRYFVSFVLQFQFHQALCKEAGHQGPLHQCDIYQSAQAGAKLKQ
FT                   VLQAGCSRPWQEVLKDLVGSDALDAKALLEYFQPVSQWLEEQNQRNGEVLGWPENQWRP
FT                   PLPDNYPEGIDLETDEAKADRFVEEYDRTAQVLLNEYAEANWQYNTNITIEGSKILLEK
FT                   STEVSNHTLKYGTRAKTFDVSNFQNSSIKRIIKKLQNLDRAVLPPKELEEYNQILLDME
FT                   TTYSLSNICYTNGTCMPLEPDLTNMMATSRKYEELLWAWKSWRDKVGRAILPFFPKYVE
FT                   FSNKIAKLNGYTDAGDSWRSLYESDNLEQDLEKLYQELQPLYLNLHAYVRRSLHRHYGS
FT                   EYINLDGPIPAHLLGNMWAQTWSNIYDLVAPFPSAPNIDATEAMIKQGWTPRRIFKEAD
FT                   NFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHPSAWDFYNGKDFRIKQCTSVNMEDLV
FT                   IAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDIMALSVSTPKHLYSLNLLSTEGS
FT                   GYEYDINFLMKMALDKIAFIPFSYLIDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCP
FT                   PVPRSQGDFDPGSKFHVPANVPYVRYFVSFIIQFQFHEALCRAAGHTGPLHKCDIYQSK
FT                   EAGKLLADAMKLGYSKPWPEAMKLITGQPNMSASAMMNYFKPLTEWLVTENRRHGETLG
FT                   WPEYNWAPNTARAEGSTAESNRVNFLGLYLEPQQARVGQWVLLFLGVALLVATVGLAHR
FT                   LYNIRNHHSLRRPHRGPQFGSEVELRHS"
FT   CDS             join(4609351..4609614,4610276..4610443,4611070..4611163,
FT                   4611922..4612065,4612661..4612852,4613386..4613483,
FT                   4613730..4613902,4614230..4614453,4614757..4614901,
FT                   4615144..4615242,4615469..4615591,4616032..4616243,
FT                   4616901..4617037,4617910..4618068,4618317..4618404,
FT                   4620845..4621036,4622862..4622959,4623132..4623304,
FT                   4626409..4626632,4626937..4627081,4627354..4627452,
FT                   4629403..4629525,4629816..4630003,4630189..4630421)
FT                   /codon_start=1
FT                   /gene="Ace"
FT                   /locus_tag="mCG_4821"
FT                   /product="angiotensin I converting enzyme
FT                   (peptidyl-dipeptidase A) 1, isoform CRA_a"
FT                   /note="gene_id=mCG4821.1 transcript_id=mCT173105.0
FT                   protein_id=mCP96024.0 isoform=CRA_a"
FT                   /protein_id="EDL34253.1"
FT                   /translation="MGAASGQRGRWPLSPPLLMLSLLVLLLQPSPAPALDPGLQPGNFS
FT                   PDEAGAQLFAESYNSSAEVVMFQSTVASWAHDTNITEENARRQEEAALVSQEFAEVWGK
FT                   KAKELYESIWQNFTDSKLRRIIGSIRTLGPANLPLAQRQQYNSLLSNMSRIYSTGKVCF
FT                   PNKTATCWSLDPELTNILASSRSYAKLLFAWEGWHDAVGIPLKPLYQDFTAISNEAYRQ
FT                   DDFSDTGAFWRSWYESPSFEESLEHIYHQLEPLYLNLHAYVRRALHRRYGDKYVNLRGP
FT                   IPAHLLGDMWAQSWENIYDMVVPFPDKPNLDVTSTMVQKGWNATHMFRVSEEFFTSLGL
FT                   SPMPPEFWAESMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTRVTMEQLATVHHEMGH
FT                   VQYYLQYKDLHVSLRRGANPGFHEAIGDVLALSVSTPAHLHKIGLLDHVTNDIESDINY
FT                   LLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVARNETH
FT                   FDAGAKFHIPNVTPYIRYFVSFVLQFQFHQALCKEAGHQGPLHQCDIYQSAQAGAKLKQ
FT                   VLQAGCSRPWQEVLKDLVGSDALDAKALLEYFQPVSQWLEEQNQRNGEVLGWPENQWRP
FT                   PLPDNYPEGIDLETDEAKADRFVEEYDRTAQVLLNEYAEANWQYNTNITIEGSKILLEK
FT                   STEVSNHTLKYGTRAKTFDVSNFQNSSIKRIIKKLQNLDRAVLPPKELEEYNQILLDME
FT                   TTYSLSNICYTNGTCMPLEPGYTDAGDSWRSLYESDNLEQDLEKLYQELQPLYLNLHAY
FT                   VRRSLHRHYGSEYINLDGPIPAHLLGNMWAQTWSNIYDLVAPFPSAPNIDATEAMIKQG
FT                   WTPRRIFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHPSAWDFYNGKDFRIK
FT                   QCTSVNMEDLVIAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDIMALSVSTPKHL
FT                   YSLNLLSTEGSGYEYDINFLMKMALDKIAFIPFSYLIDQWRWRVFDGSITKENYNQEWW
FT                   SLRLKYQGLCPPVPRSQGDFDPGSKFHVPANVPYVRYFVSFIIQFQFHEALCRAAGHTG
FT                   PLHKCDIYQSKEAGKLLADAMKLGYSKPWPEAMKLITGQPNMSASAMMNYFKPLTEWLV
FT                   TENRRHGETLGWPEYNWAPNTARAEGSTAESNRVNFLGLYLEPQQARVGQWVLLFLGVA
FT                   LLVATVGLAHRLYNIRNHHSLRRPHRGPQFGSEVELRHS"
FT   mRNA            join(<4612692..4612852,4613386..4613483,4613730..4613902,
FT                   4614230..4614453,4614757..4614901,4615144..4615242,
FT                   4615469..4615591,4616032..4616243,4616901..4617037,
FT                   4617910..4618068,4618317..4618404,4620534..4620677,
FT                   4620845..4621036,4622862..4622959,4623132..4623304,
FT                   4626409..4626632,4626937..4627081,4627354..4627452,
FT                   4629403..4629525,4629816..4630646)
FT                   /gene="Ace"
FT                   /locus_tag="mCG_4821"
FT                   /product="angiotensin I converting enzyme
FT                   (peptidyl-dipeptidase A) 1, transcript variant mCT193235"
FT                   /note="gene_id=mCG4821.1 transcript_id=mCT193235.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4612693..4612852,4613386..4613483,4613730..4613902,
FT                   4614230..4614453,4614757..4614901,4615144..4615242,
FT                   4615469..4615591,4616032..4616243,4616901..4617037,
FT                   4617910..4618068,4618317..4618404,4620534..4620677,
FT                   4620845..4621036,4622862..4622959,4623132..4623304,
FT                   4626409..4626632,4626937..4627081,4627354..4627452,
FT                   4629403..4629525,4629816..4630047)
FT                   /codon_start=1
FT                   /gene="Ace"
FT                   /locus_tag="mCG_4821"
FT                   /product="angiotensin I converting enzyme
FT                   (peptidyl-dipeptidase A) 1, isoform CRA_b"
FT                   /note="gene_id=mCG4821.1 transcript_id=mCT193235.0
FT                   protein_id=mCP114237.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8K233"
FT                   /db_xref="InterPro:IPR001548"
FT                   /db_xref="MGI:MGI:87874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K233"
FT                   /protein_id="EDL34254.1"
FT                   /translation="WYESPSFEESLEHIYHQLEPLYLNLHAYVRRALHRRYGDKYVNLR
FT                   GPIPAHLLGDMWAQSWENIYDMVVPFPDKPNLDVTSTMVQKGWNATHMFRVSEEFFTSL
FT                   GLSPMPPEFWAESMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTRVTMEQLATVHHEM
FT                   GHVQYYLQYKDLHVSLRRGANPGFHEAIGDVLALSVSTPAHLHKIGLLDHVTNDIESDI
FT                   NYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVARNE
FT                   THFDAGAKFHIPNVTPYIRYFVSFVLQFQFHQALCKEAGHQGPLHQCDIYQSAQAGAKL
FT                   KQVLQAGCSRPWQEVLKDLVGSDALDAKALLEYFQPVSQWLEEQNQRNGEVLGWPENQW
FT                   RPPLPDNYPEGIDLETDEAKADRFVEEYDRTAQVLLNEYAEANWQYNTNITIEGSKILL
FT                   EKSTEVSNHTLKYGTRAKTFDVSNFQNSSIKRIIKKLQNLDRAVLPPKELEEYNQILLD
FT                   METTYSLSNICYTNGTCMPLEPDLTNMMATSRKYEELLWAWKSWRDKVGRAILPFFPKY
FT                   VEFSNKIAKLNGYTDAGDSWRSLYESDNLEQDLEKLYQELQPLYLNLHAYVRRSLHRHY
FT                   GSEYINLDGPIPAHLLGNMWAQTWSNIYDLVAPFPSAPNIDATEAMIKQGWTPRRIFKE
FT                   ADNFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHPSAWDFYNGKDFRIKQCTSVNMED
FT                   LVIAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDIMALSVSTPKHLYSLNLLSTE
FT                   GSGYEYDINFLMKMALDKIAFIPFSYLIDQWRWRVFDGSITKENYNQEWWSLRLKYQGL
FT                   CPPVPRSQGDFDPGSKFHVPANVPYVRYFVSFIIQFQFHEALCRAAGHTGPLHKCDIYQ
FT                   SKEAGKLLADAMKLGYSKPWPEAMKLITGQPNMSASAMMNYFKPLTEWLVTENRRHGET
FT                   LGWPEYNWAPNTGTTPTLPPAPGPSS"
FT   gene            <4636123..>4646834
FT                   /locus_tag="mCG_4823"
FT                   /note="gene_id=mCG4823.2"
FT   mRNA            join(<4636123..4636386,4636772..4636930,4637192..4637279,
FT                   4637398..4637541,4638282..4638473,4638555..4638652,
FT                   4638764..4638936,4639265..4639488,4639641..4639785,
FT                   4641328..4641426,4641600..4641722,4645815..4645999,
FT                   4646476..>4646834)
FT                   /locus_tag="mCG_4823"
FT                   /product="mCG4823"
FT                   /note="gene_id=mCG4823.2 transcript_id=mCT3795.1 created on
FT                   13-SEP-2002"
FT   CDS             join(4636123..4636386,4636772..4636930,4637192..4637279,
FT                   4637398..4637541,4638282..4638473,4638555..4638652,
FT                   4638764..4638936,4639265..4639488,4639641..4639785,
FT                   4641328..4641426,4641600..4641722,4645815..4645999,
FT                   4646476..4646834)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4823"
FT                   /product="mCG4823"
FT                   /note="gene_id=mCG4823.2 transcript_id=mCT3795.1
FT                   protein_id=mCP14651.1"
FT                   /protein_id="EDL34256.1"
FT                   /translation="MAQDCGRDKLKYGWDLKKHRTKYEDCGGAAPSSRPTRSPSLADDF
FT                   YSEAQAKLFLQFYEQTAQVVLNEFMEATWNYVTNITKQNQKNMLQKEADRSQFMLYFST
FT                   RARMFRTDHFLNQDVKRMLRKLQNIDKSALPTEDLLEYNRLLTYMETAYNRAEVCLDEG
FT                   PCLTLEPDLQEIMATSRDQKELLWAWQGWRDAVGRQLRPVFEDYVRLSNKAAQYNGYKD
FT                   MGALWRSKYESDTLEEDLEQLYKELQPLYLNLHAYVRRSLYRYYGPELIDLRGPIPAHL
FT                   LGNMWAQSWNNILDLVLPYPTKAPEDITAIMKIQHWRPEKMFEEANLFFTSMGMLPAPP
FT                   AFWIKSMMEKPADGREVECHTSSWNFYKFNDFRVKKCTEVTLEDLLSVFHQMGHIQYFL
FT                   QYQNLSVIYQEGASPAFEEAVGSVIALSVSSHKYLLARGLLSQPHQDSEEEVNFLLGIA
FT                   LEKIAFIPFSYLVDKFRWKIFDGTISKITYNQEWWNFRLKYQGLCPPVPRSDDDFDPGA
FT                   KFHIPANVPYIRYFLGLILQFQLHEALCEASGHVGPLHQCDNYNSKVAGKILGDLLKLG
FT                   SSRPWREVLQEVTGESNISTKAFLTYFKPLMDWLVTENVKQGDTLGWPDFSCSFEEKIT
FT                   SKVSFLGTDTEPEQAYLGQWVLLSMSFFMLVLILALGFRLHYLEKQLLDEDTMILKTLP
FT                   YSYFLGIAMEPHQAARKQWLLLGLCCILMLCCIGLLIRIVTQNTENTPWMKNEGQS"
FT   gene            <4649594..>4670134
FT                   /gene="Kcnh6"
FT                   /locus_tag="mCG_141098"
FT                   /note="gene_id=mCG141098.0"
FT   mRNA            join(<4649594..4649669,4650374..4650604,4655519..4655680,
FT                   4655776..4655981,4658626..4659051,4660143..4660542,
FT                   4661513..4661712,4661882..4662134,4665116..4665309,
FT                   4667185..4667269,4668107..4668263,4668948..4669128,
FT                   4669853..>4670134)
FT                   /gene="Kcnh6"
FT                   /locus_tag="mCG_141098"
FT                   /product="potassium voltage-gated channel, subfamily H
FT                   (eag-related), member 6"
FT                   /note="gene_id=mCG141098.0 transcript_id=mCT173097.0
FT                   created on 13-SEP-2002"
FT   CDS             join(4649594..4649669,4650374..4650604,4655519..4655680,
FT                   4655776..4655981,4658626..4659051,4660143..4660542,
FT                   4661513..4661712,4661882..4662134,4665116..4665309,
FT                   4667185..4667269,4668107..4668263,4668948..4669128,
FT                   4669853..4670134)
FT                   /codon_start=1
FT                   /gene="Kcnh6"
FT                   /locus_tag="mCG_141098"
FT                   /product="potassium voltage-gated channel, subfamily H
FT                   (eag-related), member 6"
FT                   /note="gene_id=mCG141098.0 transcript_id=mCT173097.0
FT                   protein_id=mCP96016.0"
FT                   /db_xref="GOA:Q32ME0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR003967"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR030172"
FT                   /db_xref="MGI:MGI:2684139"
FT                   /db_xref="UniProtKB/TrEMBL:Q32ME0"
FT                   /protein_id="EDL34257.1"
FT                   /translation="MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCN
FT                   DGFCELFGYSRVEVMQRPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDAS
FT                   SFRCLVDVVPVKNEDGAVIMFILNFEDLAQLLAKSSSRSLTQRLLSHSFLGSEGSHSRP
FT                   SGQGPGPGRGKYGTVSQIPQFTLSFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEK
FT                   VTQVLSLGADVLPEYKLQAPRIHRGTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFL
FT                   LSDQDDSQRGTCGYTCSPLTVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVH
FT                   YFKGWFLIDMVAAIPFDLLIFRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAA
FT                   VLFLLMCTFALIAHWLACIWYAIGNVERPYLEPKIGWLDSLGAQLGKHYNGSDPASGPS
FT                   VQDKYVTALYFTFSSLTSVGFGNVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQR
FT                   LYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECL
FT                   QADICLHLHRALLQHCPAFRGASKGCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFIS
FT                   RGSIEILRDDVVVAILGKNDIFGEPASLHARPGKSSADVRALTYCDLHKIHRADLLEVL
FT                   DMYPAFADTFWNKLEVTFNLRDADGGLHSTPRQAPGNQDPQGFFLNDSQSGAAPSLSIS
FT                   DTSGLWPELLQQMPPSPPNPREKLDCWPRELGFKLEQLQAQMNRLESRVSSDLSRILQL
FT                   LQHPQGHPGYILGAPASSDLALFPETSVTQSSESMLLVGHLPSAQTLSYGDLDKHIRMP
FT                   RNFSPRIPHVAAAMDKSLVPSSEQEQPKGLLSPLASPLCPLEVQGLGGPHFSSLPEHLS
FT                   SVPKQLEFQRHGSDPGFTRS"
FT   gene            4672947..4699690
FT                   /gene="Wdr68"
FT                   /locus_tag="mCG_4810"
FT                   /note="gene_id=mCG4810.1"
FT   mRNA            join(4672947..4673331,4687059..4687217,4688005..4688116,
FT                   4688511..4688629,4692127..4692336,4694101..4694218,
FT                   4695053..4699690)
FT                   /gene="Wdr68"
FT                   /locus_tag="mCG_4810"
FT                   /product="WD repeat domain 68"
FT                   /note="gene_id=mCG4810.1 transcript_id=mCT3805.1 created on
FT                   13-SEP-2002"
FT   CDS             join(4673194..4673331,4687059..4687217,4688005..4688116,
FT                   4688511..4688629,4692127..4692336,4694101..4694218,
FT                   4695053..4695225)
FT                   /codon_start=1
FT                   /gene="Wdr68"
FT                   /locus_tag="mCG_4810"
FT                   /product="WD repeat domain 68"
FT                   /note="gene_id=mCG4810.1 transcript_id=mCT3805.1
FT                   protein_id=mCP14671.1"
FT                   /protein_id="EDL34258.1"
FT                   /translation="MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNN
FT                   KVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETE
FT                   TRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVS
FT                   GHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHH
FT                   PLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCH
FT                   ICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEIL
FT                   RV"
FT   assembly_gap    4675287..4678663
FT                   /estimated_length=3377
FT                   /gap_type="unknown"
FT   assembly_gap    4703302..4703428
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   gene            complement(4705358..4707162)
FT                   /locus_tag="mCG_1042092"
FT                   /note="gene_id=mCG1042092.1"
FT   mRNA            complement(join(4705358..4705615,4706200..4707162))
FT                   /locus_tag="mCG_1042092"
FT                   /product="mCG1042092, transcript variant mCT159796"
FT                   /note="gene_id=mCG1042092.1 transcript_id=mCT159796.1
FT                   created on 13-SEP-2002"
FT   mRNA            complement(4705422..4707162)
FT                   /locus_tag="mCG_1042092"
FT                   /product="mCG1042092, transcript variant mCT173093"
FT                   /note="gene_id=mCG1042092.1 transcript_id=mCT173093.0
FT                   created on 13-SEP-2002"
FT   gene            4706344..4713914
FT                   /gene="Ccdc44"
FT                   /locus_tag="mCG_2890"
FT                   /note="gene_id=mCG2890.2"
FT   mRNA            join(4706344..4706836,4709824..4709930,4712185..4712312,
FT                   4712849..4713026,4713419..4713914)
FT                   /gene="Ccdc44"
FT                   /locus_tag="mCG_2890"
FT                   /product="coiled-coil domain containing 44"
FT                   /note="gene_id=mCG2890.2 transcript_id=mCT1276.2 created on
FT                   13-SEP-2002"
FT   CDS             complement(4706407..4706709)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042092"
FT                   /product="mCG1042092, isoform CRA_a"
FT                   /note="gene_id=mCG1042092.1 transcript_id=mCT173093.0
FT                   protein_id=mCP96012.0 isoform=CRA_a"
FT                   /protein_id="EDL34259.1"
FT                   /translation="MQRPVWRCTTAGVCMLGGAPRTHAEPEASHTKARDSGHSQAGGSP
FT                   RHHLLRQGAARCKDEQLKSARLVRPRNNPVWTFRPLLQLSRNSEVRLFLTLHCLE"
FT   CDS             complement(4706407..4706709)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042092"
FT                   /product="mCG1042092, isoform CRA_a"
FT                   /note="gene_id=mCG1042092.1 transcript_id=mCT159796.1
FT                   protein_id=mCP75214.1 isoform=CRA_a"
FT                   /protein_id="EDL34260.1"
FT                   /translation="MQRPVWRCTTAGVCMLGGAPRTHAEPEASHTKARDSGHSQAGGSP
FT                   RHHLLRQGAARCKDEQLKSARLVRPRNNPVWTFRPLLQLSRNSEVRLFLTLHCLE"
FT   CDS             join(4706569..4706836,4709824..4709930,4712185..4712312,
FT                   4712849..4713026,4713419..4713619)
FT                   /codon_start=1
FT                   /gene="Ccdc44"
FT                   /locus_tag="mCG_2890"
FT                   /product="coiled-coil domain containing 44"
FT                   /note="gene_id=mCG2890.2 transcript_id=mCT1276.2
FT                   protein_id=mCP14663.2"
FT                   /protein_id="EDL34261.1"
FT                   /translation="MSWAAASLRMTAVPCFRVRCLGFRVGPWGASQHANPGCGAAPHRT
FT                   LHVSATASAGHNKWSKVRHIKGPKDMERSRIFSKLTLSIRLAVKEGGPNPENNSSLANI
FT                   LELCRSKNMPKSTIESALKTEKNKGIYLLYEGRGPGGSSLLIEALSNSGPKCHLDIKYI
FT                   LNKNGGMMAEGARHFFDKKGVVVVGVEDREKKAVNLERALELAIEAGAEDVKEAEDEEE
FT                   KNLFKFICDASSLHQVRKKLDSLGLCPVSCSMEFIPHSKVQLAEPELEQAAHLIQALNN
FT                   YEDVIHVYDNIE"
FT   gene            4724914..4796699
FT                   /gene="Map3k3"
FT                   /locus_tag="mCG_141097"
FT                   /note="gene_id=mCG141097.0"
FT   mRNA            join(4724914..4725254,4737316..4737437,4750826..4750866,
FT                   4754266..4754365,4757565..4757678,4763867..4763987,
FT                   4782484..4782617,4785745..4785818,4788624..4788691,
FT                   4788873..4788965,4789541..4789732,4790329..4790477,
FT                   4791068..4791199,4791677..4791806,4792276..4792453,
FT                   4794025..4796699)
FT                   /gene="Map3k3"
FT                   /locus_tag="mCG_141097"
FT                   /product="mitogen activated protein kinase kinase kinase 3,
FT                   transcript variant mCT173096"
FT                   /note="gene_id=mCG141097.0 transcript_id=mCT173096.0
FT                   created on 13-SEP-2002"
FT   mRNA            join(<4724928..4725254,4737316..4737437,4750826..4750866,
FT                   4754266..4754365,4757565..4757678,4763867..4763987,
FT                   4782484..4782617,4785745..4785818,4788624..4788691,
FT                   4788873..4788965,4789541..4789732,4790329..4790477,
FT                   4791068..4791199,4791677..4791806,4792276..4792453,
FT                   4794025..4795338,4795474..4795491)
FT                   /gene="Map3k3"
FT                   /locus_tag="mCG_141097"
FT                   /product="mitogen activated protein kinase kinase kinase 3,
FT                   transcript variant mCT193222"
FT                   /note="gene_id=mCG141097.0 transcript_id=mCT193222.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<4725206..4725254,4737316..4737437,4750826..4750866,
FT                   4754266..4754365,4757565..4757678,4763867..4763987,
FT                   4782484..4782617,4785745..4785818,4788624..4788691,
FT                   4788873..4788965,4789541..4789732,4790329..4790477,
FT                   4791068..4791199,4791677..4791806,4792276..4792453,
FT                   4794025..4794253)
FT                   /codon_start=1
FT                   /gene="Map3k3"
FT                   /locus_tag="mCG_141097"
FT                   /product="mitogen activated protein kinase kinase kinase 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG141097.0 transcript_id=mCT193222.0
FT                   protein_id=mCP114212.0 isoform=CRA_b"
FT                   /protein_id="EDL34263.1"
FT                   /translation="HFWAVVATAASAIATMDEQEALDSIMKDLVALQMSRRTRLSGYET
FT                   MKNKDTGHPNRQSDVRIKFEHNGERRIIAFSRPVRYEDVEHKVTTVFGQPLDLHYMNNE
FT                   LSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHTSSSPHSGVSRQVRIKPSQSA
FT                   GDINTIYQAPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPE
FT                   TSEQCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSQMSRARSFPDNRKECSDRETQLY
FT                   DKGVKGGTYPRRYHVSVHHKDYNDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGVA
FT                   VQYLDPRGRLRSADSENALTVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDT
FT                   GRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKILTIFM
FT                   EYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGN
FT                   VKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEML
FT                   TEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHH
FT                   FAQLVY"
FT   CDS             join(4725251..4725254,4737316..4737437,4750826..4750866,
FT                   4754266..4754365,4757565..4757678,4763867..4763987,
FT                   4782484..4782617,4785745..4785818,4788624..4788691,
FT                   4788873..4788965,4789541..4789732,4790329..4790477,
FT                   4791068..4791199,4791677..4791806,4792276..4792453,
FT                   4794025..4794253)
FT                   /codon_start=1
FT                   /gene="Map3k3"
FT                   /locus_tag="mCG_141097"
FT                   /product="mitogen activated protein kinase kinase kinase 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG141097.0 transcript_id=mCT173096.0
FT                   protein_id=mCP96015.0 isoform=CRA_a"
FT                   /protein_id="EDL34262.1"
FT                   /translation="MDEQEALDSIMKDLVALQMSRRTRLSGYETMKNKDTGHPNRQSDV
FT                   RIKFEHNGERRIIAFSRPVRYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAI
FT                   DILDRSSSMKSLRILLLSQDRNHTSSSPHSGVSRQVRIKPSQSAGDINTIYQAPEPRSR
FT                   HLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAEN
FT                   SLSGSCQSLDRSADSPSFRKSQMSRARSFPDNRKECSDRETQLYDKGVKGGTYPRRYHV
FT                   SVHHKDYNDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGVAVQYLDPRGRLRSADS
FT                   ENALTVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDS
FT                   PETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAY
FT                   GALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTI
FT                   CMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAI
FT                   FKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHFAQLVY"
FT   assembly_gap    4742380..4745290
FT                   /estimated_length=2911
FT                   /gap_type="unknown"
FT   gene            complement(4766492..>4767722)
FT                   /locus_tag="mCG_1042093"
FT                   /note="gene_id=mCG1042093.0"
FT   mRNA            complement(join(4766492..4766850,4767202..>4767722))
FT                   /locus_tag="mCG_1042093"
FT                   /product="mCG1042093"
FT                   /note="gene_id=mCG1042093.0 transcript_id=mCT159797.0
FT                   created on 13-SEP-2002"
FT   assembly_gap    4767053..4767201
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   CDS             complement(4767492..4767722)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042093"
FT                   /product="mCG1042093"
FT                   /note="gene_id=mCG1042093.0 transcript_id=mCT159797.0
FT                   protein_id=mCP75218.0"
FT                   /protein_id="EDL34264.1"
FT                   /translation="MSACLFTFSSIVLWFVFFFFFLPSFLPSFLPSFLPFLGESLFFFN
FT                   SLRFIYFMYVSTLALSSDTPEEGIRSQYTQL"
FT   gene            complement(4796315..4800919)
FT                   /gene="Limd2"
FT                   /locus_tag="mCG_3213"
FT                   /note="gene_id=mCG3213.3"
FT   mRNA            complement(join(4796315..4798892,4798994..4799133,
FT                   4799221..4799265,4799407..4799501,4800110..4800212))
FT                   /gene="Limd2"
FT                   /locus_tag="mCG_3213"
FT                   /product="LIM domain containing 2, transcript variant
FT                   mCT1305"
FT                   /note="gene_id=mCG3213.3 transcript_id=mCT1305.3 created on
FT                   17-APR-2003"
FT   mRNA            complement(join(4797147..4798892,4798994..4799133,
FT                   4799221..4799265,4799407..4799473,4800419..4800919))
FT                   /gene="Limd2"
FT                   /locus_tag="mCG_3213"
FT                   /product="LIM domain containing 2, transcript variant
FT                   mCT173103"
FT                   /note="gene_id=mCG3213.3 transcript_id=mCT173103.1 created
FT                   on 17-APR-2003"
FT   mRNA            complement(join(4797147..4798892,4798994..4799133,
FT                   4799221..4799265,4799407..4799501,4800419..4800919))
FT                   /gene="Limd2"
FT                   /locus_tag="mCG_3213"
FT                   /product="LIM domain containing 2, transcript variant
FT                   mCT173102"
FT                   /note="gene_id=mCG3213.3 transcript_id=mCT173102.1 created
FT                   on 17-APR-2003"
FT   mRNA            complement(join(4797147..4798892,4798994..4799133,
FT                   4799221..4799265,4799407..4799473,4800110..4800177))
FT                   /gene="Limd2"
FT                   /locus_tag="mCG_3213"
FT                   /product="LIM domain containing 2, transcript variant
FT                   mCT173101"
FT                   /note="gene_id=mCG3213.3 transcript_id=mCT173101.1 created
FT                   on 17-APR-2003"
FT   mRNA            complement(join(4797147..4798892,4798994..4799133,
FT                   4799221..4799265,4799407..4799501,4799872..4799962))
FT                   /gene="Limd2"
FT                   /locus_tag="mCG_3213"
FT                   /product="LIM domain containing 2, transcript variant
FT                   mCT173099"
FT                   /note="gene_id=mCG3213.3 transcript_id=mCT173099.1 created
FT                   on 17-APR-2003"
FT   mRNA            complement(join(4797147..4798892,4798994..4799133,
FT                   4799221..4799472))
FT                   /gene="Limd2"
FT                   /locus_tag="mCG_3213"
FT                   /product="LIM domain containing 2, transcript variant
FT                   mCT173100"
FT                   /note="gene_id=mCG3213.3 transcript_id=mCT173100.1 created
FT                   on 17-APR-2003"
FT   CDS             complement(join(4798733..4798892,4798994..4799133,
FT                   4799221..4799265,4799407..4799448))
FT                   /codon_start=1
FT                   /gene="Limd2"
FT                   /locus_tag="mCG_3213"
FT                   /product="LIM domain containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG3213.3 transcript_id=mCT1305.3
FT                   protein_id=mCP14685.1 isoform=CRA_a"
FT                   /protein_id="EDL34265.1"
FT                   /translation="MFQAAGAAQATPSHEAKGSSGSSTVQRSKSFSLRAQVKETCAACQ
FT                   KTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQLFKSKGNYD
FT                   EGFGRKQHKELWAHKEVDSGTKTA"
FT   CDS             complement(join(4798733..4798892,4798994..4799133,
FT                   4799221..4799265,4799407..4799448))
FT                   /codon_start=1
FT                   /gene="Limd2"
FT                   /locus_tag="mCG_3213"
FT                   /product="LIM domain containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG3213.3 transcript_id=mCT173101.1
FT                   protein_id=mCP96020.0 isoform=CRA_a"
FT                   /protein_id="EDL34266.1"
FT                   /translation="MFQAAGAAQATPSHEAKGSSGSSTVQRSKSFSLRAQVKETCAACQ
FT                   KTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQLFKSKGNYD
FT                   EGFGRKQHKELWAHKEVDSGTKTA"
FT   CDS             complement(join(4798733..4798892,4798994..4799133,
FT                   4799221..4799265,4799407..4799448))
FT                   /codon_start=1
FT                   /gene="Limd2"
FT                   /locus_tag="mCG_3213"
FT                   /product="LIM domain containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG3213.3 transcript_id=mCT173102.1
FT                   protein_id=mCP96021.0 isoform=CRA_a"
FT                   /protein_id="EDL34267.1"
FT                   /translation="MFQAAGAAQATPSHEAKGSSGSSTVQRSKSFSLRAQVKETCAACQ
FT                   KTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQLFKSKGNYD
FT                   EGFGRKQHKELWAHKEVDSGTKTA"
FT   CDS             complement(join(4798733..4798892,4798994..4799133,
FT                   4799221..4799265,4799407..4799448))
FT                   /codon_start=1
FT                   /gene="Limd2"
FT                   /locus_tag="mCG_3213"
FT                   /product="LIM domain containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG3213.3 transcript_id=mCT173103.1
FT                   protein_id=mCP96022.0 isoform=CRA_a"
FT                   /protein_id="EDL34268.1"
FT                   /translation="MFQAAGAAQATPSHEAKGSSGSSTVQRSKSFSLRAQVKETCAACQ
FT                   KTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQLFKSKGNYD
FT                   EGFGRKQHKELWAHKEVDSGTKTA"
FT   CDS             complement(join(4798733..4798892,4798994..4799133,
FT                   4799221..4799265,4799407..4799448))
FT                   /codon_start=1
FT                   /gene="Limd2"
FT                   /locus_tag="mCG_3213"
FT                   /product="LIM domain containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG3213.3 transcript_id=mCT173099.1
FT                   protein_id=mCP96018.0 isoform=CRA_a"
FT                   /protein_id="EDL34269.1"
FT                   /translation="MFQAAGAAQATPSHEAKGSSGSSTVQRSKSFSLRAQVKETCAACQ
FT                   KTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQLFKSKGNYD
FT                   EGFGRKQHKELWAHKEVDSGTKTA"
FT   CDS             complement(4799293..4799448)
FT                   /codon_start=1
FT                   /gene="Limd2"
FT                   /locus_tag="mCG_3213"
FT                   /product="LIM domain containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG3213.3 transcript_id=mCT173100.1
FT                   protein_id=mCP96019.0 isoform=CRA_b"
FT                   /protein_id="EDL34270.1"
FT                   /translation="MFQAAGAAQATPSHVGVQPGGEESRGQEQLVCLAPCATSSAPGMW
FT                   AGPPES"
FT   gene            complement(4802977..4833854)
FT                   /gene="2610019A05Rik"
FT                   /locus_tag="mCG_2874"
FT                   /note="gene_id=mCG2874.2"
FT   mRNA            complement(join(4802977..4804250,4804490..4804532,
FT                   4804779..4805020,4807871..4807975,4808368..4808539,
FT                   4811013..4811136,4811215..4811323,4813529..4813650,
FT                   4813955..4814057,4821232..4821260,4824837..4824894,
FT                   4827376..4827455,4833741..4833854))
FT                   /gene="2610019A05Rik"
FT                   /locus_tag="mCG_2874"
FT                   /product="RIKEN cDNA 2610019A05, transcript variant
FT                   mCT1293"
FT                   /note="gene_id=mCG2874.2 transcript_id=mCT1293.2 created on
FT                   02-APR-2003"
FT   mRNA            complement(join(4802978..4804250,4804490..4804532,
FT                   4804779..4805020,4807871..4807975,4808368..4808539,
FT                   4811013..4811136,4811215..4811323,4813529..4813650,
FT                   4813955..4814057,4824837..4824894,4827376..4827455,
FT                   4833741..4833854))
FT                   /gene="2610019A05Rik"
FT                   /locus_tag="mCG_2874"
FT                   /product="RIKEN cDNA 2610019A05, transcript variant
FT                   mCT173449"
FT                   /note="gene_id=mCG2874.2 transcript_id=mCT173449.0 created
FT                   on 02-APR-2003"
FT   mRNA            complement(join(4802978..4804250,4804490..4804532,
FT                   4804779..4805020,4807871..4807975,4808368..4808539,
FT                   4811013..4811136,4811215..4811323,4813529..4813650,
FT                   4813955..4814057,4827400..4827455,4833741..4833824))
FT                   /gene="2610019A05Rik"
FT                   /locus_tag="mCG_2874"
FT                   /product="RIKEN cDNA 2610019A05, transcript variant
FT                   mCT173447"
FT                   /note="gene_id=mCG2874.2 transcript_id=mCT173447.0 created
FT                   on 02-APR-2003"
FT   mRNA            complement(join(4802978..4804250,4804490..4804532,
FT                   4804779..4805020,4807871..4807975,4808368..4808539,
FT                   4811013..4811136,4811215..4811323,4813529..4813650,
FT                   4813955..4814057,4827400..4827455,4828083..4828196))
FT                   /gene="2610019A05Rik"
FT                   /locus_tag="mCG_2874"
FT                   /product="RIKEN cDNA 2610019A05, transcript variant
FT                   mCT173448"
FT                   /note="gene_id=mCG2874.2 transcript_id=mCT173448.0 created
FT                   on 02-APR-2003"
FT   mRNA            complement(join(4802978..4804250,4804490..4804532,
FT                   4804779..4805020,4807871..4807975,4808368..4808539,
FT                   4811215..4811323,4813529..4813650,4813955..4814057,
FT                   4821232..4821260,4824837..4824894,4827376..4827455))
FT                   /gene="2610019A05Rik"
FT                   /locus_tag="mCG_2874"
FT                   /product="RIKEN cDNA 2610019A05, transcript variant
FT                   mCT173450"
FT                   /note="gene_id=mCG2874.2 transcript_id=mCT173450.0 created
FT                   on 02-APR-2003"
FT   mRNA            complement(join(4803907..4804250,4804772..4805020,
FT                   4807871..4807975,4808368..4808539,4811013..4811136,
FT                   4811215..4811323,4813529..4813650,4813955..4814057,
FT                   4827400..4827455,4833741..>4833837))
FT                   /gene="2610019A05Rik"
FT                   /locus_tag="mCG_2874"
FT                   /product="RIKEN cDNA 2610019A05, transcript variant
FT                   mCT193272"
FT                   /note="gene_id=mCG2874.2 transcript_id=mCT193272.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4804098..4804250,4804772..4805020,
FT                   4807871..4807975,4808368..4808539,4811013..4811136,
FT                   4811215..4811323,4813529..4813650,4813955..4814057,
FT                   4827400..>4827417))
FT                   /codon_start=1
FT                   /gene="2610019A05Rik"
FT                   /locus_tag="mCG_2874"
FT                   /product="RIKEN cDNA 2610019A05, isoform CRA_e"
FT                   /note="gene_id=mCG2874.2 transcript_id=mCT193272.0
FT                   protein_id=mCP114234.0 isoform=CRA_e"
FT                   /protein_id="EDL34276.1"
FT                   /translation="EPMSFLANEASSESIASFSKPEMMSSFLPEGGCYELLTIIGKGFE
FT                   DLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFSHPNIVPYRATFIA
FT                   DNELWVVTSFMAYGSAKDLIGTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKA
FT                   SHILISTDGKVYLSGLRSNLSMISHGQRQRAVHDFPKYSIKVLPWLSPEVLQQNLQGYD
FT                   AKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSR
FT                   SIANPGLNDSLAAGSLRPSNGDSPSHPYHRTFSPHFHNFVEQCLQRNPDARYSIKRRAS
FT                   EALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEDLEVDDWEF"
FT   CDS             complement(join(4804098..4804250,4804490..4804532,
FT                   4804779..4805020,4807871..4807975,4808368..4808539,
FT                   4811013..4811136,4811215..4811323,4813529..4813650,
FT                   4813955..4814057,4827400..4827411))
FT                   /codon_start=1
FT                   /gene="2610019A05Rik"
FT                   /locus_tag="mCG_2874"
FT                   /product="RIKEN cDNA 2610019A05, isoform CRA_b"
FT                   /note="gene_id=mCG2874.2 transcript_id=mCT173447.0
FT                   protein_id=mCP96366.0 isoform=CRA_b"
FT                   /protein_id="EDL34272.1"
FT                   /translation="MSFLANEASSESIASFSKPEMMSSFLPEGGCYELLTIIGKGFEDL
FT                   MTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFSHPNIVPYRATFIADN
FT                   ELWVVTSFMAYGSAKDLIGTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASH
FT                   ILISTDGKVYLSGLRSNLSMISHGQRQRAVHDFPKYSIKVLPWLSPEVLQQNLQGYDAK
FT                   SDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSI
FT                   ANPGLNDSLAAGSLRPSNGDSPSHPYHRTFSPHFHNFVEQCLQRNPDARPNASTLLNHS
FT                   FFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEDLEVDDWEF"
FT   CDS             complement(join(4804098..4804250,4804490..4804532,
FT                   4804779..4805020,4807871..4807975,4808368..4808539,
FT                   4811013..4811136,4811215..4811323,4813529..4813650,
FT                   4813955..4814057,4827400..4827411))
FT                   /codon_start=1
FT                   /gene="2610019A05Rik"
FT                   /locus_tag="mCG_2874"
FT                   /product="RIKEN cDNA 2610019A05, isoform CRA_b"
FT                   /note="gene_id=mCG2874.2 transcript_id=mCT173448.0
FT                   protein_id=mCP96369.0 isoform=CRA_b"
FT                   /protein_id="EDL34273.1"
FT                   /translation="MSFLANEASSESIASFSKPEMMSSFLPEGGCYELLTIIGKGFEDL
FT                   MTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFSHPNIVPYRATFIADN
FT                   ELWVVTSFMAYGSAKDLIGTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASH
FT                   ILISTDGKVYLSGLRSNLSMISHGQRQRAVHDFPKYSIKVLPWLSPEVLQQNLQGYDAK
FT                   SDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSI
FT                   ANPGLNDSLAAGSLRPSNGDSPSHPYHRTFSPHFHNFVEQCLQRNPDARPNASTLLNHS
FT                   FFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEDLEVDDWEF"
FT   CDS             complement(join(4804098..4804250,4804490..4804532,
FT                   4804779..4805020,4807871..4807975,4808368..4808539,
FT                   4811013..4811136,4811215..4811323,4813529..4813650,
FT                   4813955..4814057,4821232..4821260,4824837..4824894,
FT                   4827376..4827411))
FT                   /codon_start=1
FT                   /gene="2610019A05Rik"
FT                   /locus_tag="mCG_2874"
FT                   /product="RIKEN cDNA 2610019A05, isoform CRA_a"
FT                   /note="gene_id=mCG2874.2 transcript_id=mCT1293.2
FT                   protein_id=mCP14679.2 isoform=CRA_a"
FT                   /protein_id="EDL34271.1"
FT                   /translation="MSFLVSKPERIRRWVSEKFIVEGLRDLELFGEQPPGDTRRKANEA
FT                   SSESIASFSKPEMMSSFLPEGGCYELLTIIGKGFEDLMTVNLARYKPTGEYVTVRRINL
FT                   EACSNEMVTFLQGELHVSKLFSHPNIVPYRATFIADNELWVVTSFMAYGSAKDLIGTHF
FT                   MDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISTDGKVYLSGLRSNLSMIS
FT                   HGQRQRAVHDFPKYSIKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKD
FT                   MPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSIANPGLNDSLAAGSLRPSNGDSP
FT                   SHPYHRTFSPHFHNFVEQCLQRNPDARPNASTLLNHSFFKQIKRRASEALPELLRPVTP
FT                   ITNFEGSQSQDHSGIFGLVTNLEDLEVDDWEF"
FT   CDS             complement(join(4804098..4804250,4804490..4804532,
FT                   4804779..4805020,4807871..4807975,4808368..4808539,
FT                   4811013..4811136,4811215..4811323,4813529..4813650,
FT                   4813955..4814009))
FT                   /codon_start=1
FT                   /gene="2610019A05Rik"
FT                   /locus_tag="mCG_2874"
FT                   /product="RIKEN cDNA 2610019A05, isoform CRA_c"
FT                   /note="gene_id=mCG2874.2 transcript_id=mCT173449.0
FT                   protein_id=mCP96368.0 isoform=CRA_c"
FT                   /protein_id="EDL34274.1"
FT                   /translation="MMSSFLPEGGCYELLTIIGKGFEDLMTVNLARYKPTGEYVTVRRI
FT                   NLEACSNEMVTFLQGELHVSKLFSHPNIVPYRATFIADNELWVVTSFMAYGSAKDLIGT
FT                   HFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISTDGKVYLSGLRSNLSM
FT                   ISHGQRQRAVHDFPKYSIKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPF
FT                   KDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSIANPGLNDSLAAGSLRPSNGD
FT                   SPSHPYHRTFSPHFHNFVEQCLQRNPDARPNASTLLNHSFFKQIKRRASEALPELLRPV
FT                   TPITNFEGSQSQDHSGIFGLVTNLEDLEVDDWEF"
FT   CDS             complement(join(4808514..4808539,4811215..4811323,
FT                   4813529..4813650,4813955..4814057,4821232..4821260,
FT                   4824837..4824894,4827376..4827411))
FT                   /codon_start=1
FT                   /gene="2610019A05Rik"
FT                   /locus_tag="mCG_2874"
FT                   /product="RIKEN cDNA 2610019A05, isoform CRA_d"
FT                   /note="gene_id=mCG2874.2 transcript_id=mCT173450.0
FT                   protein_id=mCP96367.0 isoform=CRA_d"
FT                   /protein_id="EDL34275.1"
FT                   /translation="MSFLVSKPERIRRWVSEKFIVEGLRDLELFGEQPPGDTRRKANEA
FT                   SSESIASFSKPEMMSSFLPEGGCYELLTIIGKGFEDLMTVNLARYKPTGEYVTVRRINL
FT                   EACSNEMVTFLQGELHVSKLFSHPNIVPYRATFIADNELWVVTSFMAYGVSRPATF"
FT   assembly_gap    4812251..4812643
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   gene            complement(4839285..>4856619)
FT                   /locus_tag="mCG_3218"
FT                   /note="gene_id=mCG3218.1"
FT   mRNA            complement(join(4839285..4841291,4842286..4842453,
FT                   4842659..4842768,4843003..4843061,4843813..4843898,
FT                   4845196..4845306,4845635..4845736,4848281..4848346,
FT                   4848470..4848591,4850563..4850737,4851948..4852055,
FT                   4853356..4853624,4856424..4856619))
FT                   /locus_tag="mCG_3218"
FT                   /product="mCG3218, transcript variant mCT1300"
FT                   /note="gene_id=mCG3218.1 transcript_id=mCT1300.2 created on
FT                   16-SEP-2002"
FT   mRNA            complement(join(4840760..4841291,4842286..4842453,
FT                   4842659..4842768,4843003..4843061,4843813..4843898,
FT                   4845196..4845306,4845635..4845736,4848281..4848346,
FT                   4848470..4848591,4850563..4850737,4851948..4852055,
FT                   4853356..4853636,4856424..>4856619))
FT                   /locus_tag="mCG_3218"
FT                   /product="mCG3218, transcript variant mCT193185"
FT                   /note="gene_id=mCG3218.1 transcript_id=mCT193185.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4841211..4841291,4842286..4842453,
FT                   4842659..4842768,4843003..4843061,4843813..4843898,
FT                   4845196..4845306,4845635..4845736,4848281..4848346,
FT                   4848470..4848591,4850563..4850737,4851948..4852055,
FT                   4853356..>4853625))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3218"
FT                   /product="mCG3218, isoform CRA_b"
FT                   /note="gene_id=mCG3218.1 transcript_id=mCT193185.0
FT                   protein_id=mCP114171.0 isoform=CRA_b"
FT                   /protein_id="EDL34278.1"
FT                   /translation="GAMKAFYAFCVVLLVFGSVSEAKFDDFEDEEDIVEYDDNDFAEFE
FT                   DVMEDSVTESPQRVISTEDDEDEATVELEGQDESQEGDFEDADTQEGDTESEPYDDEEF
FT                   EGYEDKPDTSSNKNKDPITIVDVPAHLQNSWESYYLEILMVTGLLAYIMNYIIGKNKNS
FT                   RLAQAWFNSHRELLESNFTLVGDDGTNKEATSTGKLNQENEHIYNLWCSGRVCCEGMLI
FT                   QLRFLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYVFAVGTRKALLRLQKEMQDL
FT                   SEFCSDKPKSGAKYGLPDSLAILSEMGEVTEGMMDTKMVHFLTHYADKIESVHFSDQFS
FT                   GPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMESLLPLMNMVIYSIDKAKKFR
FT                   LNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRL
FT                   EEAALRREQKKLEKKQMKMKQIKVKAM"
FT   CDS             complement(join(4841211..4841291,4842286..4842453,
FT                   4842659..4842768,4843003..4843061,4843813..4843898,
FT                   4845196..4845306,4845635..4845736,4848281..4848346,
FT                   4848470..4848591,4850563..4850737,4851948..4852055,
FT                   4853356..4853619))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3218"
FT                   /product="mCG3218, isoform CRA_a"
FT                   /note="gene_id=mCG3218.1 transcript_id=mCT1300.2
FT                   protein_id=mCP14632.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q0VBU4"
FT                   /db_xref="InterPro:IPR012879"
FT                   /db_xref="MGI:MGI:1914413"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VBU4"
FT                   /protein_id="EDL34277.1"
FT                   /translation="MKAFYAFCVVLLVFGSVSEAKFDDFEDEEDIVEYDDNDFAEFEDV
FT                   MEDSVTESPQRVISTEDDEDEATVELEGQDESQEGDFEDADTQEGDTESEPYDDEEFEG
FT                   YEDKPDTSSNKNKDPITIVDVPAHLQNSWESYYLEILMVTGLLAYIMNYIIGKNKNSRL
FT                   AQAWFNSHRELLESNFTLVGDDGTNKEATSTGKLNQENEHIYNLWCSGRVCCEGMLIQL
FT                   RFLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYVFAVGTRKALLRLQKEMQDLSE
FT                   FCSDKPKSGAKYGLPDSLAILSEMGEVTEGMMDTKMVHFLTHYADKIESVHFSDQFSGP
FT                   KIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMESLLPLMNMVIYSIDKAKKFRLN
FT                   REGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEE
FT                   AALRREQKKLEKKQMKMKQIKVKAM"
FT   gene            4857196..4889412
FT                   /gene="Ddx42"
FT                   /locus_tag="mCG_120702"
FT                   /note="gene_id=mCG120702.1"
FT   mRNA            join(4857196..4857431,4864356..4864593,4865059..4865203,
FT                   4869037..4869098,4870604..4870640,4871406..4871555,
FT                   4873080..4873184,4875126..4875245,4875881..4876057,
FT                   4877269..4877397,4878782..4878881,4879410..4879457,
FT                   4880276..4880373,4881825..4882101,4883149..4883375,
FT                   4885601..4885711,4887050..4887151,4887765..4889411)
FT                   /gene="Ddx42"
FT                   /locus_tag="mCG_120702"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 42,
FT                   transcript variant mCT121894"
FT                   /note="gene_id=mCG120702.1 transcript_id=mCT121894.1
FT                   created on 16-SEP-2002"
FT   mRNA            join(<4857197..4857431,4864356..4864593,4865059..4865215,
FT                   4869043..4869098,4870604..4870640,4871406..4871555,
FT                   4873080..4873184,4875126..4875245,4875881..4876057,
FT                   4877269..4877397,4878782..4878881,4879410..4879457,
FT                   4880276..4880373,4881825..4882101,4883149..4883375,
FT                   4885601..4885711,4887050..4887151,4887765..4889412)
FT                   /gene="Ddx42"
FT                   /locus_tag="mCG_120702"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 42,
FT                   transcript variant mCT193261"
FT                   /note="gene_id=mCG120702.1 transcript_id=mCT193261.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<4857200..4857431,4864356..4864593,4865059..4865215,
FT                   4869043..4869098,4870604..4870640,4871406..4871555,
FT                   4873080..4873184,4875126..4875245,4875881..4876057,
FT                   4877269..4877397,4878782..4878881,4879410..4879457,
FT                   4880276..4880373,4881825..4882101,4883149..4883375,
FT                   4885601..4885711,4887050..4887151,4887765..4888439)
FT                   /codon_start=1
FT                   /gene="Ddx42"
FT                   /locus_tag="mCG_120702"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 42,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG120702.1 transcript_id=mCT193261.0
FT                   protein_id=mCP114197.0 isoform=CRA_b"
FT                   /protein_id="EDL34280.1"
FT                   /translation="RACQTLPPPYPQSATGREAAAKGAEEERGWTRSRTARTQGRGGSF
FT                   APTGVATASAAAAAGLGEGLARRSAASPGDTRAPVIGIMNWNKGGPGTKRGFGFGGFAI
FT                   SAGKKEEAKLPQQSHSAFGAASSSSGFGKSAPPQLPSFYKIGSKRANFDEENAYFEDEE
FT                   EDSSNVDLPYIPAENSPTRQQFHSKPADSDSDDDPLEAFMAEVEASAARDMKRLEEKDK
FT                   ERKNVKGIRDDIEEEDDQEAYFRYMAENPTAGVVQEEEEDNLEYDSDGNPIAPSKKIID
FT                   PLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLNLRVSGAAPPRPGSSFAH
FT                   FGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGKTAAFIWPMLIHIM
FT                   DQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAVYGGGSMWEQAKALQE
FT                   GAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDRQT
FT                   LLFSATFRKKIEKLARDILIDPIRVVQGDIGEANEDVTQIVEILHSGPSKWNWLTRRLV
FT                   EFTSSGSVLLFVTKKANAEELASNLKQEGHNLGLLHGDMDQSERNKVISDFKKKDIPVL
FT                   VATDVAARGLDIPSIKTVINYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTPKDSNFAG
FT                   DLVRNLEGANQHVSKELLDLAMQNAWFRKSRFKGGKGKKLNIGGGGLGYRERPGLGSEN
FT                   SDRGNNNNVMSNYEAYKPSTGAMGDRLTAMKAAFQSQYKSHFVAASLSNQKAGTSSAGA
FT                   SGWTSAGSLNSVPTNSAQQGHNSPDNPMTSSTKNIPGFNNSGNISSAPVTYPSIGAQGV
FT                   NNTASGNNSREGIGGGNGKRERYTENRGGSRHSHGDGGNRHGDGGRHGDGYRYPESGSR
FT                   HTDGHRHGETRHGGSAGRHGESRGANDGRNGESRKEGFNRENKMDPKVDSSRMDKVDSK
FT                   TDKTPDGFAVPEPPKRKKSRWDS"
FT   CDS             join(4864373..4864593,4865059..4865203,4869037..4869098,
FT                   4870604..4870640,4871406..4871555,4873080..4873184,
FT                   4875126..4875245,4875881..4876057,4877269..4877397,
FT                   4878782..4878881,4879410..4879457,4880276..4880373,
FT                   4881825..4882101,4883149..4883375,4885601..4885711,
FT                   4887050..4887151,4887765..4888439)
FT                   /codon_start=1
FT                   /gene="Ddx42"
FT                   /locus_tag="mCG_120702"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 42,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG120702.1 transcript_id=mCT121894.1
FT                   protein_id=mCP75183.1 isoform=CRA_a"
FT                   /protein_id="EDL34279.1"
FT                   /translation="MNWNKGGPGTKRGFGFGGFAISAGKKEEAKLPQQSHSAFGAASSS
FT                   SGFGKSAPPQLPSFYKIGSKRANFDEENAYFEDEEEDSSNVDLPYIPAENSPTRQQFHS
FT                   KPADSDSDDDPLEAFMAEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYMA
FT                   ENPTAGVVQEEEEDNLEYDSDGNPIAPSKKIIDPLPPIDHSEIDYPPFEKNFYNEHEEI
FT                   TNLTPQQLIDLRHKLNLRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQG
FT                   VPVALSGRDMIGIAKTGSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQI
FT                   HAECKRFGKAYNLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATNLQRV
FT                   SYLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIEKLARDILIDPIRVV
FT                   QGDIGEANEDVTQIVEILHSGPSKWNWLTRRLVEFTSSGSVLLFVTKKANAEELASNLK
FT                   QEGHNLGLLHGDMDQSERNKVISDFKKKDIPVLVATDVAARGLDIPSIKTVINYDVARD
FT                   IDTHTHRIGRTGRAGEKGVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAW
FT                   FRKSRFKGGKGKKLNIGGGGLGYRERPGLGSENSDRGNNNNVMSNYEAYKPSTGAMGDR
FT                   LTAMKAAFQSQYKSHFVAASLSNQKAGTSSAGASGWTSAGSLNSVPTNSAQQGHNSPDN
FT                   PMTSSTKNIPGFNNSGNISSAPVTYPSIGAQGVNNTASGNNSREGIGGGNGKRERYTEN
FT                   RGGSRHSHGDGGNRHGDGGRHGDGYRYPESGSRHTDGHRHGETRHGGSAGRHGESRGAN
FT                   DGRNGESRKEGFNRENKMDPKVDSSRMDKVDSKTDKTPDGFAVPEPPKRKKSRWDS"
FT   gene            complement(4889417..4896108)
FT                   /gene="Ftsj3"
FT                   /locus_tag="mCG_3212"
FT                   /note="gene_id=mCG3212.2"
FT   mRNA            complement(join(4889417..4889889,4889977..4890071,
FT                   4890146..4890329,4890428..4890527,4890621..4890706,
FT                   4890835..4891109,4891179..4891296,4891427..4891608,
FT                   4892476..4892611,4892701..4892850,4892940..4893020,
FT                   4893174..4893274,4893355..4893459,4893563..4893678,
FT                   4893756..4893950,4894036..4894135,4894881..4894960,
FT                   4895060..4895106,4895594..4895699,4895859..4895951,
FT                   4896035..4896108))
FT                   /gene="Ftsj3"
FT                   /locus_tag="mCG_3212"
FT                   /product="FtsJ homolog 3 (E. coli)"
FT                   /note="gene_id=mCG3212.2 transcript_id=mCT1309.2 created on
FT                   25-JUL-2002"
FT   CDS             complement(join(4889697..4889889,4889977..4890071,
FT                   4890146..4890329,4890428..4890527,4890621..4890706,
FT                   4890835..4891109,4891179..4891296,4891427..4891608,
FT                   4892476..4892611,4892701..4892850,4892940..4893020,
FT                   4893174..4893274,4893355..4893459,4893563..4893678,
FT                   4893756..4893950,4894036..4894135,4894881..4894960,
FT                   4895060..4895106,4895594..4895699,4895859..4895925))
FT                   /codon_start=1
FT                   /gene="Ftsj3"
FT                   /locus_tag="mCG_3212"
FT                   /product="FtsJ homolog 3 (E. coli)"
FT                   /note="gene_id=mCG3212.2 transcript_id=mCT1309.2
FT                   protein_id=mCP14634.2"
FT                   /protein_id="EDL34281.1"
FT                   /translation="MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKA
FT                   RALLDLCAAPGGWLQVAAKFMPVSSLIVGVDLVPIKPLPNVVTLQEDITTERCRQALRK
FT                   ELKTWKVDVVLNDGAPNVGASWVHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRD
FT                   YQPLLWIFQQLFHRVQATKPQASRHESAEIFVVCQGFLAPDKVDAKFFDPKFAFKEVEV
FT                   QAKTVTELVTKKKPKAEGYAEGDLTLYHRTSVTDFLRAANPVDFLSKASEISIDDEELA
FT                   QHPATTEDIRVCCQDIKVLGRKELRSLLNWRTKLRRYVAKKLKEQAKALDISLSSEEEE
FT                   EGDEEEAVAETKQAPEEEEEREEEQLNRTLAEMKAQEVAELKRKKKKLLREQRKQRERV
FT                   ELKMDLPGVSIADEGETGMFSLRTIRGQQLLEEVTQGDMNAADTFLSDLPRDDIYVSDA
FT                   EDDDDTSLESDLDPEELAGVRTHSDLKEQKYLRFTQVDDNKEEEGENPLLVPLEEKAVL
FT                   QEEQASLWFSKDGFSGIEDDADEALEISQAQLLYKSRQKEQQPTDPPPPPTNLKTEKKS
FT                   PQGQNEVPKETEAILGTEAVTDPGGEERGNSSDSDSSSSEDEDSWKVSRGVKRGRGSKA
FT                   DEDGFEVVPIQDPVKYRILDPEGLALGAVIASSKKAKRDLIDNSFNRYAFNEEEGELPE
FT                   WFAQEEKQHRIRQLPVDKKEVEHYRKRWREINARPIKKVAEAKARKKRRVLKKLEQTKK
FT                   KAEAVVNTVDISEREKVAQLRSLYKKAGLGKEKRQVTYVVAKKGVGRKVRRPAGVKGHF
FT                   KVVDSRMKKDQRAQQRKEQKKKHKRK"
FT   gene            4896425..4904327
FT                   /gene="Psmc5"
FT                   /locus_tag="mCG_3214"
FT                   /note="gene_id=mCG3214.2"
FT   mRNA            join(4896425..4896488,4897122..4897193,4901148..4901217,
FT                   4901480..4901577,4901718..4902005,4902201..4902327,
FT                   4902413..4902603,4902699..4902797,4902876..4902986,
FT                   4903092..4903178,4903304..4904327)
FT                   /gene="Psmc5"
FT                   /locus_tag="mCG_3214"
FT                   /product="protease (prosome, macropain) 26S subunit, ATPase
FT                   5, transcript variant mCT1301"
FT                   /note="gene_id=mCG3214.2 transcript_id=mCT1301.3 created on
FT                   18-JUN-2003"
FT   mRNA            join(4896426..4896488,4901718..4902005,4902201..4902327,
FT                   4902413..4902603,4902699..4902797,4902876..4902986,
FT                   4903092..4903178,4903304..4904327)
FT                   /gene="Psmc5"
FT                   /locus_tag="mCG_3214"
FT                   /product="protease (prosome, macropain) 26S subunit, ATPase
FT                   5, transcript variant mCT171101"
FT                   /note="gene_id=mCG3214.2 transcript_id=mCT171101.1 created
FT                   on 18-JUN-2003"
FT   mRNA            join(4896439..4896488,4897122..4897193,4901148..4901217,
FT                   4901480..4901577,4901718..4902005,4902201..4902327,
FT                   4902413..4902603,4902699..4902986,4903092..4903178,
FT                   4903304..4904327)
FT                   /gene="Psmc5"
FT                   /locus_tag="mCG_3214"
FT                   /product="protease (prosome, macropain) 26S subunit, ATPase
FT                   5, transcript variant mCT181640"
FT                   /note="gene_id=mCG3214.2 transcript_id=mCT181640.1 created
FT                   on 18-JUN-2003"
FT   CDS             join(4896465..4896488,4897122..4897193,4901148..4901217,
FT                   4901480..4901577,4901718..4902005,4902201..4902327,
FT                   4902413..4902603,4902699..4902797,4902876..4902986,
FT                   4903092..4903178,4903304..4903357)
FT                   /codon_start=1
FT                   /gene="Psmc5"
FT                   /locus_tag="mCG_3214"
FT                   /product="protease (prosome, macropain) 26S subunit, ATPase
FT                   5, isoform CRA_a"
FT                   /note="gene_id=mCG3214.2 transcript_id=mCT1301.3
FT                   protein_id=mCP14674.2 isoform=CRA_a"
FT                   /protein_id="EDL34282.1"
FT                   /translation="MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRL
FT                   QAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNID
FT                   INDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKE
FT                   VIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQK
FT                   FIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLD
FT                   GFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTR
FT                   GINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNM
FT                   SIKKLWK"
FT   CDS             join(4896465..4896488,4901718..4902005,4902201..4902327,
FT                   4902413..4902603,4902699..4902797,4902876..4902986,
FT                   4903092..4903178,4903304..4903357)
FT                   /codon_start=1
FT                   /gene="Psmc5"
FT                   /locus_tag="mCG_3214"
FT                   /product="protease (prosome, macropain) 26S subunit, ATPase
FT                   5, isoform CRA_b"
FT                   /note="gene_id=mCG3214.2 transcript_id=mCT171101.1
FT                   protein_id=mCP94019.0 isoform=CRA_b"
FT                   /protein_id="EDL34283.1"
FT                   /translation="MALDGPEQVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHK
FT                   ILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPK
FT                   GVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAP
FT                   SIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILD
FT                   SALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKG
FT                   VCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK"
FT   CDS             join(4896465..4896488,4897122..4897193,4901148..4901217,
FT                   4901480..4901577,4901718..4902005,4902201..4902327,
FT                   4902413..4902603,4902699..4902875)
FT                   /codon_start=1
FT                   /gene="Psmc5"
FT                   /locus_tag="mCG_3214"
FT                   /product="protease (prosome, macropain) 26S subunit, ATPase
FT                   5, isoform CRA_c"
FT                   /note="gene_id=mCG3214.2 transcript_id=mCT181640.1
FT                   protein_id=mCP104562.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8K1K2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:105047"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K1K2"
FT                   /protein_id="EDL34284.1"
FT                   /translation="MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRL
FT                   QAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNID
FT                   INDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKE
FT                   VIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQK
FT                   FIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLD
FT                   GFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEVCAGGAWRSSGYGDSAG
FT                   LRAFFSYP"
FT   assembly_gap    4901025..4901044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4903468..4912866)
FT                   /gene="Smarcd2"
FT                   /locus_tag="mCG_2869"
FT                   /note="gene_id=mCG2869.2"
FT   mRNA            complement(join(4903468..4904414,4904490..4904591,
FT                   4904728..4904850,4904967..4905102,4905235..4905332,
FT                   4905478..4905639,4905955..4906056,4906183..4906278,
FT                   4906832..4906987,4907186..4907308,4907433..4907475,
FT                   4907629..4907813,4912788..4912866))
FT                   /gene="Smarcd2"
FT                   /locus_tag="mCG_2869"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily d, member 2,
FT                   transcript variant mCT1298"
FT                   /note="gene_id=mCG2869.2 transcript_id=mCT1298.2 created on
FT                   02-APR-2003"
FT   mRNA            complement(join(4903482..4904414,4904490..4904591,
FT                   4904728..4904850,4904967..4905102,4905235..4905332,
FT                   4905478..4905639,4905955..4906056,4906183..4906278,
FT                   4906832..4906987,4907186..4907308,4907433..4907475,
FT                   4907629..4907917))
FT                   /gene="Smarcd2"
FT                   /locus_tag="mCG_2869"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily d, member 2,
FT                   transcript variant mCT171089"
FT                   /note="gene_id=mCG2869.2 transcript_id=mCT171089.0 created
FT                   on 02-APR-2003"
FT   CDS             complement(join(4904361..4904414,4904490..4904591,
FT                   4904728..4904850,4904967..4905102,4905235..4905332,
FT                   4905478..4905639,4905955..4906056,4906183..4906278,
FT                   4906832..4906987,4907186..4907308,4907433..4907475,
FT                   4907629..4907813,4912788..4912853))
FT                   /codon_start=1
FT                   /gene="Smarcd2"
FT                   /locus_tag="mCG_2869"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily d, member 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG2869.2 transcript_id=mCT1298.2
FT                   protein_id=mCP14624.2 isoform=CRA_a"
FT                   /protein_id="EDL34285.1"
FT                   /translation="MGVPGAAAFRPMGPAGPAAQYQRPGMSPGSRMPMAGLQVGPPAGS
FT                   PFGTAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKRRKMADKVLPQRIRELVP
FT                   ESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKADGDNAG
FT                   TAGTPGGTPAADKVASWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKELYGPDNHLV
FT                   EWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAI
FT                   MQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVIN
FT                   HVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQ
FT                   LKTQRDFMLSFSTEPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVG
FT                   RHIFAKVQQRRQELEQVLGIRLT"
FT   CDS             complement(join(4904361..4904414,4904490..4904591,
FT                   4904728..4904850,4904967..4905102,4905235..4905332,
FT                   4905478..4905639,4905955..4906056,4906183..4906278,
FT                   4906832..4906987,4907186..4907308,4907433..4907475,
FT                   4907629..4907879))
FT                   /codon_start=1
FT                   /gene="Smarcd2"
FT                   /locus_tag="mCG_2869"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily d, member 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG2869.2 transcript_id=mCT171089.0
FT                   protein_id=mCP94007.0 isoform=CRA_b"
FT                   /protein_id="EDL34286.1"
FT                   /translation="MGYGPRRAPPLTCVPPLFHFPQRPGMSPGSRMPMAGLQVGPPAGS
FT                   PFGTAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKRRKMADKVLPQRIRELVP
FT                   ESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKADGDNAG
FT                   TAGTPGGTPAADKVASWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKELYGPDNHLV
FT                   EWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAI
FT                   MQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVIN
FT                   HVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQ
FT                   LKTQRDFMLSFSTEPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVG
FT                   RHIFAKVQQRRQELEQVLGIRLT"
FT   assembly_gap    4912867..4912937
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            <4916999..4929062
FT                   /gene="Tcam1"
FT                   /locus_tag="mCG_2878"
FT                   /note="gene_id=mCG2878.3"
FT   mRNA            join(4916999..4917121,4922226..4922301,4923110..4923376,
FT                   4924368..4924688,4924881..4925159,4925697..4925966,
FT                   4926701..4926943,4927143..4929062)
FT                   /gene="Tcam1"
FT                   /locus_tag="mCG_2878"
FT                   /product="testicular cell adhesion molecule 1, transcript
FT                   variant mCT1289"
FT                   /note="gene_id=mCG2878.3 transcript_id=mCT1289.3 created on
FT                   23-JUN-2003"
FT   mRNA            join(<4916999..4917121,4922226..4922301,4923110..4923376,
FT                   4924368..4924688,4924881..4925159,4925697..4926131,
FT                   4926701..4926943,4927143..4928458)
FT                   /gene="Tcam1"
FT                   /locus_tag="mCG_2878"
FT                   /product="testicular cell adhesion molecule 1, transcript
FT                   variant mCT193273"
FT                   /note="gene_id=mCG2878.3 transcript_id=mCT193273.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4916999..4917121,4922226..4922301,4923110..4923376,
FT                   4924368..4924688,4924881..4925159,4925697..4925974)
FT                   /codon_start=1
FT                   /gene="Tcam1"
FT                   /locus_tag="mCG_2878"
FT                   /product="testicular cell adhesion molecule 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2878.3 transcript_id=mCT193273.0
FT                   protein_id=mCP114235.0 isoform=CRA_a"
FT                   /protein_id="EDL34287.1"
FT                   /translation="QRLPHVVVSSALAMSLFSLRSPSIEEGSAVRQEGQDDRFDSLLDF
FT                   LPRMKMLLLGVWTLLALIPCPGAAEELFQVSVHPNEALVEFGHSLTVNCSTTCPDPGPS
FT                   GIETFLKKTQLSKGSQWKEFLLEDITEDLVLQCFFSCAGEQKDTVLAITMYQPPEQVIL
FT                   DLQPEWVAVDEAFTVTCHVPSVAPLQSLTLTLLQGDQELHRKDFLSLSLVSQRAEVTAT
FT                   VRAHRDNDRRNFSCRAELDLSPHGGGLFHGSSATKQLRIFEFSQNPQIWVPSLLEVGKA
FT                   EIVSCEVTRVFPAQEAVFRMFLEDQELSPFSSWREDAAWASATIQAMETGDQELTCLVS
FT                   LGPVEQKTRKPVYVYSFPPPILEIEDAYPLAGTDVNVTCSGHVLTSPSPTLRLQGSLNH
FT                   SAPGKPAWLLFTAREEDDGRTLSCEASLEVQGQRLVRTTESQLHVLCE"
FT   mRNA            join(<4917076..4917202,4922226..4922301,4923110..4923376,
FT                   4924368..4924688,4924881..4925159,4925697..4925966,
FT                   4926701..4926943,4927143..4929062)
FT                   /gene="Tcam1"
FT                   /locus_tag="mCG_2878"
FT                   /product="testicular cell adhesion molecule 1, transcript
FT                   variant mCT193274"
FT                   /note="gene_id=mCG2878.3 transcript_id=mCT193274.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4917200..4917202,4922226..4922301,4923110..4923376,
FT                   4924368..4924688,4924881..4925159,4925697..4925966,
FT                   4926701..4926943,4927143..4927354)
FT                   /codon_start=1
FT                   /gene="Tcam1"
FT                   /locus_tag="mCG_2878"
FT                   /product="testicular cell adhesion molecule 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2878.3 transcript_id=mCT193274.0
FT                   protein_id=mCP114236.0 isoform=CRA_b"
FT                   /protein_id="EDL34288.1"
FT                   /translation="QLLDFLPRMKMLLLGVWTLLALIPCPGAAEELFQVSVHPNEALVE
FT                   FGHSLTVNCSTTCPDPGPSGIETFLKKTQLSKGSQWKEFLLEDITEDLVLQCFFSCAGE
FT                   QKDTVLAITMYQPPEQVILDLQPEWVAVDEAFTVTCHVPSVAPLQSLTLTLLQGDQELH
FT                   RKDFLSLSLVSQRAEVTATVRAHRDNDRRNFSCRAELDLSPHGGGLFHGSSATKQLRIF
FT                   EFSQNPQIWVPSLLEVGKAEIVSCEVTRVFPAQEAVFRMFLEDQELSPFSSWREDAAWA
FT                   SATIQAMETGDQELTCLVSLGPVEQKTRKPVYVYSFPPPILEIEDAYPLAGTDVNVTCS
FT                   GHVLTSPSPTLRLQGSLNHSAPGKPAWLLFTAREEDDGRTLSCEASLEVQGQRLVRTTE
FT                   SQLHVLYKPRFQESRCPGNQIWVEGMHQMLACIPEGNPTPVLVCVWNGMIFDLDVPQKA
FT                   TQNHTGTYCCTATNPLGSVSKDITIIVQGLPEGISSSTIFIIIIFTLGMAVITVALYLN
FT                   YQPCKGNSRKRMHRPREQSKGEESQFSDIRAEECHAHLC"
FT   CDS             join(4922247..4922301,4923110..4923376,4924368..4924688,
FT                   4924881..4925159,4925697..4925966,4926701..4926943,
FT                   4927143..4927354)
FT                   /codon_start=1
FT                   /gene="Tcam1"
FT                   /locus_tag="mCG_2878"
FT                   /product="testicular cell adhesion molecule 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG2878.3 transcript_id=mCT1289.3
FT                   protein_id=mCP14622.3 isoform=CRA_c"
FT                   /db_xref="GOA:Q99NB3"
FT                   /db_xref="InterPro:IPR003987"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1923120"
FT                   /db_xref="UniProtKB/TrEMBL:Q99NB3"
FT                   /protein_id="EDL34289.1"
FT                   /translation="MKMLLLGVWTLLALIPCPGAAEELFQVSVHPNEALVEFGHSLTVN
FT                   CSTTCPDPGPSGIETFLKKTQLSKGSQWKEFLLEDITEDLVLQCFFSCAGEQKDTVLAI
FT                   TMYQPPEQVILDLQPEWVAVDEAFTVTCHVPSVAPLQSLTLTLLQGDQELHRKDFLSLS
FT                   LVSQRAEVTATVRAHRDNDRRNFSCRAELDLSPHGGGLFHGSSATKQLRIFEFSQNPQI
FT                   WVPSLLEVGKAEIVSCEVTRVFPAQEAVFRMFLEDQELSPFSSWREDAAWASATIQAME
FT                   TGDQELTCLVSLGPVEQKTRKPVYVYSFPPPILEIEDAYPLAGTDVNVTCSGHVLTSPS
FT                   PTLRLQGSLNHSAPGKPAWLLFTAREEDDGRTLSCEASLEVQGQRLVRTTESQLHVLYK
FT                   PRFQESRCPGNQIWVEGMHQMLACIPEGNPTPVLVCVWNGMIFDLDVPQKATQNHTGTY
FT                   CCTATNPLGSVSKDITIIVQGLPEGISSSTIFIIIIFTLGMAVITVALYLNYQPCKGNS
FT                   RKRMHRPREQSKGEESQFSDIRAEECHAHLC"
FT   gene            complement(4940596..4942193)
FT                   /gene="Gh"
FT                   /locus_tag="mCG_3216"
FT                   /note="gene_id=mCG3216.1"
FT   mRNA            complement(join(4940596..4940894,4941093..4941254,
FT                   4941423..4941539,4941724..4941884,4942068..4942193))
FT                   /gene="Gh"
FT                   /locus_tag="mCG_3216"
FT                   /product="growth hormone"
FT                   /note="gene_id=mCG3216.1 transcript_id=mCT1303.1 created on
FT                   25-JUL-2002"
FT   CDS             complement(join(4940694..4940894,4941093..4941254,
FT                   4941423..4941539,4941724..4941884,4942068..4942077))
FT                   /codon_start=1
FT                   /gene="Gh"
FT                   /locus_tag="mCG_3216"
FT                   /product="growth hormone"
FT                   /note="gene_id=mCG3216.1 transcript_id=mCT1303.1
FT                   protein_id=mCP14603.1"
FT                   /db_xref="GOA:A0A0M6L0K7"
FT                   /db_xref="InterPro:IPR001400"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="InterPro:IPR018116"
FT                   /db_xref="MGI:MGI:95707"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0M6L0K7"
FT                   /protein_id="EDL34290.1"
FT                   /translation="MATDSRTSWLLTVSLLCLLWPQEASAFPAMPLSSLFSNAVLRAQH
FT                   LHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFS
FT                   LLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQIL
FT                   KQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF"
FT   assembly_gap    4943009..4943228
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    4946868..4946898
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   gene            complement(4951862..4955287)
FT                   /gene="Cd79b"
FT                   /locus_tag="mCG_3044"
FT                   /note="gene_id=mCG3044.1"
FT   mRNA            complement(join(4951862..4952431,4952533..4952574,
FT                   4952848..4952966,4953159..4953467,4954187..4954237,
FT                   4954944..4955287))
FT                   /gene="Cd79b"
FT                   /locus_tag="mCG_3044"
FT                   /product="CD79B antigen"
FT                   /note="gene_id=mCG3044.1 transcript_id=mCT1297.1 created on
FT                   25-JUL-2002"
FT   CDS             complement(join(4952333..4952431,4952533..4952574,
FT                   4952848..4952966,4953159..4953467,4954187..4954237,
FT                   4954944..4955010))
FT                   /codon_start=1
FT                   /gene="Cd79b"
FT                   /locus_tag="mCG_3044"
FT                   /product="CD79B antigen"
FT                   /note="gene_id=mCG3044.1 transcript_id=mCT1297.1
FT                   protein_id=mCP14604.2"
FT                   /protein_id="EDL34291.1"
FT                   /translation="MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCSQ
FT                   IWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYT
FT                   LTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILI
FT                   QTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVG
FT                   EHPGQE"
FT   gene            complement(4959812..>4989965)
FT                   /gene="Scn4a"
FT                   /locus_tag="mCG_2873"
FT                   /note="gene_id=mCG2873.2"
FT   mRNA            complement(join(4959812..4961427,4962418..4962688,
FT                   4963298..4963402,4964458..4964595,4964790..4964843,
FT                   4965029..4965307,4966713..4966835,4967288..4967461,
FT                   4968093..4968247,4968602..4968737,4970558..4971034,
FT                   4975944..4976300,4977628..4977801,4979724..4979962,
FT                   4981988..4982141,4982877..4983086,4984458..4984599,
FT                   4984780..4984843,4985979..4986293,4988333..4988424,
FT                   4988848..4988976,4989279..4989368,4989476..4989594,
FT                   4989693..>4989965))
FT                   /gene="Scn4a"
FT                   /locus_tag="mCG_2873"
FT                   /product="sodium channel, voltage-gated, type IV, alpha"
FT                   /note="gene_id=mCG2873.2 transcript_id=mCT1299.2 created on
FT                   25-JUL-2002"
FT   CDS             complement(join(4960172..4961427,4962418..4962688,
FT                   4963298..4963402,4964458..4964595,4964790..4964843,
FT                   4965029..4965307,4966713..4966835,4967288..4967461,
FT                   4968093..4968247,4968602..4968737,4970558..4971034,
FT                   4975944..4976300,4977628..4977801,4979724..4979962,
FT                   4981988..4982141,4982877..4983086,4984458..4984599,
FT                   4984780..4984843,4985979..4986293,4988333..4988424,
FT                   4988848..4988976,4989279..4989368,4989476..4989594,
FT                   4989693..4989965))
FT                   /codon_start=1
FT                   /gene="Scn4a"
FT                   /locus_tag="mCG_2873"
FT                   /product="sodium channel, voltage-gated, type IV, alpha"
FT                   /note="gene_id=mCG2873.2 transcript_id=mCT1299.2
FT                   protein_id=mCP14644.2"
FT                   /db_xref="GOA:G3X8T7"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001696"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR008052"
FT                   /db_xref="InterPro:IPR010526"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028826"
FT                   /db_xref="MGI:MGI:98250"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8T7"
FT                   /protein_id="EDL34292.1"
FT                   /translation="MASSSLPTLVPPGPHCLRPFTPESLAAIEQRAMEEEARLQRNKQM
FT                   EIEEPERKPRSDLEAGKNLPLIYGDPPPEVIGVPLEDLDPYYSDKKTFIVLNKGKAIFR
FT                   FSATPALYMLSPFSIVRRVAIKVLIHALFSMFIMITILTNCVFMTMSNPPSWSKDVEYT
FT                   FTGIYTFESLIKMLARGFCIDDFTFLRDPWNWLDFSVITMAYVTEFVDLGNISALRTFR
FT                   VLRALKTITVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALVGLQLFMGNLRQKCV
FT                   RWPPPMNDTNTTWYGNDTWYGNDTWYGNDTWYGNDTWNSQESWVSNSTFDWEAYINDEG
FT                   NFYFLEGSNDALLCGNSSDAGHCPEGYECMKAGRNPNYGYTSYDTFSWAFLALFRLMTQ
FT                   DYWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATLAEDQEK
FT                   EEEFQQMLEKFKKHQEELEKAKAAQALEGGEEADGDPTHSKDCNGSLDTSGEKGPPRPS
FT                   CSAESAISDAMEELEEAHQKCPPWWYKCAHKVLIWNCCAPWVKFKHIILLIVMDPFVDL
FT                   GITICIVLNTLFMAMEHYPMTEHFDNVLSVGNLVFTGIFTAEMVLKLIAMDPYEYFQQG
FT                   WNIFDSFIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGAL
FT                   GNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIASDCSLPRWHMHDFFHSFLIVFRILC
FT                   GEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSADSLAASDEDGE
FT                   MNNLQIAIGRIKWGIAFAKTFLLGLLHGKILSLKDIMLSLGEPGGAGENGESPPEDEKK
FT                   EPPPEDGNKELKDNHILNHVGLTDGPRSSIEMDHLNFINNPYLTIHVPIASEESDLEMP
FT                   TEEETDTFSEPEDIKKPLQPLYDGNSSVCSTADYKPPEEDPEEQAEENPEGELPEECFT
FT                   EACVKRCPCLYVDISQGRGKMWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIY
FT                   IEQRRVIQTILEYADKVFTYIFILEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLV
FT                   ANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWL
FT                   IFSIMGVNLFAGKFYYCINTTTSERFDISVVNNKSECESLMYTGQVRWMNVKVNYDNVG
FT                   LGYLSLLQVATFKGWMDIMYAAVDSREKEEQPDYEVNLYMYLYFVIFIIFGSFFTLNLF
FT                   IGVIIDNFNQQKKKFGGKDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPQNKIQGMVYDF
FT                   VTKQVFDISIMILICLNMVTMMVETDDQSQLKVDILYNINMVFIIVFTGECVLKMFALR
FT                   HYYFTIGWNIFDFVVVILSIVGLALSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKG
FT                   IRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSI
FT                   ICLFEITTSAGWDGLLNPILNSGPPDCDPTLENPGTNIKGDCGNPSIGICFFCSYIIIS
FT                   FLIVVNMYIAIILENFNVATEESSEPLCEDDFEMFYETWEKFDPDATQFIDYSRLSDFV
FT                   DTLQEPLKIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSGEMDALKQTMEE
FT                   KFMAANPSKVSYEPITTTLKRKQEEVCAIKIQRAYRRHLLQRSVKQASYMYRHSQEGNG
FT                   DGAPEKEGLLANTMNKMYGSEKEDNGVQSQGEKEKDSTEDAGPTTEVTAPSSSDTALTP
FT                   PPPSPPPPSSPPQGQTVRPGVKESLV"
FT   assembly_gap    4963867..4963886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4999568..4999587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5006599..5018294
FT                   /locus_tag="mCG_2882"
FT                   /note="gene_id=mCG2882.1"
FT   mRNA            join(5006599..5006778,5007905..5008072,5015477..5015620,
FT                   5016589..5016695,5017434..5017654,5017807..5017877,
FT                   5018073..5018294)
FT                   /locus_tag="mCG_2882"
FT                   /product="mCG2882"
FT                   /note="gene_id=mCG2882.1 transcript_id=mCT1288.1 created on
FT                   16-SEP-2002"
FT   assembly_gap    5011840..5011859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(5016603..5016695,5017434..5017654,5017807..5017877,
FT                   5018073..5018101)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2882"
FT                   /product="mCG2882"
FT                   /note="gene_id=mCG2882.1 transcript_id=mCT1288.1
FT                   protein_id=mCP14637.2"
FT                   /protein_id="EDL34293.1"
FT                   /translation="MMLQNAQMHQLLLGQLVADALNPGPEWPSPPVHTDSHEEQMEEEM
FT                   EMQEQEPLVYHHHYLPCPVTPLGPMSLWPASFLPVPPHQPPWQGEPRIQHQPPASRQEE
FT                   VRDVPPPPPPSATGTVGADVPPASDYYDAESLP"
FT   gene            complement(5018837..5029273)
FT                   /gene="Icam2"
FT                   /locus_tag="mCG_2871"
FT                   /note="gene_id=mCG2871.2"
FT   mRNA            complement(join(5018837..5019174,5019828..5020145,
FT                   5021865..5022137,5022515..5022622,5023628..5023744,
FT                   5029245..5029273))
FT                   /gene="Icam2"
FT                   /locus_tag="mCG_2871"
FT                   /product="intercellular adhesion molecule 2, transcript
FT                   variant mCT171090"
FT                   /note="gene_id=mCG2871.2 transcript_id=mCT171090.0 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(5018837..5019174,5019828..5020145,
FT                   5021865..5022137,5022515..5022622,5023628..5023744,
FT                   5024068..5024177))
FT                   /gene="Icam2"
FT                   /locus_tag="mCG_2871"
FT                   /product="intercellular adhesion molecule 2, transcript
FT                   variant mCT171091"
FT                   /note="gene_id=mCG2871.2 transcript_id=mCT171091.0 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(5018837..5019174,5019828..5020145,
FT                   5021865..5022137,5023628..5023839))
FT                   /gene="Icam2"
FT                   /locus_tag="mCG_2871"
FT                   /product="intercellular adhesion molecule 2, transcript
FT                   variant mCT1294"
FT                   /note="gene_id=mCG2871.2 transcript_id=mCT1294.1 created on
FT                   25-JUL-2002"
FT   CDS             complement(join(5018987..5019174,5019828..5020145,
FT                   5021865..5022137,5023628..5023682))
FT                   /codon_start=1
FT                   /gene="Icam2"
FT                   /locus_tag="mCG_2871"
FT                   /product="intercellular adhesion molecule 2, isoform CRA_a"
FT                   /note="gene_id=mCG2871.2 transcript_id=mCT1294.1
FT                   protein_id=mCP14615.1 isoform=CRA_a"
FT                   /protein_id="EDL34294.1"
FT                   /translation="MSSFACWSLSLLILFYSPGSGEKAFEVYIWSEKQIVEATESWKIN
FT                   CSTNCAAPDMGGLETPTNKIMLEEHPQGKWKQFLVSNVSKDTVFFCHFTCSGKQHSESL
FT                   NIRVYQPPAQVTLKLQPPRVFVGEDFTIECTVSPVQPLERLTLSLLRGRETLKNQTFGG
FT                   AETVPQEATATFNSTALKKDGLNFSCQAELDLRPHGGYIIRSISEYQILEVYEPMQDNQ
FT                   MVIIIVVVSILLFLFVTSVLLCFIFGQHWHRRRTGTYGVLAAWRRLPRAFRARPV"
FT   CDS             complement(join(5018987..5019174,5019828..5020145,
FT                   5021865..5022137,5022515..5022622,5023628..5023682))
FT                   /codon_start=1
FT                   /gene="Icam2"
FT                   /locus_tag="mCG_2871"
FT                   /product="intercellular adhesion molecule 2, isoform CRA_b"
FT                   /note="gene_id=mCG2871.2 transcript_id=mCT171090.0
FT                   protein_id=mCP94009.0 isoform=CRA_b"
FT                   /protein_id="EDL34295.1"
FT                   /translation="MSSFACWSLSLLILFYSPGLVISVLHCFMNACSRWQVCEPAAPFI
FT                   CKVLPQRMKGSGEKAFEVYIWSEKQIVEATESWKINCSTNCAAPDMGGLETPTNKIMLE
FT                   EHPQGKWKQFLVSNVSKDTVFFCHFTCSGKQHSESLNIRVYQPPAQVTLKLQPPRVFVG
FT                   EDFTIECTVSPVQPLERLTLSLLRGRETLKNQTFGGAETVPQEATATFNSTALKKDGLN
FT                   FSCQAELDLRPHGGYIIRSISEYQILEVYEPMQDNQMVIIIVVVSILLFLFVTSVLLCF
FT                   IFGQHWHRRRTGTYGVLAAWRRLPRAFRARPV"
FT   CDS             complement(join(5018987..5019174,5019828..5020145,
FT                   5021865..5022137,5022515..5022622,5023628..5023682))
FT                   /codon_start=1
FT                   /gene="Icam2"
FT                   /locus_tag="mCG_2871"
FT                   /product="intercellular adhesion molecule 2, isoform CRA_b"
FT                   /note="gene_id=mCG2871.2 transcript_id=mCT171091.0
FT                   protein_id=mCP94008.0 isoform=CRA_b"
FT                   /protein_id="EDL34296.1"
FT                   /translation="MSSFACWSLSLLILFYSPGLVISVLHCFMNACSRWQVCEPAAPFI
FT                   CKVLPQRMKGSGEKAFEVYIWSEKQIVEATESWKINCSTNCAAPDMGGLETPTNKIMLE
FT                   EHPQGKWKQFLVSNVSKDTVFFCHFTCSGKQHSESLNIRVYQPPAQVTLKLQPPRVFVG
FT                   EDFTIECTVSPVQPLERLTLSLLRGRETLKNQTFGGAETVPQEATATFNSTALKKDGLN
FT                   FSCQAELDLRPHGGYIIRSISEYQILEVYEPMQDNQMVIIIVVVSILLFLFVTSVLLCF
FT                   IFGQHWHRRRTGTYGVLAAWRRLPRAFRARPV"
FT   gene            complement(5038816..5129064)
FT                   /gene="Ern1"
FT                   /locus_tag="mCG_2875"
FT                   /note="gene_id=mCG2875.2"
FT   mRNA            complement(join(5038816..5039950,5040968..5041035,
FT                   5041391..5041514,5044644..5044771,5046918..5047065,
FT                   5048237..5048436,5048692..5048791,5049256..5049445,
FT                   5050086..5050176,5051091..5051358,5052819..5053010,
FT                   5055547..5055665,5060022..5060061,5076123..5076187,
FT                   5100106..5100226,5128826..5129064))
FT                   /gene="Ern1"
FT                   /locus_tag="mCG_2875"
FT                   /product="endoplasmic reticulum (ER) to nucleus signalling
FT                   1, transcript variant mCT171096"
FT                   /note="gene_id=mCG2875.2 transcript_id=mCT171096.0 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(5038816..5039950,5040968..5041035,
FT                   5041391..5041514,5044644..5044771,5046918..5047065,
FT                   5048237..5048436,5048692..5048791,5049256..5049445,
FT                   5050086..5050176,5051091..5051358,5052819..5053010,
FT                   5055547..5055665,5060022..5060187,5061217..5061295,
FT                   5062904..5063165,5064585..5064686,5068013..5068135,
FT                   5070214..5070286,5076115..5076187,5078290..5078323,
FT                   5100106..5100226,5128826..5129046))
FT                   /gene="Ern1"
FT                   /locus_tag="mCG_2875"
FT                   /product="endoplasmic reticulum (ER) to nucleus signalling
FT                   1, transcript variant mCT1290"
FT                   /note="gene_id=mCG2875.2 transcript_id=mCT1290.2 created on
FT                   25-JUL-2002"
FT   CDS             complement(join(5039738..5039950,5040968..5041035,
FT                   5041391..5041514,5044644..5044771,5046918..5047065,
FT                   5048237..5048436,5048692..5048791,5049256..5049445,
FT                   5050086..5050176,5051091..5051358,5052819..5053010,
FT                   5055547..5055665,5060022..5060061,5076123..5076187,
FT                   5100106..5100226,5128826..5128885))
FT                   /codon_start=1
FT                   /gene="Ern1"
FT                   /locus_tag="mCG_2875"
FT                   /product="endoplasmic reticulum (ER) to nucleus signalling
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG2875.2 transcript_id=mCT171096.0
FT                   protein_id=mCP94014.0 isoform=CRA_c"
FT                   /protein_id="EDL34299.1"
FT                   /translation="MPARWLLLLLALLLPPPGPGSFGRTSTVTLPETLLFVSTLDGSLH
FT                   AVSKRTGSIKWTLKEGRLSSQIPMMAVCTHLEARTTKSKLNYLRNYWLLIGHHETPLSA
FT                   STKMLERFPNNLPKHRENVIPADSEKRSFEEVINIVGQTSDNTPTTVSQDVEEKLARAP
FT                   AKPEAPVDSMLKDMATIILSTFLLVGWVAFIITYPLSVHQQRQLQHQQFQKELEKIQLL
FT                   QQQQLPFHPHGDLTQDPEFLDSSGPFSESSGTSSPSPSPRASNHSLHPSSSASRAGTSP
FT                   SLEQDDEDEETRMVIVGKISFCPKDVLGHGAEGTIVYKGMFDNRDVAVKRILPECFSFA
FT                   DREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAHLGLEPITL
FT                   LHQTTSGLAHLHSLNIVHRDLKPHNILLSMPNAHGRIKAMISDFGLCKKLAVGRHSFSR
FT                   RSGVPGTEGWIAPEMLSEDCKDNPTYTVDIFSAGCVFYYVISEGNHPFGKSLQRQANIL
FT                   LGACNLDCFHSDKHEDVIARELIEKMIAMDPQQRPSAKHVLKHPFFWSLEKQLQFFQDV
FT                   SDRIEKEALDGPIVRQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDLLRAM
FT                   RNKKHHYRELPVEVQETLGSIPDDFVRYFTSRFPHLLSHTYQAMELCRHERLFQTYYWH
FT                   EPTEPQPPVIPYAL"
FT   CDS             complement(join(5039738..5039950,5040968..5041035,
FT                   5041391..5041514,5044644..5044771,5046918..5047065,
FT                   5048237..5048436,5048692..5048791,5049256..5049445,
FT                   5050086..5050176,5051091..5051358,5052819..5053010,
FT                   5055547..5055665,5060022..5060187,5061217..5061295,
FT                   5062904..5063165,5064585..5064686,5068013..5068135,
FT                   5070214..5070286,5076115..5076187,5078290..5078323,
FT                   5100106..5100226,5128826..5128885))
FT                   /codon_start=1
FT                   /gene="Ern1"
FT                   /locus_tag="mCG_2875"
FT                   /product="endoplasmic reticulum (ER) to nucleus signalling
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG2875.2 transcript_id=mCT1290.2
FT                   protein_id=mCP14618.2 isoform=CRA_a"
FT                   /protein_id="EDL34297.1"
FT                   /translation="MPARWLLLLLALLLPPPGPGSFGRTSTVTLPETLLFVSTLDGSLH
FT                   AVSKRTGSIKWTLKEDPVLQVPTHVEEPAFLPDPNDGSLYTLGGKNNEGLTKLPFTIPE
FT                   LVQASPCRSSDGILYMGKKQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEY
FT                   TITMYDTKTRELRWNATYFDYAASLPEDDVDYKMSHFVSNGDGLVVTVDSESGDVLWIQ
FT                   NYASPVVAFYVWQGEVLRKVVHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSK
FT                   LTPTLYVGKYSTSLYASPSMVHEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPST
FT                   DLKFDPGLKGKSKLNYLRNYWLLIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEK
FT                   RSFEEVINIVGQTSDNTPTTVSQDVEEKLARAPAKPEAPVDSMLKDMATIILSTFLLVG
FT                   WVAFIITYPLSVHQQRQLQHQQFQKELEKIQLLQQQQLPFHPHGDLTQDPEFLDSSGPF
FT                   SESSGTSSPSPSPRASNHSLHPSSSASRAGTSPSLEQDDEDEETRMVIVGKISFCPKDV
FT                   LGHGAEGTIVYKGMFDNRDVAVKRILPECFSFADREVQLLRESDEHPNVIRYFCTEKDR
FT                   QFQYIAIELCAATLQEYVEQKDFAHLGLEPITLLHQTTSGLAHLHSLNIVHRDLKPHNI
FT                   LLSMPNAHGRIKAMISDFGLCKKLAVGRHSFSRRSGVPGTEGWIAPEMLSEDCKDNPTY
FT                   TVDIFSAGCVFYYVISEGNHPFGKSLQRQANILLGACNLDCFHSDKHEDVIARELIEKM
FT                   IAMDPQQRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKEALDGPIVRQLERGGRAVVK
FT                   MDWRENITVPLQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPVEVQETLGSIPDDFV
FT                   RYFTSRFPHLLSHTYQAMELCRHERLFQTYYWHEPTEPQPPVIPYAL"
FT   mRNA            complement(join(5054962..5055665,5060022..5060187,
FT                   5061217..5061295,5062904..5063165,5064585..5064686,
FT                   5068013..5068135,5070214..5070286,5076115..5076187,
FT                   5078290..5078323,5100106..5100226,5128826..5129046))
FT                   /gene="Ern1"
FT                   /locus_tag="mCG_2875"
FT                   /product="endoplasmic reticulum (ER) to nucleus signalling
FT                   1, transcript variant mCT171095"
FT                   /note="gene_id=mCG2875.2 transcript_id=mCT171095.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(5055532..5055665,5060022..5060187,
FT                   5061217..5061295,5062904..5063165,5064585..5064686,
FT                   5068013..5068135,5070214..5070286,5076115..5076187,
FT                   5078290..5078323,5100106..5100226,5128826..5128885))
FT                   /codon_start=1
FT                   /gene="Ern1"
FT                   /locus_tag="mCG_2875"
FT                   /product="endoplasmic reticulum (ER) to nucleus signalling
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG2875.2 transcript_id=mCT171095.0
FT                   protein_id=mCP94013.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR027295"
FT                   /db_xref="MGI:MGI:1930134"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TBZ5"
FT                   /protein_id="EDL34298.1"
FT                   /translation="MPARWLLLLLALLLPPPGPGSFGRTSTVTLPETLLFVSTLDGSLH
FT                   AVSKRTGSIKWTLKEDPVLQVPTHVEEPAFLPDPNDGSLYTLGGKNNEGLTKLPFTIPE
FT                   LVQASPCRSSDGILYMGKKQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEY
FT                   TITMYDTKTRELRWNATYFDYAASLPEDDVDYKMSHFVSNGDGLVVTVDSESGDVLWIQ
FT                   NYASPVVAFYVWQGEVLRKVVHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSK
FT                   LTPTLYVGKYSTSLYASPSMVHEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPST
FT                   DLKFDPGLKGKSKLNYLRNYWLLIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEK
FT                   RSFEEVSGK"
FT   assembly_gap    5141861..5141909
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   gene            <5142155..5142438
FT                   /locus_tag="mCG_58418"
FT                   /note="gene_id=mCG58418.2"
FT   mRNA            <5142155..5142438
FT                   /locus_tag="mCG_58418"
FT                   /product="mCG58418"
FT                   /note="gene_id=mCG58418.2 transcript_id=mCT58601.2 created
FT                   on 16-SEP-2002"
FT   CDS             <5142255..5142425
FT                   /codon_start=1
FT                   /locus_tag="mCG_58418"
FT                   /product="mCG58418"
FT                   /note="gene_id=mCG58418.2 transcript_id=mCT58601.2
FT                   protein_id=mCP35697.2"
FT                   /protein_id="EDL34300.1"
FT                   /translation="TADPGDANRNLSRPHRQREVAGAADFVPSPFASLSGLPCAGQQTA
FT                   WTSTTFPRASE"
FT   gene            complement(5143366..5222091)
FT                   /gene="Tex2"
FT                   /locus_tag="mCG_121870"
FT                   /note="gene_id=mCG121870.0"
FT   mRNA            complement(join(5143366..5144946,5148150..5148270,
FT                   5153185..5153394,5154870..5154995,5161165..5161297,
FT                   5170542..5170641,5175151..5175297,5185454..5185701,
FT                   5187946..5188285,5189996..5190196,5208359..5210021,
FT                   5220351..5220493,5222006..5222091))
FT                   /gene="Tex2"
FT                   /locus_tag="mCG_121870"
FT                   /product="testis expressed gene 2, transcript variant
FT                   mCT123083"
FT                   /note="gene_id=mCG121870.0 transcript_id=mCT123083.1
FT                   created on 16-SEP-2002"
FT   mRNA            complement(join(5143622..5144946,5148150..5148270,
FT                   5153185..5153394,5154870..5154989,5161165..5161297,
FT                   5170542..5170641,5175151..5175297,5185454..5185701,
FT                   5187946..5188285,5189996..5190197,5208359..>5208504))
FT                   /gene="Tex2"
FT                   /locus_tag="mCG_121870"
FT                   /product="testis expressed gene 2, transcript variant
FT                   mCT193276"
FT                   /note="gene_id=mCG121870.0 transcript_id=mCT193276.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(5144824..5144946,5148150..5148270,
FT                   5153185..5153394,5154870..5154995,5161165..5161297,
FT                   5170542..5170641,5175151..5175297,5185454..5185701,
FT                   5187946..5188285,5189996..5190196,5208359..5209996))
FT                   /codon_start=1
FT                   /gene="Tex2"
FT                   /locus_tag="mCG_121870"
FT                   /product="testis expressed gene 2, isoform CRA_a"
FT                   /note="gene_id=mCG121870.0 transcript_id=mCT123083.1
FT                   protein_id=mCP75483.1 isoform=CRA_a"
FT                   /protein_id="EDL34301.1"
FT                   /translation="MTSLNGRHAEKTIDMPKPSAPKVHVQRSVSRDTIAIHFSASGEEE
FT                   EEEEEEFRGYLEEGLDDQSIVTGLEAKEDLYLESQGGHDPAGPVSTAPADGLSVSESPA
FT                   ILPVSENTVKLLESPAPALQVLSPVPLALSPGSSSSGPLASSPSVSSLSEQKTSSSSPL
FT                   SSPSKSPVLSSSASSSALSSAKPFMSLVKSLSTEVEPKESPHPPRHRHLMKTLVKSLST
FT                   DTSRQESDTVSYKPPDSKLNLHLFKQFTQPRNTGGDSKTAPSSPLTSPSDTRSFFKVPE
FT                   MEAKIEDTKRRLSEVIYEPFQLLSKIIGEESGSHRPKALSASASELSSLSGLNGHLESN
FT                   NYSIKEEEGDSEGEGYGSDSNTSRSDHLKPTEDASKEVEPKGSQASSLKDLGLKTSSLV
FT                   LEKCSLSALVSKEDEEFCELYTEDFELETEGEGRLDKTLDLPLKPEVLASDGVALESED
FT                   EEDSATEHQELPVKTLGFFIMCVYAYLILPLPYYMSGLFLGVGLGFMTAVCMIWFFTPP
FT                   SAHKHHKSLKALRHQSTRSLDIKEPEILKEWMNEIYNYDPETYHATLTHSVFVRLEGGT
FT                   LRLSKPNKNISRRASYNETKPEVTYISQKIYDLSDSKIYLVPKSLARKRIWNKKYPICI
FT                   ELGRQDDFMSKAQSDKEATEEKPPPEKELPSEDLKKPPQPQEGTKSSQRDPILYLFGRT
FT                   GREKEEWFRRFILASRLKSELRKPAGVSGSKSGLLPAHSRHSSPSGHLSHSRSSSKGSV
FT                   EEMMSQPKQKELVGSVRQKMLLDYSVYMGRCVPQDNRSPHRSPVQSAESSPTASKKLPE
FT                   APPSEEEEQEAWVNALLGRIFWDFLGEKYWSDVVSKKIQMKLSKIKLPYFMNELTLTEL
FT                   DMGVAVPKILQAFKPYVDHQGLWIDLEMSYNGSFLMTLETKMNLTKLGKEPLVEALKVG
FT                   EIGKEGCRPRAYCLADSDEESSSAGSSEEDDPPEPTAGDKQPLPGAEGYVGGHRTSKIM
FT                   RFVDKITKSKYFQKATETEFIKKKIEEVSNTPLLLTVEVQECRGTLAVNIPPPPTDRIW
FT                   YGFRKPPYVELKARPKLGEREVTLVHVTEWIEKKLEQELQKVFVMPNMDDVYIPIMHSA
FT                   MDPRSTSCLLKEPPVETSDQL"
FT   CDS             complement(join(5144824..5144946,5148150..5148270,
FT                   5153185..5153394,5154870..5154989,5161165..5161297,
FT                   5170542..5170641,5175151..5175297,5185454..5185701,
FT                   5187946..5188285,5189996..5190197,5208359..>5208360))
FT                   /codon_start=1
FT                   /gene="Tex2"
FT                   /locus_tag="mCG_121870"
FT                   /product="testis expressed gene 2, isoform CRA_b"
FT                   /note="gene_id=mCG121870.0 transcript_id=mCT193276.0
FT                   protein_id=mCP114198.0 isoform=CRA_b"
FT                   /protein_id="EDL34302.1"
FT                   /translation="REWMNEIYNYDPETYHATLTHSVFVRLEGGTLRLSKPNKNISRRA
FT                   SYNETKPEVTYISQKIYDLSDSKIYLVPKSLARKRIWNKKYPICIELGRQDDFMSKAQS
FT                   DKEATEEKPPPEKELPSEDLKKPPQPQEGTKSSQRDPILYLFGRTGREKEEWFRRFILA
FT                   SRLKSELRKPAGVSGSKSGLLPAHSRHSSPSGHLSHSRSSSKGSVEEMMSQPKQKELVG
FT                   SVRQKMLLDYSVYMGRCVPQDNRSPHRSPVQSAESSPTASKKLPEAPPSEEEEQEAWVN
FT                   ALLGRIFWDFLGEKYWSDVVSKKIQMKLSKIKLPYFMNELTLTELDMGVAVPKILQAFK
FT                   PYVDHQGLWIDLEMSYNGSFLMTLETKMNLTKLGKEPLVEALKVGEIGKEGPRAYCLAD
FT                   SDEESSSAGSSEEDDPPEPTAGDKQPLPGAEGYVGGHRTSKIMRFVDKITKSKYFQKAT
FT                   ETEFIKKKIEEVSNTPLLLTVEVQECRGTLAVNIPPPPTDRIWYGFRKPPYVELKARPK
FT                   LGEREVTLVHVTEWIEKKLEQELQKVFVMPNMDDVYIPIMHSAMDPRSTSCLLKEPPVE
FT                   TSDQL"
FT   assembly_gap    5145812..5145903
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    5190245..5190729
FT                   /estimated_length=485
FT                   /gap_type="unknown"
FT   assembly_gap    5193080..5193104
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    5221323..5221823
FT                   /estimated_length=501
FT                   /gap_type="unknown"
FT   assembly_gap    5232438..5232517
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    5237343..5237436
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    5238817..5238836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5249697..5249716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5271561..5272051
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    5279929..5281593
FT                   /estimated_length=1665
FT                   /gap_type="unknown"
FT   assembly_gap    5288131..5289078
FT                   /estimated_length=948
FT                   /gap_type="unknown"
FT   assembly_gap    5294592..5294721
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   gene            complement(5295717..5356139)
FT                   /gene="Pecam1"
FT                   /locus_tag="mCG_2881"
FT                   /note="gene_id=mCG2881.2"
FT   mRNA            complement(join(5295717..5296661,5321134..5321196,
FT                   5322603..5322656,5324443..5324516,5325156..5325183,
FT                   5325790..5325897,5326523..5326810,5330342..5330617,
FT                   5332488..5332736,5336876..5337151,5338174..5338476,
FT                   5340715..5341008,5355647..5355673,5355764..5356139))
FT                   /gene="Pecam1"
FT                   /locus_tag="mCG_2881"
FT                   /product="platelet/endothelial cell adhesion molecule 1,
FT                   transcript variant mCT171099"
FT                   /note="gene_id=mCG2881.2 transcript_id=mCT171099.0 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(5295717..5296661,5313315..5313371,
FT                   5321134..5321196,5322603..5322656,5324443..5324516,
FT                   5325156..5325183,5325790..5325897,5326523..5326810,
FT                   5330342..5330617,5332488..5332736,5336876..5337151,
FT                   5338174..5338476,5340715..5341008,5355647..5355673,
FT                   5355764..5356139))
FT                   /gene="Pecam1"
FT                   /locus_tag="mCG_2881"
FT                   /product="platelet/endothelial cell adhesion molecule 1,
FT                   transcript variant mCT171098"
FT                   /note="gene_id=mCG2881.2 transcript_id=mCT171098.0 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(5295717..5296661,5303576..5303598,
FT                   5313315..5313371,5321134..5321196,5322603..5322656,
FT                   5324443..5324516,5325156..5325183,5325790..5325897,
FT                   5326523..5326810,5330342..5330617,5332488..5332736,
FT                   5336876..5337151,5338174..5338476,5340715..5341008,
FT                   5355647..5355673,5355764..5356139))
FT                   /gene="Pecam1"
FT                   /locus_tag="mCG_2881"
FT                   /product="platelet/endothelial cell adhesion molecule 1,
FT                   transcript variant mCT1287"
FT                   /note="gene_id=mCG2881.2 transcript_id=mCT1287.1 created on
FT                   25-JUL-2002"
FT   CDS             complement(join(5296632..5296661,5303576..5303598,
FT                   5313315..5313371,5321134..5321196,5322603..5322656,
FT                   5324443..5324516,5325156..5325183,5325790..5325897,
FT                   5326523..5326810,5330342..5330617,5332488..5332736,
FT                   5336876..5337151,5338174..5338476,5340715..5341008,
FT                   5355647..5355673,5355764..5355797))
FT                   /codon_start=1
FT                   /gene="Pecam1"
FT                   /locus_tag="mCG_2881"
FT                   /product="platelet/endothelial cell adhesion molecule 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG2881.2 transcript_id=mCT1287.1
FT                   protein_id=mCP14639.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q08481"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:97537"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08481"
FT                   /protein_id="EDL34303.1"
FT                   /translation="MLLALGLTLVLYASLQAEENSFTINSIHMESLPSWEVMNGQQLTL
FT                   ECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLN
FT                   NKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTK
FT                   FVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESF
FT                   STPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSV
FT                   MAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSG
FT                   TPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSK
FT                   PSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPT
FT                   RDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEG
FT                   TSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRS
FT                   STLAVRVFLAPWKKGLIAVVVIGVVIATLIVAAKCYFLRKAKAKQKPVEMSRPAAPLLN
FT                   SNSEKISEPSVEANSHYGYDDVSGNDAVKPINQNKDPQNMDVEYTEVEVSSLEPHQALG
FT                   TRATETVYSEIRKVDPNLMENRYSRTEGSLNGT"
FT   CDS             complement(join(5296642..5296661,5321134..5321196,
FT                   5322603..5322656,5324443..5324516,5325156..5325183,
FT                   5325790..5325897,5326523..5326810,5330342..5330617,
FT                   5332488..5332736,5336876..5337151,5338174..5338476,
FT                   5340715..5341008,5355647..5355673,5355764..5355797))
FT                   /codon_start=1
FT                   /gene="Pecam1"
FT                   /locus_tag="mCG_2881"
FT                   /product="platelet/endothelial cell adhesion molecule 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG2881.2 transcript_id=mCT171099.0
FT                   protein_id=mCP94016.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q08481"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:97537"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08481"
FT                   /protein_id="EDL34305.1"
FT                   /translation="MLLALGLTLVLYASLQAEENSFTINSIHMESLPSWEVMNGQQLTL
FT                   ECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLN
FT                   NKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTK
FT                   FVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESF
FT                   STPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSV
FT                   MAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSG
FT                   TPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSK
FT                   PSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPT
FT                   RDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEG
FT                   TSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRS
FT                   STLAVRVFLAPWKKGLIAVVVIGVVIATLIVAAKCYFLRKAKAKQKPVEMSRPAAPLLN
FT                   SNSEKISEPSVEANSHYGYDDVSGNDAVKPINQNKDPQNMDVEYTEVEVSSLEPHQENG
FT                   RLP"
FT   CDS             complement(join(5296642..5296661,5313315..5313371,
FT                   5321134..5321196,5322603..5322656,5324443..5324516,
FT                   5325156..5325183,5325790..5325897,5326523..5326810,
FT                   5330342..5330617,5332488..5332736,5336876..5337151,
FT                   5338174..5338476,5340715..5341008,5355647..5355673,
FT                   5355764..5355797))
FT                   /codon_start=1
FT                   /gene="Pecam1"
FT                   /locus_tag="mCG_2881"
FT                   /product="platelet/endothelial cell adhesion molecule 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG2881.2 transcript_id=mCT171098.0
FT                   protein_id=mCP94018.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q08481"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:97537"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08481"
FT                   /protein_id="EDL34304.1"
FT                   /translation="MLLALGLTLVLYASLQAEENSFTINSIHMESLPSWEVMNGQQLTL
FT                   ECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLN
FT                   NKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTK
FT                   FVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESF
FT                   STPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSV
FT                   MAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSG
FT                   TPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSK
FT                   PSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPT
FT                   RDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEG
FT                   TSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRS
FT                   STLAVRVFLAPWKKGLIAVVVIGVVIATLIVAAKCYFLRKAKAKQKPVEMSRPAAPLLN
FT                   SNSEKISEPSVEANSHYGYDDVSGNDAVKPINQNKDPQNMDVEYTEVEVSSLEPHQALG
FT                   TRATETVYSEIRKVDPKNGRLP"
FT   assembly_gap    5300016..5300095
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   mRNA            complement(join(5303371..5303598,5313315..5313371,
FT                   5321134..5321196,5322603..5322656,5324443..5324516,
FT                   5325156..5325183,5325790..5325897,5326523..5326810,
FT                   5330342..5330617,5332488..5332736,5336876..5337151,
FT                   5338174..5338476,5340715..5341008,5355647..5355673,
FT                   5355764..5356139))
FT                   /gene="Pecam1"
FT                   /locus_tag="mCG_2881"
FT                   /product="platelet/endothelial cell adhesion molecule 1,
FT                   transcript variant mCT171100"
FT                   /note="gene_id=mCG2881.2 transcript_id=mCT171100.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(5303531..5303598,5313315..5313371,
FT                   5321134..5321196,5322603..5322656,5324443..5324516,
FT                   5325156..5325183,5325790..5325897,5326523..5326810,
FT                   5330342..5330617,5332488..5332736,5336876..5337151,
FT                   5338174..5338476,5340715..5341008,5355647..5355673,
FT                   5355764..5355797))
FT                   /codon_start=1
FT                   /gene="Pecam1"
FT                   /locus_tag="mCG_2881"
FT                   /product="platelet/endothelial cell adhesion molecule 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG2881.2 transcript_id=mCT171100.0
FT                   protein_id=mCP94017.0 isoform=CRA_d"
FT                   /db_xref="GOA:B1ARB3"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:97537"
FT                   /db_xref="UniProtKB/TrEMBL:B1ARB3"
FT                   /protein_id="EDL34306.1"
FT                   /translation="MLLALGLTLVLYASLQAEENSFTINSIHMESLPSWEVMNGQQLTL
FT                   ECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLN
FT                   NKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTK
FT                   FVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESF
FT                   STPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSV
FT                   MAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSG
FT                   TPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSK
FT                   PSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPT
FT                   RDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEG
FT                   TSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRS
FT                   STLAVRVFLAPWKKGLIAVVVIGVVIATLIVAAKCYFLRKAKAKQKPVEMSRPAAPLLN
FT                   SNSEKISEPSVEANSHYGYDDVSGNDAVKPINQNKDPQNMDVEYTEVEVSSLEPHQALG
FT                   TRATETVYSEIRKVDPNLMENRYSVSTHVTHTTLKMHP"
FT   assembly_gap    5304522..5304541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5311357..5311376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5335154..5335529
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    5341080..5342001
FT                   /estimated_length=922
FT                   /gap_type="unknown"
FT   assembly_gap    5343768..5343863
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    5349948..5349967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5358599..5358618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5363859..5363878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5372606..5373411
FT                   /locus_tag="mCG_1042097"
FT                   /note="gene_id=mCG1042097.0"
FT   mRNA            join(<5372606..5372778,5373005..5373411)
FT                   /locus_tag="mCG_1042097"
FT                   /product="mCG1042097"
FT                   /note="gene_id=mCG1042097.0 transcript_id=mCT159801.1
FT                   created on 17-SEP-2002"
FT   CDS             join(<5372718..5372778,5373005..5373138)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042097"
FT                   /product="mCG1042097"
FT                   /note="gene_id=mCG1042097.0 transcript_id=mCT159801.1
FT                   protein_id=mCP75499.1"
FT                   /protein_id="EDL34307.1"
FT                   /translation="FSYLSLASARIVCVCVCVCVCVCVCVCVCVCVSDSDSFGRERISL
FT                   MASVGKKRKYMIIIYFVCV"
FT   assembly_gap    5374011..5374213
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    5380358..5380377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5388623..5388642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5391881..5391900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5392283..5408085
FT                   /locus_tag="mCG_2877"
FT                   /note="gene_id=mCG2877.2"
FT   mRNA            join(<5392283..5392469,5392714..5392755,5395862..5396131,
FT                   5402286..5402399,5404915..5405007,5406281..5406343,
FT                   5408014..5408085)
FT                   /locus_tag="mCG_2877"
FT                   /product="mCG2877, transcript variant mCT1292"
FT                   /note="gene_id=mCG2877.2 transcript_id=mCT1292.2 created on
FT                   17-SEP-2002"
FT   mRNA            join(<5392283..5392469,5392714..5392755,5395862..5396131,
FT                   5404915..5405007,5406281..5406343,5408014..5408085)
FT                   /locus_tag="mCG_2877"
FT                   /product="mCG2877, transcript variant mCT173451"
FT                   /note="gene_id=mCG2877.2 transcript_id=mCT173451.0 created
FT                   on 17-SEP-2002"
FT   CDS             join(<5392283..5392469,5392714..5392755,5395862..5396131,
FT                   5402286..5402399,5404915..5405007,5406281..5406343,
FT                   5408014..5408066)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2877"
FT                   /product="mCG2877, isoform CRA_b"
FT                   /note="gene_id=mCG2877.2 transcript_id=mCT1292.2
FT                   protein_id=mCP14607.2 isoform=CRA_b"
FT                   /protein_id="EDL34309.1"
FT                   /translation="LNPLISCVWLGRGISEAEPHSVVTQLTMGDGDSPMCLSAVSFKGI
FT                   RCWLDKLLLWALTISITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKN
FT                   TSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNF
FT                   TMAKDESCPSCRLSLLLPGLLLGILVIVLVLAYLIHLKYKKGKKTQREDQSKGSGDAPA
FT                   QDELYVNACKTQTEQPQEIHYATPVFKEMAPMEEEGGTDGKADYIYSELTH"
FT   CDS             join(<5392283..5392469,5392714..5392755,5395862..5396131,
FT                   5404915..5405007,5406281..5406343,5408014..5408066)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2877"
FT                   /product="mCG2877, isoform CRA_a"
FT                   /note="gene_id=mCG2877.2 transcript_id=mCT173451.0
FT                   protein_id=mCP96370.0 isoform=CRA_a"
FT                   /protein_id="EDL34308.1"
FT                   /translation="LNPLISCVWLGRGISEAEPHSVVTQLTMGDGDSPMCLSAVSFKGI
FT                   RCWLDKLLLWALTISITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKN
FT                   TSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNF
FT                   TMARKKTQREDQSKGSGDAPAQDELYVNACKTQTEQPQEIHYATPVFKEMAPMEEEGGT
FT                   DGKADYIYSELTH"
FT   assembly_gap    5401315..5401353
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    5404753..5404772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5409266..5420935)
FT                   /gene="Polg2"
FT                   /locus_tag="mCG_2883"
FT                   /note="gene_id=mCG2883.2"
FT   mRNA            complement(join(5409266..5409533,5413705..5413805,
FT                   5414438..5414518,5414648..5414788,5416480..5416653,
FT                   5418196..5418301,5418488..5418614,5420011..5420935))
FT                   /gene="Polg2"
FT                   /locus_tag="mCG_2883"
FT                   /product="polymerase (DNA directed), gamma 2, accessory
FT                   subunit"
FT                   /note="gene_id=mCG2883.2 transcript_id=mCT1284.1 created on
FT                   25-JUL-2002"
FT   CDS             complement(join(5409368..5409533,5413705..5413805,
FT                   5414438..5414518,5414648..5414788,5416480..5416653,
FT                   5418196..5418301,5418488..5418614,5420011..5420494))
FT                   /codon_start=1
FT                   /gene="Polg2"
FT                   /locus_tag="mCG_2883"
FT                   /product="polymerase (DNA directed), gamma 2, accessory
FT                   subunit"
FT                   /note="gene_id=mCG2883.2 transcript_id=mCT1284.1
FT                   protein_id=mCP14650.0"
FT                   /db_xref="GOA:Q0VES3"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR027030"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="MGI:MGI:1354947"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VES3"
FT                   /protein_id="EDL34310.1"
FT                   /translation="MRCGGGARACRRACRCWLSGYAGPADGTQQPDAPEHAVAREALVD
FT                   LCRRRHFLSGTPQQLSTAALLSGCHARFGPLGVELRKNLASQWWSSMVVFREQVFAVDS
FT                   LHQEPGSSQPRDSAFRLVSPESIREILQDREPSKEQLVAFLENLLKTSGKLRATLLHGA
FT                   LEHYVNCLDLVNRKLPFGLAQIGVCFHPVSNSNQTPSSVTRVGEKTEASLVWFTPTRTS
FT                   SQWLDFWLRHRLLWWRKFAMSPSNFSSADCQDELGRKGSKLYYSFPWGKEPIETLWNLG
FT                   DQELLHTYPGNVSTIQGRDGRKNVVPCVLSVSGDVDLGTLAYLYDSFQLAENSFARKKS
FT                   LQRKVLKLHPCLAPIKVALDVGKGPTVELRQVCQGLLNELLENGISVWPGYSETVHSSL
FT                   EQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLASASN
FT                   V"
FT   assembly_gap    5413086..5413105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5422594..5430201)
FT                   /locus_tag="mCG_2872"
FT                   /note="gene_id=mCG2872.2"
FT   mRNA            complement(join(5422594..5423308,5423521..5423745,
FT                   5425019..5425078,5425161..5425222,5425474..5425584,
FT                   5425940..5426112,5426196..5426356,5426455..5426596,
FT                   5427127..5427192,5427286..5427419,5427508..5427604,
FT                   5427969..5428134,5429333..5429557))
FT                   /locus_tag="mCG_2872"
FT                   /product="mCG2872, transcript variant mCT1295"
FT                   /note="gene_id=mCG2872.2 transcript_id=mCT1295.2 created on
FT                   25-JUL-2002"
FT   mRNA            complement(join(5422600..5423308,5423521..5423745,
FT                   5425019..5425078,5425161..5425222,5425474..5425584,
FT                   5425940..5426112,5426196..5426356,5426455..5426596,
FT                   5427127..5427192,5427286..5427419,5427508..5427604,
FT                   5427969..5428134,5429333..5429519,5430076..5430201))
FT                   /locus_tag="mCG_2872"
FT                   /product="mCG2872, transcript variant mCT171094"
FT                   /note="gene_id=mCG2872.2 transcript_id=mCT171094.0 created
FT                   on 25-JUL-2002"
FT   mRNA            complement(join(5422600..5423308,5423521..5423745,
FT                   5425019..5425078,5425161..5425222,5425474..5425584,
FT                   5425940..5426112,5426196..5426356,5426455..5426596,
FT                   5427127..5427192,5427286..5427419,5427508..5427604,
FT                   5427969..5428134,5429333..5429519,5429759..5429928))
FT                   /locus_tag="mCG_2872"
FT                   /product="mCG2872, transcript variant mCT171092"
FT                   /note="gene_id=mCG2872.2 transcript_id=mCT171092.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(5422902..5423308,5423521..5423745,
FT                   5425019..5425078,5425161..5425222,5425474..5425584,
FT                   5425940..5426112,5426196..5426356,5426455..5426596,
FT                   5427127..5427192,5427286..5427419,5427508..5427604,
FT                   5427969..5428134,5429333..5429376))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2872"
FT                   /product="mCG2872, isoform CRA_a"
FT                   /note="gene_id=mCG2872.2 transcript_id=mCT171092.0
FT                   protein_id=mCP94010.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BTS0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012587"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:105037"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BTS0"
FT                   /protein_id="EDL34311.1"
FT                   /translation="MSSYSSDRDRGRDRGFGAPRFGGSRTGPLSGKKFGNPGEKLVKKK
FT                   WNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPAN
FT                   VMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLE
FT                   RGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICI
FT                   ATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSAT
FT                   WPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEK
FT                   ENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATD
FT                   VASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLIS
FT                   VLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRG
FT                   YSNLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQ
FT                   YGSNVANMHNGMNQQAYAYPATAAAAPMIGYPMPTGYSQ"
FT   CDS             complement(join(5422902..5423308,5423521..5423745,
FT                   5425019..5425078,5425161..5425222,5425474..5425584,
FT                   5425940..5426112,5426196..5426356,5426455..5426596,
FT                   5427127..5427192,5427286..5427419,5427508..5427604,
FT                   5427969..5428134,5429333..5429376))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2872"
FT                   /product="mCG2872, isoform CRA_a"
FT                   /note="gene_id=mCG2872.2 transcript_id=mCT171094.0
FT                   protein_id=mCP94011.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BTS0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012587"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:105037"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BTS0"
FT                   /protein_id="EDL34313.1"
FT                   /translation="MSSYSSDRDRGRDRGFGAPRFGGSRTGPLSGKKFGNPGEKLVKKK
FT                   WNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPAN
FT                   VMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLE
FT                   RGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICI
FT                   ATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSAT
FT                   WPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEK
FT                   ENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATD
FT                   VASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLIS
FT                   VLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRG
FT                   YSNLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQ
FT                   YGSNVANMHNGMNQQAYAYPATAAAAPMIGYPMPTGYSQ"
FT   CDS             complement(join(5422902..5423308,5423521..5423745,
FT                   5425019..5425078,5425161..5425222,5425474..5425584,
FT                   5425940..5426112,5426196..5426356,5426455..5426596,
FT                   5427127..5427192,5427286..5427419,5427508..5427604,
FT                   5427969..5428134,5429333..5429376))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2872"
FT                   /product="mCG2872, isoform CRA_a"
FT                   /note="gene_id=mCG2872.2 transcript_id=mCT1295.2
FT                   protein_id=mCP14619.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BTS0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012587"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:105037"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BTS0"
FT                   /protein_id="EDL34314.1"
FT                   /translation="MSSYSSDRDRGRDRGFGAPRFGGSRTGPLSGKKFGNPGEKLVKKK
FT                   WNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPAN
FT                   VMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLE
FT                   RGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICI
FT                   ATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSAT
FT                   WPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEK
FT                   ENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATD
FT                   VASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLIS
FT                   VLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRG
FT                   YSNLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQ
FT                   YGSNVANMHNGMNQQAYAYPATAAAAPMIGYPMPTGYSQ"
FT   mRNA            complement(join(5423826..5425078,5425161..5425222,
FT                   5425474..5425584,5425940..5426112,5426196..5426356,
FT                   5426455..5426596,5427127..5427192,5427286..5427419,
FT                   5427508..5427604,5427969..5428134,5429333..5429557))
FT                   /locus_tag="mCG_2872"
FT                   /product="mCG2872, transcript variant mCT171093"
FT                   /note="gene_id=mCG2872.2 transcript_id=mCT171093.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(5425014..5425078,5425161..5425222,
FT                   5425474..5425584,5425940..5426112,5426196..5426356,
FT                   5426455..5426596,5427127..5427192,5427286..5427419,
FT                   5427508..5427604,5427969..5428134,5429333..5429376))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2872"
FT                   /product="mCG2872, isoform CRA_b"
FT                   /note="gene_id=mCG2872.2 transcript_id=mCT171093.0
FT                   protein_id=mCP94012.0 isoform=CRA_b"
FT                   /db_xref="GOA:S4R1I6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:105037"
FT                   /db_xref="UniProtKB/TrEMBL:S4R1I6"
FT                   /protein_id="EDL34312.1"
FT                   /translation="MSSYSSDRDRGRDRGFGAPRFGGSRTGPLSGKKFGNPGEKLVKKK
FT                   WNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPAN
FT                   VMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLE
FT                   RGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICI
FT                   ATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSAT
FT                   WPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEK
FT                   ENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATD
FT                   VASRGLG"
FT   gene            5430314..5460111
FT                   /gene="Ccdc45"
FT                   /locus_tag="mCG_121869"
FT                   /note="gene_id=mCG121869.0"
FT   mRNA            join(5430314..5430437,5431793..5431921,5433563..5433670,
FT                   5437219..5437329,5441140..5441239,5442559..5442674,
FT                   5446089..5446217,5447332..5447525,5450289..5450398,
FT                   5450725..5450854,5452424..5452577,5453624..5453763,
FT                   5455013..5455114,5455856..5455988,5456720..5456889,
FT                   5456986..5457060,5457905..5458057,5459086..5459232,
FT                   5459448..5459519,5459786..5460111)
FT                   /gene="Ccdc45"
FT                   /locus_tag="mCG_121869"
FT                   /product="coiled-coil domain containing 45"
FT                   /note="gene_id=mCG121869.0 transcript_id=mCT123082.1
FT                   created on 17-SEP-2002"
FT   CDS             join(5430419..5430437,5431793..5431921,5433563..5433670,
FT                   5437219..5437329,5441140..5441239,5442559..5442674,
FT                   5446089..5446217,5447332..5447525,5450289..5450398,
FT                   5450725..5450854,5452424..5452577,5453624..5453763,
FT                   5455013..5455114,5455856..5455988,5456720..5456889,
FT                   5456986..5457060,5457905..5458057,5459086..5459232,
FT                   5459448..5459519,5459786..5459977)
FT                   /codon_start=1
FT                   /gene="Ccdc45"
FT                   /locus_tag="mCG_121869"
FT                   /product="coiled-coil domain containing 45"
FT                   /note="gene_id=mCG121869.0 transcript_id=mCT123082.1
FT                   protein_id=mCP75466.1"
FT                   /db_xref="GOA:Q8BVV7"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR026619"
FT                   /db_xref="MGI:MGI:2443502"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BVV7"
FT                   /protein_id="EDL34315.1"
FT                   /translation="MASSEAEWVTIANNLLFKCHIHLRIHELQDCDANVFIALYQSILG
FT                   EKVPDLIVLPRNQEDEAHNVQAVIDSLALDYLQVSLSHITGENIVKGDNESIRNLLEIF
FT                   DGLLDYLTEHISESSPNKSETEQYSKDSHGEEAGEDLERTEEAKWRNASFMRCSFSSDT
FT                   LGPTWDEDEAESTGEIIRLGDTAHTFSQRSNGAQNSKDLRSRKASASPGVEPPEEMLNP
FT                   GPLGFLSQNGPPCEAASETPPMSMVPSARKLGEPIRAAIPLHPPYHPSEPRAPCPIGKE
FT                   YLWSSRYLSTPTSGEHMAPSVEPDDAFLTSTLFKDDDQETYLPKPEATRTRKPSKGERD
FT                   ENRAAIPSEHLPFSQKARKPLTEQELHAMSEKLSQRLSELDWMLKTALGDRGTGETDGN
FT                   DGDGGGEEVRSGNEEMLSQHSDSVMEYGPKKPRPGFSTCRKAPYRSHSLSPSSVNKHRQ
FT                   LEKEKKRQHKSKGTDSCHFQAKALTEAFERELRKHKVQENVGLRGIREEEEEEEETGKS
FT                   YREVVPKGTSKRSQVQKTYSRKTAAPSPKGDGRLKSSKASPMKVSEHSLLSLMLEQFPF
FT                   LYVSDPTLTKMWKQQMAQVEQLKREAQRENRSKKKLQDEIEEALRRHDLLTALVKKEYD
FT                   HNKRLQDFRDRIQRQRLTQSKIKENRHQSVRARKYYDDYRVQLRAKMMKMRTREEMIFK
FT                   KLFEEGLQIQKQRLRDLRNYAKEKRNEEKRQHQNELDSMENHYKDQFSLLAEAISQERQ
FT                   ELKVRQKFQAQTLHKVKRELRAKMEKEIQQLQHMITQNDDDAFFRELEAERFKARLQLA
FT                   SFQYSKNPFPRGQTS"
FT   assembly_gap    5451252..5451271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5461309..5561554)
FT                   /gene="Smurf2"
FT                   /locus_tag="mCG_2870"
FT                   /note="gene_id=mCG2870.1"
FT   mRNA            complement(join(5461309..5464016,5464272..5464347,
FT                   5465861..5466062,5469756..5469876,5472174..5472311,
FT                   5474999..5475177,5477326..5477440,5480445..5480548,
FT                   5482859..5483054,5487242..5487400,5491017..5491101,
FT                   5493717..5493919,5497447..5497530,5500978..5501062,
FT                   5505980..5506045,5509807..5509940,5512784..5512892,
FT                   5517183..5517221,5561476..5561554))
FT                   /gene="Smurf2"
FT                   /locus_tag="mCG_2870"
FT                   /product="SMAD specific E3 ubiquitin protein ligase 2"
FT                   /note="gene_id=mCG2870.1 transcript_id=mCT1296.2 created on
FT                   17-SEP-2002"
FT   CDS             complement(join(5463917..5464016,5464272..5464347,
FT                   5465861..5466062,5469756..5469876,5472174..5472311,
FT                   5474999..5475177,5477326..5477440,5480445..5480548,
FT                   5482859..5483054,5487242..5487400,5491017..5491101,
FT                   5493717..5493919,5497447..5497530,5500978..5501062,
FT                   5505980..5506045,5509807..5509940,5512784..5512892,
FT                   5517183..5517221,5561476..5561527))
FT                   /codon_start=1
FT                   /gene="Smurf2"
FT                   /locus_tag="mCG_2870"
FT                   /product="SMAD specific E3 ubiquitin protein ligase 2"
FT                   /note="gene_id=mCG2870.1 transcript_id=mCT1296.2
FT                   protein_id=mCP14646.2"
FT                   /db_xref="GOA:A2A5Z6"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="MGI:MGI:1913563"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2A5Z6"
FT                   /protein_id="EDL34316.1"
FT                   /translation="MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSG
FT                   QCHSTDTVKNTLDPKWNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAI
FT                   NRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGW
FT                   EERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENTPITGTNGATCGH
FT                   SSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHD
FT                   PRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNR
FT                   QNQLKDQQQQQVVPLCPDDTECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSR
FT                   EEIFEESYRQVMKMRPKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQ
FT                   YSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSI
FT                   TLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVTEE
FT                   NKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVS
FT                   DWKVNTRLKHCTPDSNVVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAG
FT                   PRLFTIHQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGFAVE"
FT   assembly_gap    5550198..5550326
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    5561693..5562296
FT                   /estimated_length=604
FT                   /gap_type="unknown"
FT   assembly_gap    5585895..5588868
FT                   /estimated_length=2974
FT                   /gap_type="unknown"
FT   assembly_gap    5590239..5591365
FT                   /estimated_length=1127
FT                   /gap_type="unknown"
FT   assembly_gap    5596183..5596202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5602186..5602205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5604178..5604554
FT                   /estimated_length=377
FT                   /gap_type="unknown"
FT   gene            complement(5629647..5643138)
FT                   /locus_tag="mCG_2886"
FT                   /note="gene_id=mCG2886.2"
FT   mRNA            complement(join(5629647..5629983,5630328..5630477,
FT                   5631192..5631374,5631642..5631875,5632072..5632335,
FT                   5632416..5632510,5632861..5633129,5633583..5633671,
FT                   5637439..5637576,5638168..5638265,5642972..5643138))
FT                   /locus_tag="mCG_2886"
FT                   /product="mCG2886, transcript variant mCT1279"
FT                   /note="gene_id=mCG2886.2 transcript_id=mCT1279.1 created on
FT                   17-SEP-2002"
FT   mRNA            complement(join(5629647..5629983,5630328..5630477,
FT                   5631192..5631374,5631642..5631875,5632072..5632335,
FT                   5632416..5632510,5632861..5633129,5633583..5633671,
FT                   5637439..5637576,5638168..5638265,5642359..5642392))
FT                   /locus_tag="mCG_2886"
FT                   /product="mCG2886, transcript variant mCT173452"
FT                   /note="gene_id=mCG2886.2 transcript_id=mCT173452.0 created
FT                   on 17-SEP-2002"
FT   mRNA            complement(join(5629647..5629983,5630328..5630477,
FT                   5631192..5631374,5631642..5631875,5632072..5632335,
FT                   5632416..5632510,5632861..5633129,5633583..5633671,
FT                   5637439..5637576,5638168..5638265,5639308..5639432))
FT                   /locus_tag="mCG_2886"
FT                   /product="mCG2886, transcript variant mCT173453"
FT                   /note="gene_id=mCG2886.2 transcript_id=mCT173453.0 created
FT                   on 17-SEP-2002"
FT   CDS             complement(join(5629891..5629983,5630328..5630477,
FT                   5631192..5631374,5631642..5631875,5632072..5632335,
FT                   5632416..5632510,5632861..5633129,5633583..5633671,
FT                   5637439..5637576,5638168..5638242))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2886"
FT                   /product="mCG2886, isoform CRA_a"
FT                   /note="gene_id=mCG2886.2 transcript_id=mCT1279.1
FT                   protein_id=mCP14668.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q52L97"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024931"
FT                   /db_xref="InterPro:IPR032413"
FT                   /db_xref="MGI:MGI:103561"
FT                   /db_xref="MGI:MGI:3704480"
FT                   /db_xref="UniProtKB/TrEMBL:Q52L97"
FT                   /protein_id="EDL34317.1"
FT                   /translation="MSTNENANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDE
FT                   QMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLL
FT                   SREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGA
FT                   IPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLA
FT                   CGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDG
FT                   PNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVF
FT                   PSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAW
FT                   AITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETE
FT                   KLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAF
FT                   QVQDGAPGTFNF"
FT   CDS             complement(join(5629891..5629983,5630328..5630477,
FT                   5631192..5631374,5631642..5631875,5632072..5632335,
FT                   5632416..5632510,5632861..5633129,5633583..5633671,
FT                   5637439..5637576,5638168..5638242))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2886"
FT                   /product="mCG2886, isoform CRA_a"
FT                   /note="gene_id=mCG2886.2 transcript_id=mCT173452.0
FT                   protein_id=mCP96371.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q52L97"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024931"
FT                   /db_xref="InterPro:IPR032413"
FT                   /db_xref="MGI:MGI:103561"
FT                   /db_xref="MGI:MGI:3704480"
FT                   /db_xref="UniProtKB/TrEMBL:Q52L97"
FT                   /protein_id="EDL34318.1"
FT                   /translation="MSTNENANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDE
FT                   QMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLL
FT                   SREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGA
FT                   IPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLA
FT                   CGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDG
FT                   PNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVF
FT                   PSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAW
FT                   AITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETE
FT                   KLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAF
FT                   QVQDGAPGTFNF"
FT   CDS             complement(join(5629891..5629983,5630328..5630477,
FT                   5631192..5631374,5631642..5631875,5632072..5632335,
FT                   5632416..5632510,5632861..5633129,5633583..5633671,
FT                   5637439..5637576,5638168..5638242))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2886"
FT                   /product="mCG2886, isoform CRA_a"
FT                   /note="gene_id=mCG2886.2 transcript_id=mCT173453.0
FT                   protein_id=mCP96372.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q52L97"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024931"
FT                   /db_xref="InterPro:IPR032413"
FT                   /db_xref="MGI:MGI:103561"
FT                   /db_xref="MGI:MGI:3704480"
FT                   /db_xref="UniProtKB/TrEMBL:Q52L97"
FT                   /protein_id="EDL34319.1"
FT                   /translation="MSTNENANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDE
FT                   QMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLL
FT                   SREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGA
FT                   IPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLA
FT                   CGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDG
FT                   PNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVF
FT                   PSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAW
FT                   AITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETE
FT                   KLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAF
FT                   QVQDGAPGTFNF"
FT   assembly_gap    5639517..5641296
FT                   /estimated_length=1780
FT                   /gap_type="unknown"
FT   gene            5671430..5673751
FT                   /locus_tag="mCG_3215"
FT                   /note="gene_id=mCG3215.2"
FT   mRNA            join(5671430..5671580,5671675..5671869,5672897..5673751)
FT                   /locus_tag="mCG_3215"
FT                   /product="mCG3215"
FT                   /note="gene_id=mCG3215.2 transcript_id=mCT1302.2 created on
FT                   17-SEP-2002"
FT   CDS             join(5671722..5671869,5672897..5673087)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3215"
FT                   /product="mCG3215"
FT                   /note="gene_id=mCG3215.2 transcript_id=mCT1302.2
FT                   protein_id=mCP14630.2"
FT                   /protein_id="EDL34320.1"
FT                   /translation="MRLVTLLVDPDGLYKMSRLYITPDGFFFRVHILALDSSSCHKPCP
FT                   EFKPGSRYIVMGHIYHKRRQLPSALLQVLRGRLRPGDGLIRGSSSYVKRFNRKREWQVR
FT                   GATHTQCI"
FT   gene            complement(5677421..5775438)
FT                   /locus_tag="mCG_3307"
FT                   /note="gene_id=mCG3307.2"
FT   mRNA            complement(join(5677421..5679902,5683538..5683724,
FT                   5685987..5686071,5686936..5687128,5690303..5690646,
FT                   5695062..5695287,5695496..5695578,5697128..5697591,
FT                   5698145..5698379,5700907..5701124,5702745..5702853,
FT                   5703957..5704108,5704323..5704484,5704809..5705055,
FT                   5707940..5707982,5708218..5708368,5709399..5709527,
FT                   5710547..5710671,5714955..5717262,5718794..5718973,
FT                   5719932..5720070,5720794..5720923,5722997..5723128,
FT                   5723490..5723845,5724787..5724974,5728986..5729171,
FT                   5737264..5737452,5737978..5738187,5741829..5742052,
FT                   5754549..5755371,5775156..5775438))
FT                   /locus_tag="mCG_3307"
FT                   /product="mCG3307"
FT                   /note="gene_id=mCG3307.2 transcript_id=mCT2354.2 created on
FT                   17-SEP-2002"
FT   CDS             complement(join(5679896..5679902,5683538..5683724,
FT                   5685987..5686071,5686936..5687128,5690303..5690646,
FT                   5695062..5695287,5695496..5695578,5697128..5697591,
FT                   5698145..5698379,5700907..5701124,5702745..5702853,
FT                   5703957..5704108,5704323..5704484,5704809..5705055,
FT                   5707940..5707982,5708218..5708368,5709399..5709527,
FT                   5710547..5710671,5714955..5717262,5718794..5718973,
FT                   5719932..5720070,5720794..5720923,5722997..5723128,
FT                   5723490..5723845,5724787..5724974,5728986..5729171,
FT                   5737264..5737452,5737978..5738187,5741829..5742052,
FT                   5754549..5755371,5775156..5775357))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3307"
FT                   /product="mCG3307"
FT                   /note="gene_id=mCG3307.2 transcript_id=mCT2354.2
FT                   protein_id=mCP14648.2"
FT                   /protein_id="EDL34321.1"
FT                   /translation="MVSEEDEEEEEDGDAEETQDSEDEEEDDMEEDDDDSDYPEEMEDD
FT                   DDDASYCTESSFRSHSTYSSTPGRRKPRVHRPRSPILEEKDIPPLEFPKSSEDLMVPNE
FT                   HIMNVIAIYEVVRNFGNVLRLSPFCFEDFCAALVSQEQCTLMAEMHVALLKAVLREEDT
FT                   SNTTFGPADLKDSVNSTLYFIDGMTWPEVLRVYCESDKEYHHVLPYQEAEDYPYGPVEN
FT                   KIKVLQFLVDQFLTTNIAREELMSEGVIQYDDHCRVCHKLGDLLCCETCSAVYHLECVK
FT                   PPLEEVPEDEWQCEVCVAHKVPGVTDCVAEVQKNKPYVRHEPIGYDRSRRKYWFLNRRL
FT                   IIEEDTDNENEKKVWYYSTKVQLAELIDCLDKGYWEAELCRVLEDIREEMQQHMDVTED
FT                   LTNKARGSNKSFLAAANEEILDSLRIKRGEDIDCDQSPEDPEKDKHEGENNSSKDAEKS
FT                   REEAEDPSADKDADSKGLEEEPGHGKPEEPTEVGDKGNSVPANLGDNTTNASPEETSPC
FT                   DGRSPEGCLSETHDSSSMAEKKVASELPPDVPEDSNRTCDSSNTSATTASSQPNLETCS
FT                   SSELTSSQSDSAKAADDPEIGERDSHTPVSVHEEIGDFRLEKSNGEVSESPGAGKGTSG
FT                   STRIITRLRNPESKLSQLKSQQVAAAAHEANKLFKEGKEVLVVNSQGEVSRLSTKKEVV
FT                   MKGNINNYFKLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFK
FT                   WNGSVHGSKVLTISTLRLTITQLESNIPSSFLHPNWASHRANWIKAVQMCSKPREFALA
FT                   LAILECAVKPVVMLPIWRESLGHTRLHRMTSIEREEKEKVKKKEKKQEEEETMQQATWV
FT                   KYTFPVKHQVWKQKGEEYRVTGYGGWSWISKTHVYRFLPKLPGNTNVNYRKPLDGAKNN
FT                   TDENKDESEKRKSPRSPKKMKTECDSEQGETRDADATAGAAAGAMELSKEPEKKDQDVK
FT                   ELLDSDNDKSFKEEPMEIDDTIKTESHVSSLESTEVDVVNVSEGFHLRTSYKKKTKSSK
FT                   LDGLLERRIRQFTLEEKQRLEKLKLESGVKGAGKPPMGALKSSSESPGSTKASEGHQGD
FT                   SLRQEQSPSSSQASTVDLGLGGSQSDPLVLGISPPSLSTHKPDPKDQVLDDVSIQSPGP
FT                   NCQRQNSVESDLDARISEPAGKGLELSQTKTEVTDSSSDDSKPTSADDVGILICKSRKL
FT                   HSQDDSSTVVSSSKSTLPASVPKSPRDRDARAFSKAVDFDGRLGGDSEYSSTLENSSDN
FT                   MCIRDSAEEDMVVQNSSEATSKRFIAPEQGGESVESTKCQVVSKSTENCEDKLQGKVTE
FT                   ANGKKLGQHPPKPEERAVNRCTDQVSLRHSVDRKNSEPRESEKKGQKANKFQINGKDSK
FT                   AKGYLKGPGTKDGSDGKVVSSAVEPKVNNINKVIPGNTKSLAGKESAAKPFINGDIIME
FT                   ELSEQNTSETNSYSLSSSDAKGNHQDGLHTLPSTKESASTQVITPRAPCPDRNSLSQVE
FT                   DMETESPEVKRVIPSPVRTGEGSNLSKGFMDDNGLPSSKDENVNGESQRKTVITEVTTM
FT                   TSTVATESKTVIKVAKGDKQTVVSSTENCARSTVTTTTTTVTKLSTPSPDTGVDTISVK
FT                   EQSKTVVTTTVTDSLTTAGSTLVTSMTVSKEYSTRDRVKLMKFSRPKKTRSGTALPSYR
FT                   KFVTKSSKKSIFVLPNDDLKKLARKGGIREVPYFNYNAKPALDIWPYPSPRPTFGITWR
FT                   YRLQTVKSLAGVSLMLRLLWASLRWDDMAAKAPPGGGSTRTETSETEITTTEIIKRRDV
FT                   GPYGIRSEYCIRKIICPIGVPEAPKETPTPQRKGLRSSALRPKRPETPKQTGPVIIESW
FT                   VAEEELELWEIRAFAERVEKEKAQAAEQQTKKRLEQQKPAVIAASTTSPANNTSSTVSP
FT                   AQKVMVAPLSGSVTPGTKMVLATKVGSPATVTFQQNKNFHQTFATWVKQGQSNSATSTA
FT                   ATSATTIASTGQTFQITGSPVTMAGKVITKLPLPANSKIVAVNVPATQGGMVQVQQKVL
FT                   GIIPSTTGPSQQTFTSFQPRTATVTIRPNTSASAGTTTTSQVITGPQIRPGMTVIRTPL
FT                   QQPALGKAIIRTPVVVQPGTPQQVVTQIIRGQPVSTAISAPSTASSAPVQKGLTPGAAA
FT                   GPLQPSAPHSPRPQQGQVKLTMAQLTQLTQGHGGNQGLTVVIQGQGQTTGQLQLIPQGM
FT                   TVLPGPGQQLMQAAMPNGTVQRFLFTPLSTSATAASSSSNSSSTTTNATAAGSGEQKQS
FT                   KILPQTQVQPATTLAPTQSSSVSPAEAQPQPAQPAAQPQPQPQPPAQPEVQTQPAVSSH
FT                   VPSETQPSQAQTSKPLVATQCQPQSSVQGQSPVRVQSPPLTRICPSTPSQVTPGQQPQV
FT                   QTTASQPIPIPPPTSLQAPSQGQPQSQPQVVMKHNAVIEHLKQKKTMTPAEREENQRMI
FT                   VCNQVMKYILDKIDKEEKQAAKKRKREESVEQKRSKQNASKLSALLFKHKEQLKAEILR
FT                   KRALLDKELQIQVQEELKRDLKMKREREMAQAVQANAASVPTPSVPAPVPAPAPAAPPA
FT                   PPRSPPPSTHSLPPAGHPTAPLPVTSQKRKREEEKDSKSKKKKMISTTSKEAKKDTRLY
FT                   CICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEADLIDEYVCPQCQSTEDAMTVLTPL
FT                   TEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERIQKRYYE
FT                   KLTEFVADMTKIFDNCRYYNPRDTPFYQCAEVLESFFVQKLKGFKASRL"
FT   assembly_gap    5744960..5745294
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    5760436..5760455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5775644..5776031
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   assembly_gap    5782158..5782476
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    5787298..5787317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5793509..5794900
FT                   /estimated_length=1392
FT                   /gap_type="unknown"
FT   assembly_gap    5803704..5803723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5806737..5806891
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   gene            complement(5807486..5831147)
FT                   /gene="Nol11"
FT                   /locus_tag="mCG_3304"
FT                   /note="gene_id=mCG3304.2"
FT   mRNA            complement(join(5807486..5808782,5809423..5809530,
FT                   5812865..5812957,5813388..5813466,5814985..5815236,
FT                   5815379..5815504,5817341..5817522,5818558..5818632,
FT                   5820351..5820436,5820744..5820867,5821817..5821893,
FT                   5822688..5822876,5823514..5823658,5825348..5825405,
FT                   5826515..5826663,5828410..5828466,5828584..5828697,
FT                   5830892..5831147))
FT                   /gene="Nol11"
FT                   /locus_tag="mCG_3304"
FT                   /product="nucleolar protein 11, transcript variant mCT2357"
FT                   /note="gene_id=mCG3304.2 transcript_id=mCT2357.2 created on
FT                   25-JUL-2002"
FT   mRNA            complement(join(5807487..5808782,5809423..5809530,
FT                   5812865..5812957,5813388..5813466,5814985..5815176,
FT                   5815379..5815504,5817341..5817522,5818558..5818632,
FT                   5820351..5820436,5820744..5820867,5821817..5821893,
FT                   5822688..5822876,5823514..5823658,5825348..5825405,
FT                   5826515..5826663,5828410..5828466,5828584..5828697,
FT                   5830892..5831147))
FT                   /gene="Nol11"
FT                   /locus_tag="mCG_3304"
FT                   /product="nucleolar protein 11, transcript variant
FT                   mCT171103"
FT                   /note="gene_id=mCG3304.2 transcript_id=mCT171103.0 created
FT                   on 25-JUL-2002"
FT   CDS             complement(join(5808666..5808782,5809423..5809530,
FT                   5812865..5812957,5813388..5813466,5814985..5815176,
FT                   5815379..5815504,5817341..5817522,5818558..5818632,
FT                   5820351..5820436,5820744..5820867,5821817..5821893,
FT                   5822688..5822876,5823514..5823658,5825348..5825405,
FT                   5826515..5826663,5828410..5828466,5828584..5828697,
FT                   5830892..5831032))
FT                   /codon_start=1
FT                   /gene="Nol11"
FT                   /locus_tag="mCG_3304"
FT                   /product="nucleolar protein 11, isoform CRA_a"
FT                   /note="gene_id=mCG3304.2 transcript_id=mCT171103.0
FT                   protein_id=mCP94021.0 isoform=CRA_a"
FT                   /protein_id="EDL34322.1"
FT                   /translation="MATLEEEFTLSTGVLGAGPEGFLGVEQTDKADQFLVTDSGRTVVL
FT                   YKVSDQKPLGSWSVKQGQSITCPAVCNFQTGEYIMVHDHKVLRIWNNDDVNVDKVFKAT
FT                   LSAEVHRIHSVQRTEPLVLFRGGAARGLEALLVEPQQNIESVIPDEEVIVWSEVFMLFK
FT                   QPVLIFITENHGHYYAYVRLCKSHSLSKYTLLLEKEEKSVKPNFTARVDGKFISLVSLS
FT                   SDGCIYETLIPIYSSDTEQNQRLVRALMLKSVVSGGVRNGVALTILDQDHIAVLGPPLS
FT                   ASKECLSIWNIKFQTLQTSKELPQGTSGQLWYHGEVLFMLHGKSLTVIPYKCEESSLAG
FT                   ALGKLKHTQESGTHSVPHFVNWETCSGYELGSSGAEQSRTLRRKKVETNLQPEVPGFKQ
FT                   LLSIIKKDSEKHIEVELRKFLAKSTPAFHTIIGDLVAGLVGRCKAEPSFYPRNCLTQLI
FT                   QTHVLSYSLCPDLMEIALEHTDVQMLQLCLQQFPDIPESTTCACLKLFLSDSTQDEKKE
FT                   MEEQIEIVQNGFGPEDGNCSEDSQQLNDKPADTAHEPGSFPVTSCPVAPKRAALLNAVL
FT                   HSAYSEPFLLPHLKDIPAKHVTLFLQYLYFLYLKCTGSATMTLPGVNPPTVSQIMDWIC
FT                   LLLDANFTVLLMIPEAKRLLLILYNFVKSQISIYSELNKIAVSFRELQRLNREKSSRGL
FT                   YSIEVLELF"
FT   CDS             complement(join(5808666..5808782,5809423..5809530,
FT                   5812865..5812957,5813388..5813466,5814985..5815236,
FT                   5815379..5815504,5817341..5817522,5818558..5818632,
FT                   5820351..5820436,5820744..5820867,5821817..5821893,
FT                   5822688..5822876,5823514..5823658,5825348..5825405,
FT                   5826515..5826663,5828410..5828466,5828584..5828697,
FT                   5830892..5831032))
FT                   /codon_start=1
FT                   /gene="Nol11"
FT                   /locus_tag="mCG_3304"
FT                   /product="nucleolar protein 11, isoform CRA_b"
FT                   /note="gene_id=mCG3304.2 transcript_id=mCT2357.2
FT                   protein_id=mCP14628.2 isoform=CRA_b"
FT                   /protein_id="EDL34323.1"
FT                   /translation="MATLEEEFTLSTGVLGAGPEGFLGVEQTDKADQFLVTDSGRTVVL
FT                   YKVSDQKPLGSWSVKQGQSITCPAVCNFQTGEYIMVHDHKVLRIWNNDDVNVDKVFKAT
FT                   LSAEVHRIHSVQRTEPLVLFRGGAARGLEALLVEPQQNIESVIPDEEVIVWSEVFMLFK
FT                   QPVLIFITENHGHYYAYVRLCKSHSLSKYTLLLEKEEKSVKPNFTARVDGKFISLVSLS
FT                   SDGCIYETLIPIYSSDTEQNQRLVRALMLKSVVSGGVRNGVALTILDQDHIAVLGPPLS
FT                   ASKECLSIWNIKFQTLQTSKELPQGTSGQLWYHGEVLFMLHGKSLTVIPYKCEESSLAG
FT                   ALGKLKHTQESGTHSVPHFVNWETCSGYELGSSGAEQSRTLRRKKVETNLQPEVPGFKQ
FT                   LLSIIKKDSEKHIEVELRKFLAKSTPAFHTIIGDLVAGLVGRCKAEPSFYPRNCLTQLI
FT                   QTHVLSYSLCPDLMEIALEHTDVQMLQLCLQQFPDIPESTTCACLKLFLSVGDDCLRDS
FT                   NINMESVFDYSDSTQDEKKEMEEQIEIVQNGFGPEDGNCSEDSQQLNDKPADTAHEPGS
FT                   FPVTSCPVAPKRAALLNAVLHSAYSEPFLLPHLKDIPAKHVTLFLQYLYFLYLKCTGSA
FT                   TMTLPGVNPPTVSQIMDWICLLLDANFTVLLMIPEAKRLLLILYNFVKSQISIYSELNK
FT                   IAVSFRELQRLNREKSSRGLYSIEVLELF"
FT   assembly_gap    5811780..5811799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5835888..5835917
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    5839513..5839532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5843139..5846868
FT                   /locus_tag="mCG_1042098"
FT                   /note="gene_id=mCG1042098.0"
FT   mRNA            join(5843139..5843200,5846194..5846395,5846666..5846868)
FT                   /locus_tag="mCG_1042098"
FT                   /product="mCG1042098"
FT                   /note="gene_id=mCG1042098.0 transcript_id=mCT159802.1
FT                   created on 17-SEP-2002"
FT   CDS             join(5843164..5843200,5846194..5846330)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042098"
FT                   /product="mCG1042098"
FT                   /note="gene_id=mCG1042098.0 transcript_id=mCT159802.1
FT                   protein_id=mCP75510.1"
FT                   /protein_id="EDL34324.1"
FT                   /translation="MLSKGNKKDKDTGTPLQVQAGHGQLPSVMNYDMLLPERNPLLPKL
FT                   FLVSTLDSLMST"
FT   assembly_gap    5847446..5847517
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   gene            complement(5848878..6115023)
FT                   /gene="Pitpnc1"
FT                   /locus_tag="mCG_3303"
FT                   /note="gene_id=mCG3303.3"
FT   mRNA            complement(join(5848878..5853643,5867202..5867265,
FT                   5875330..5875485,5893367..5893462,5936923..5936994,
FT                   5965268..5965275,5966062..5966150,5981880..5982028,
FT                   6114212..6114900))
FT                   /gene="Pitpnc1"
FT                   /locus_tag="mCG_3303"
FT                   /product="phosphatidylinositol transfer protein,
FT                   cytoplasmic 1, transcript variant mCT2358"
FT                   /note="gene_id=mCG3303.3 transcript_id=mCT2358.2 created on
FT                   02-APR-2003"
FT   mRNA            complement(join(5848879..5853643,5857663..5857781,
FT                   5867202..5867265,5875330..5875485,5893367..5893462,
FT                   5936923..5936994,5965268..5965275,5966062..5966150,
FT                   5981880..5982028,5992610..5992652))
FT                   /gene="Pitpnc1"
FT                   /locus_tag="mCG_3303"
FT                   /product="phosphatidylinositol transfer protein,
FT                   cytoplasmic 1, transcript variant mCT173454"
FT                   /note="gene_id=mCG3303.3 transcript_id=mCT173454.0 created
FT                   on 02-APR-2003"
FT   mRNA            complement(join(5853105..5853643,5857663..5857781,
FT                   5867202..5867265,5875330..5875485,5893367..5893462,
FT                   5936923..5936994,5966058..5966150,5981880..5982028,
FT                   6114212..6115023))
FT                   /gene="Pitpnc1"
FT                   /locus_tag="mCG_3303"
FT                   /product="phosphatidylinositol transfer protein,
FT                   cytoplasmic 1, transcript variant mCT181691"
FT                   /note="gene_id=mCG3303.3 transcript_id=mCT181691.0 created
FT                   on 02-APR-2003"
FT   mRNA            complement(join(5853297..5853643,5867202..5867265,
FT                   5875330..5875485,5893367..5893462,5936923..5936994,
FT                   5966058..5966150,5981880..5982028,6114212..6114319))
FT                   /gene="Pitpnc1"
FT                   /locus_tag="mCG_3303"
FT                   /product="phosphatidylinositol transfer protein,
FT                   cytoplasmic 1, transcript variant mCT181692"
FT                   /note="gene_id=mCG3303.3 transcript_id=mCT181692.0 created
FT                   on 02-APR-2003"
FT   CDS             complement(join(5853327..5853643,5867202..5867265,
FT                   5875330..5875485,5893367..5893462,5936923..5936994,
FT                   5965268..5965275,5966062..5966150,5981880..5982028,
FT                   6114212..6114259))
FT                   /codon_start=1
FT                   /gene="Pitpnc1"
FT                   /locus_tag="mCG_3303"
FT                   /product="phosphatidylinositol transfer protein,
FT                   cytoplasmic 1, isoform CRA_c"
FT                   /note="gene_id=mCG3303.3 transcript_id=mCT2358.2
FT                   protein_id=mCP14605.1 isoform=CRA_c"
FT                   /protein_id="EDL34328.1"
FT                   /translation="MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNE
FT                   PFEDPHHGNGQFTEKRVYLNSKLPSWARAVVPKIFYVTEKAWNYYPYTITEYTCSFLPK
FT                   FSIHIETKYEDNKGSNDSIFDSEAKDLEREVCFIDIACDEIPERYYKESEDPKHFKSEK
FT                   TGRGQLREGWRDNHQPIMCSYKLVTVKFEVWGLQTRVEQFVHKVVRDILLIGHRQAFAW
FT                   VDEWYDMTMDEVREFERATQEATNKKIGVFPPAISISSIALLPSSVRSAPSSAPSTPLS
FT                   TDAPEFLSIPKDRPRKKSAPETLTLPDPEKKATLNLPGVYTSEKPCRPKSE"
FT   CDS             complement(join(5853638..5853643,5857663..5857781,
FT                   5867202..5867265,5875330..5875485,5893367..5893462,
FT                   5936923..5936994,5965268..5965275,5966062..5966150,
FT                   5981880..5982007))
FT                   /codon_start=1
FT                   /gene="Pitpnc1"
FT                   /locus_tag="mCG_3303"
FT                   /product="phosphatidylinositol transfer protein,
FT                   cytoplasmic 1, isoform CRA_a"
FT                   /note="gene_id=mCG3303.3 transcript_id=mCT173454.0
FT                   protein_id=mCP96373.0 isoform=CRA_a"
FT                   /protein_id="EDL34325.1"
FT                   /translation="MISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRVYLNSKL
FT                   PSWARAVVPKIFYVTEKAWNYYPYTITEYTCSFLPKFSIHIETKYEDNKGSNDSIFDSE
FT                   AKDLEREVCFIDIACDEIPERYYKESEDPKHFKSEKTGRGQLREGWRDNHQPIMCSYKL
FT                   VTVKFEVWGLQTRVEQFVHKVVRDILLIGHRQAFAWVDEWYDMTMDDVREYEKNMHEQT
FT                   NIKVCNQHSSTVDDIESHAQTST"
FT   assembly_gap    5887411..5887430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5889338..5889919
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    5893618..5893637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5921488..5922880
FT                   /estimated_length=1393
FT                   /gap_type="unknown"
FT   CDS             complement(join(5936961..5936994,5966058..5966150,
FT                   5981880..5982028,6114212..6114259))
FT                   /codon_start=1
FT                   /gene="Pitpnc1"
FT                   /locus_tag="mCG_3303"
FT                   /product="phosphatidylinositol transfer protein,
FT                   cytoplasmic 1, isoform CRA_b"
FT                   /note="gene_id=mCG3303.3 transcript_id=mCT181691.0
FT                   protein_id=mCP104614.0 isoform=CRA_b"
FT                   /protein_id="EDL34326.1"
FT                   /translation="MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNE
FT                   PFEDPHHGNGQFTEKRVYLNSKLPSWARAVVPKIFYVTEKAWNYYPYTITGNVPSCRNS
FT                   PST"
FT   CDS             complement(join(5936961..5936994,5966058..5966150,
FT                   5981880..5982028,6114212..6114259))
FT                   /codon_start=1
FT                   /gene="Pitpnc1"
FT                   /locus_tag="mCG_3303"
FT                   /product="phosphatidylinositol transfer protein,
FT                   cytoplasmic 1, isoform CRA_b"
FT                   /note="gene_id=mCG3303.3 transcript_id=mCT181692.0
FT                   protein_id=mCP104613.0 isoform=CRA_b"
FT                   /protein_id="EDL34327.1"
FT                   /translation="MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNE
FT                   PFEDPHHGNGQFTEKRVYLNSKLPSWARAVVPKIFYVTEKAWNYYPYTITGNVPSCRNS
FT                   PST"
FT   assembly_gap    5937560..5937960
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   assembly_gap    5947700..5947719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5975162..>5975526
FT                   /locus_tag="mCG_54371"
FT                   /note="gene_id=mCG54371.2"
FT   mRNA            <5975162..>5975526
FT                   /locus_tag="mCG_54371"
FT                   /product="mCG54371"
FT                   /note="gene_id=mCG54371.2 transcript_id=mCT54554.2 created
FT                   on 17-SEP-2002"
FT   CDS             <5975164..5975526
FT                   /codon_start=1
FT                   /locus_tag="mCG_54371"
FT                   /product="mCG54371"
FT                   /note="gene_id=mCG54371.2 transcript_id=mCT54554.2
FT                   protein_id=mCP35706.2"
FT                   /protein_id="EDL34329.1"
FT                   /translation="LAEWPTKKGVEKKKGHSAINDVVTRDNTINIHKSIHGAGFKKHDP
FT                   RALKDIRRMQDVRIDTRLNKDIWAQGMRDVLYCIQVRLLRKCNEDENSPYKFHTSVTCV
FT                   PVTTLKNLQMIIVDEN"
FT   assembly_gap    5991392..5991750
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    5996946..5996965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6013637..6013761
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    6032725..6032744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6051993..6054587
FT                   /estimated_length=2595
FT                   /gap_type="unknown"
FT   gene            6054907..>6058112
FT                   /locus_tag="mCG_1042099"
FT                   /note="gene_id=mCG1042099.0"
FT   mRNA            join(6054907..6055041,6057682..>6058112)
FT                   /locus_tag="mCG_1042099"
FT                   /product="mCG1042099"
FT                   /note="gene_id=mCG1042099.0 transcript_id=mCT159803.0
FT                   created on 17-SEP-2002"
FT   CDS             6057716..>6058112
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042099"
FT                   /product="mCG1042099"
FT                   /note="gene_id=mCG1042099.0 transcript_id=mCT159803.0
FT                   protein_id=mCP75514.1"
FT                   /protein_id="EDL34330.1"
FT                   /translation="MQGPKPSRGKDHLWPPEERGAGREKKNKPASQSDLEADWNRASNS
FT                   NLLHQMPEQWPLFMHSSKGSLHQKAPSRINRQLILLVAEIHSHGKQSPALLLRRRIKSS
FT                   GIKGNSSLPGHLGKAEHGKPECSHLAPT"
FT   assembly_gap    6068310..6071899
FT                   /estimated_length=3590
FT                   /gap_type="unknown"
FT   assembly_gap    6112262..6112351
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    6119192..6120691
FT                   /estimated_length=1500
FT                   /gap_type="unknown"
FT   gene            6123534..6142177
FT                   /gene="Psmd12"
FT                   /locus_tag="mCG_3306"
FT                   /note="gene_id=mCG3306.2"
FT   mRNA            join(6123534..6123715,6129566..6129625,6129724..6129852,
FT                   6130430..6130537,6133018..6133122,6135822..6135971,
FT                   6136058..6136192,6137448..6137560,6138675..6138849,
FT                   6139735..6139812,6141567..6142177)
FT                   /gene="Psmd12"
FT                   /locus_tag="mCG_3306"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   non-ATPase, 12"
FT                   /note="gene_id=mCG3306.2 transcript_id=mCT2356.1 created on
FT                   31-JUL-2002"
FT   CDS             join(6123608..6123715,6129566..6129625,6129724..6129852,
FT                   6130430..6130537,6133018..6133122,6135822..6135971,
FT                   6136058..6136192,6137448..6137560,6138675..6138849,
FT                   6139735..6139812,6141567..6141776)
FT                   /codon_start=1
FT                   /gene="Psmd12"
FT                   /locus_tag="mCG_3306"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   non-ATPase, 12"
FT                   /note="gene_id=mCG3306.2 transcript_id=mCT2356.1
FT                   protein_id=mCP14638.1"
FT                   /db_xref="GOA:Q9D8W5"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="MGI:MGI:1914247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D8W5"
FT                   /protein_id="EDL34331.1"
FT                   /translation="MADGGSERADGRIVKMEVDYSATVDQRLPECEKLAKEGRLQEVIE
FT                   TLLSLEKQTRTASDMVSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKM
FT                   VQQCCTYVEEITDLPVKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAA
FT                   SILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTENL
FT                   KLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESDKWQQALKSVVLYVILAPFDN
FT                   EQSDLVHRISSDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGVELRKGSSETPATDV
FT                   FSSTEEGEKRWKDLKSRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVN
FT                   KTIFAKVDRLAGVINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ"
FT   assembly_gap    6131152..6131171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6146906..6146940
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    6150385..6150497
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    6152218..6152384
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   gene            complement(<6155168..>6170962)
FT                   /locus_tag="mCG_146302"
FT                   /note="gene_id=mCG146302.0"
FT   mRNA            complement(join(<6155168..6155295,6168077..6168252,
FT                   6168928..6168994,6170299..6170346,6170920..>6170962))
FT                   /locus_tag="mCG_146302"
FT                   /product="mCG146302"
FT                   /note="gene_id=mCG146302.0 transcript_id=mCT186405.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(<6155168..6155295,6168077..>6168120))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146302"
FT                   /product="mCG146302"
FT                   /note="gene_id=mCG146302.0 transcript_id=mCT186405.0
FT                   protein_id=mCP107582.0"
FT                   /protein_id="EDL34332.1"
FT                   /translation="NQEMNPVHSSSLTHSARDCSLIAINTFCNSRHHPTLHRSCLGKGG
FT                   GRGGEIKTDEER"
FT   assembly_gap    6161208..6161381
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    6162217..6162352
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    6164327..6164402
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   gene            complement(6175495..>6192742)
FT                   /locus_tag="mCG_122717"
FT                   /note="gene_id=mCG122717.1"
FT   mRNA            complement(join(6175495..6175905,6192289..>6192742))
FT                   /locus_tag="mCG_122717"
FT                   /product="mCG122717"
FT                   /note="gene_id=mCG122717.1 transcript_id=mCT123940.1
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(6175834..6175905,6192289..>6192741))
FT                   /codon_start=1
FT                   /locus_tag="mCG_122717"
FT                   /product="mCG122717"
FT                   /note="gene_id=mCG122717.1 transcript_id=mCT123940.1
FT                   protein_id=mCP75157.1"
FT                   /protein_id="EDL34333.1"
FT                   /translation="KPRPWGAGRAGTPGSARAGAASRGLPGPPEPRACARTLGPPPGSL
FT                   APQPPSGGKRRLRRGRNSKQLQRPGLASERAPLPRPCRRPAGSPAVPGAALSRTRSTRG
FT                   ESGPLPGWLWRLLKRPGQRRTGKSGLTCHYFLRHLGSTCQRPHKALWGSRMPHIRQVSQ
FT                   AIFELKNLESS"
FT   assembly_gap    6176084..6176656
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    6177938..6177957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6179703..6179949
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    6181781..6181909
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    6184342..6184396
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    6185921..6185940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6197776..6197795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6201468..6201634
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    6205074..6205327
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    6207117..6207295
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   gene            6220126..6332981
FT                   /gene="Helz"
FT                   /locus_tag="mCG_122718"
FT                   /note="gene_id=mCG122718.1"
FT   mRNA            join(6220126..6220353,6223054..6223090,6237689..6237813,
FT                   6240123..6240179,6244136..6244187,6245262..6245337,
FT                   6247296..6247494,6247922..6248029,6249052..6249349,
FT                   6258839..6259106,6263951..6264284,6265052..6265182,
FT                   6271535..6271714,6272353..6272454,6277172..6277350,
FT                   6279982..6280100,6281168..6281313,6282782..6282929,
FT                   6291096..6291279,6294158..6294386,6301012..6301216,
FT                   6305969..6306020,6306716..6306906,6308482..6308689,
FT                   6310879..6310958,6314911..6315547,6315923..6316157,
FT                   6317405..6317921,6328745..6328828,6330454..6330706,
FT                   6331550..6332981)
FT                   /gene="Helz"
FT                   /locus_tag="mCG_122718"
FT                   /product="helicase with zinc finger domain"
FT                   /note="gene_id=mCG122718.1 transcript_id=mCT123941.1
FT                   created on 18-SEP-2002"
FT   CDS             join(6220144..6220353,6223054..6223090,6237689..6237813,
FT                   6240123..6240179,6244136..6244187,6245262..6245337,
FT                   6247296..6247494,6247922..6248029,6249052..6249349,
FT                   6258839..6259106,6263951..6264284,6265052..6265182,
FT                   6271535..6271714,6272353..6272454,6277172..6277350,
FT                   6279982..6280100,6281168..6281313,6282782..6282929,
FT                   6291096..6291279,6294158..6294386,6301012..6301216,
FT                   6305969..6306020,6306716..6306906,6308482..6308689,
FT                   6310879..6310958,6314911..6315547,6315923..6316157,
FT                   6317405..6317921,6328745..6328828,6330454..6330706,
FT                   6331550..6331884)
FT                   /codon_start=1
FT                   /gene="Helz"
FT                   /locus_tag="mCG_122718"
FT                   /product="helicase with zinc finger domain"
FT                   /note="gene_id=mCG122718.1 transcript_id=mCT123941.1
FT                   protein_id=mCP75158.1"
FT                   /protein_id="EDL34334.1"
FT                   /translation="MEDRRAERSCEQACASLQRQDYDMALQHCTDALLSLGQYSMADFT
FT                   GPCPVEVERIKIESLLYRIASFLQLKNYGQADEDCRHVLGEGLAKGERAFRAVLCCMQL
FT                   KGKLQLVSSILAKSLSGESLNGMVTKDLTRLKTLLTETETATSNVLSGCHVEDLDEGSC
FT                   NGWHFRPPPRGITSSEEYTLCKRFLEQGICRYGAQCTSAHSQEELAEWQKRYASRLIKL
FT                   KQQSENKQLSGSYMETLIEKWMSSLSPEKVLSECIEGVQVEHSPDLSVTVNTKKSHQTW
FT                   TFALTCKPARMLYRVALLYDAHRPHFSIIAISAGDSTTQVSQEVPENCQEWIGGKMAQN
FT                   GLDHYVYKVGIAFNTEIFGTFRQTIVFDFGLEPVLMQRVMIDAASTEDLEYLMHAKRQL
FT                   VTTAKRWDSSSKTIVDFEPNETTDLEKSLLIRYQIPLSADQLFTQSVLDKSLTKTNYQA
FT                   RLHDLLYIEEIAQYKEVSRFNLKVQLQILASFMLTGVSGGAKYAQNGQLFGRFKLTETL
FT                   SEDTLAGRLVMTRVNAVYLLPVPKEKLVQSQGTKEKVYEATIEEKTKDYVFLRISRECC
FT                   EELSLRPDCDIQVELQFQLNRLPLCEMHYALDRIKDNAVLFPDISMTPTIPWSPNRQWD
FT                   EQLDPRLNAKQKEAVLAITTPLSIQLPPVLIIGPYGTGKTFTLAQAAKHILQQQETRIL
FT                   ICTHSNSAADLYIKDYLHPYVEAGNPQARPLRVYFRNRWVKTVHPVVHQYCLISSTQST
FT                   FQMPQKEDILKHRVVVVTLSTSQYLCQLDLEPGFFTHVLLDEAAQAMECETIMPLALAT
FT                   KNTRIVLAGDHMQLSPFVYSEFARERNLHVSLLDRLYEHYPAEFPCRILLCENYRSHEA
FT                   IINYTSELFYEGKLMASGKQPAHKDFYPLTFFTARGEDVQEKNSTAFYNNAEVFEVVER
FT                   VEELRRKWPVAWGKLDDGSIGVVTPYADQVFRIRAELRKKRLSDVNVERVLNVQGKQFR
FT                   VLFLSTVRTRHTCKHKQTPIKKKEQLLEDSTEDLDYGFLSNYKLLNTAITRAQSLVAVV
FT                   GDPVALCSIGRCRKFWERFIALCHENHSLHGITFEQIKAQLEALELKKTYVLNPLAPEF
FT                   IPRALRLQHSGNSSRQQQSPPKVKSLYHPQSDHFQSDGIVQPNPSVLIGNPIRAYTPPP
FT                   PLGPHPNLGKSPSPVQRIDPHTGTSILYVPAVYGGNVVMSVPLPVPWTGYQGRFAVDPR
FT                   IITHQAAMAYNMNLLHTHGRGSPIPYGLGHHPPVSLGQPQSQHAEKDQQEQNRNGKTDT
FT                   NNPGPEINKIRTPEKKPTEPKQVDLESNPQNRSPESRPGVVYSNTKFPRKDHLNPRHIN
FT                   NLPLPAPHAQYAIPSRHFHPLPQLPRPPFPASQPHTLLNQQQNNLPEQPNQMAPQPNQV
FT                   APQPNQMTPQPNQVAPQPNQVVQQQSQAPPQAPQPAPQLSPAFQAGPTNAFFNNAVAHR
FT                   PQSPAAEAVGPEQPPPPGLPDGHSPLRAITQPGPILASPLNNFVDESSPGLPIEEALDG
FT                   VHGSVALETLRQQQARLQQWSEHHAYLSQGGIPYSHHHHPHLPHLPHTPIGLHQPPVRA
FT                   EWKVAGRADDETETTFSRFQDLLRELSHRDQGDTGELAEMPPPQSRLLQYRQVQPRSPP
FT                   AVPSPPSSTDHSSQFANFNDSSRDIEVANSPAFPQRLPPQLFGSPFSLPSEHLAPPPLK
FT                   YLAPEGAWNFANLQQNHLIGPGFPYGLPPLPPRPPQNPFIHIQNHQHAAGQEPFHPLSS
FT                   RTVSASSLPSLEELRGCSVCRCLYYSCSCPLKTGLMKSLAEYEPRGPGRPLYQRRISSS
FT                   SAQPCVEEASAPQDSLAQGKESQGHSNPPAFNFPAPESWANTTSSAPYQNIPCNGSSRT
FT                   SQPRELIAPPKTVKPPEDQLKPESGEVSSSFNYSMLQHLGQFPPLMPNKQIAESANCSS
FT                   QQSPAGSKPAMSYASALRAPPKPRPPPEQAKKGSDPLSLLQELSLGSSPGSNGFYSYFK
FT                   "
FT   assembly_gap    6235025..6235044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6270167..6270186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6284361..6284380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6289664..6289685
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    6298972..6299109
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    6321900..6321919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6325548..6325567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6328517..6328536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6347623..6347649
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   gene            complement(6348254..6361538)
FT                   /gene="Cacng1"
FT                   /locus_tag="mCG_3308"
FT                   /note="gene_id=mCG3308.2"
FT   mRNA            complement(join(6348254..6348924,6349339..6349476,
FT                   6350809..6350883,6361176..6361538))
FT                   /gene="Cacng1"
FT                   /locus_tag="mCG_3308"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   1"
FT                   /note="gene_id=mCG3308.2 transcript_id=mCT2363.1 created on
FT                   25-JUL-2002"
FT   CDS             complement(join(6348698..6348924,6349339..6349476,
FT                   6350809..6350883,6361176..6361407))
FT                   /codon_start=1
FT                   /gene="Cacng1"
FT                   /locus_tag="mCG_3308"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   1"
FT                   /note="gene_id=mCG3308.2 transcript_id=mCT2363.1
FT                   protein_id=mCP14659.1"
FT                   /db_xref="GOA:Q4KL26"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR005421"
FT                   /db_xref="InterPro:IPR008368"
FT                   /db_xref="MGI:MGI:1206582"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KL26"
FT                   /protein_id="EDL34335.1"
FT                   /translation="MSQTKTAKVRVTLFFILVGGVLAMVAVVTDHWAVLSPHLEHHNET
FT                   CEAAHFGLWRICTARVAVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEY
FT                   SISAAAIAIFSLGFIIVGSICAFLSFGNKRDYLLRPASMFYAFAGLCLIVSVEVMRQSV
FT                   KRMIDSEDTVWIEHYYSWSFACACAAFILLFLGGLFLLLFSLPRMPQNPWESCMDAEPE
FT                   H"
FT   assembly_gap    6351751..6352050
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    6367074..6367093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6376527..6376590
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   gene            complement(6377058..6438831)
FT                   /gene="Cacng4"
FT                   /locus_tag="mCG_3311"
FT                   /note="gene_id=mCG3311.2"
FT   mRNA            complement(join(6377058..6380011,6381420..6381560,
FT                   6386530..6386613,6438525..6438831))
FT                   /gene="Cacng4"
FT                   /locus_tag="mCG_3311"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   4"
FT                   /note="gene_id=mCG3311.2 transcript_id=mCT2353.2 created on
FT                   26-JUL-2002"
FT   CDS             complement(join(6379473..6380011,6381420..6381560,
FT                   6386530..6386613,6438525..6438675))
FT                   /codon_start=1
FT                   /gene="Cacng4"
FT                   /locus_tag="mCG_3311"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   4"
FT                   /note="gene_id=mCG3311.2 transcript_id=mCT2353.2
FT                   protein_id=mCP14661.2"
FT                   /protein_id="EDL34336.1"
FT                   /translation="MAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWR
FT                   VCCIEGIYRGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLLGGLCIGA
FT                   GRIYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYNYGWSFY
FT                   FGALSFIVAETVGVLAVNIYIEKNKELRFKTKREFLKASSSSPYARMPSYRYRRRRSRS
FT                   SSRSTEASPSRDASPVGLKITGAIPMGELSMYTLSREPLKVTTAASYSPDQDAGFLQMH
FT                   DFFQQDLKEGFHVSMLNRRTTPV"
FT   assembly_gap    6399315..6399412
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    6401863..6402070
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    6403115..6403134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6439272..6439291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6441040..6441059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6466961..6466980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6478066..6478321
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    6502641..6502877
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    6508528..6508608
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   gene            complement(6522585..6561713)
FT                   /gene="Cacng5"
FT                   /locus_tag="mCG_3310"
FT                   /note="gene_id=mCG3310.1"
FT   mRNA            complement(join(6522585..6522925,6523211..6523356,
FT                   6527193..6527333,6528485..6528571,6529941..6530176,
FT                   6561560..6561713))
FT                   /gene="Cacng5"
FT                   /locus_tag="mCG_3310"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   5, transcript variant mCT2352"
FT                   /note="gene_id=mCG3310.1 transcript_id=mCT2352.1 created on
FT                   18-SEP-2002"
FT   mRNA            complement(join(6522586..6522925,6523211..6523356,
FT                   6527193..6527333,6528485..6528571,6529941..6530176,
FT                   6557939..6557999))
FT                   /gene="Cacng5"
FT                   /locus_tag="mCG_3310"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   5, transcript variant mCT173455"
FT                   /note="gene_id=mCG3310.1 transcript_id=mCT173455.0 created
FT                   on 18-SEP-2002"
FT   mRNA            complement(join(6522586..6522925,6523211..6523356,
FT                   6525972..>6526128))
FT                   /gene="Cacng5"
FT                   /locus_tag="mCG_3310"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   5, transcript variant mCT173456"
FT                   /note="gene_id=mCG3310.1 transcript_id=mCT173456.0 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(6522668..6522925,6523211..6523356,
FT                   6527193..6527333,6528485..6528571,6529941..6530136))
FT                   /codon_start=1
FT                   /gene="Cacng5"
FT                   /locus_tag="mCG_3310"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   5, isoform CRA_a"
FT                   /note="gene_id=mCG3310.1 transcript_id=mCT173455.0
FT                   protein_id=mCP96375.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544Q4"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR008368"
FT                   /db_xref="InterPro:IPR008369"
FT                   /db_xref="MGI:MGI:2157946"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Q4"
FT                   /protein_id="EDL34337.1"
FT                   /translation="MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQN
FT                   QSTEVKMSLHSGLWRVCFLAGEERGRCFTIEYVMPMNSQMTSESTVNVLKMIRSATPFP
FT                   LVSLFFMFIGFILSNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNR
FT                   TKDAETYFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLS
FT                   NCSDYSGQFLHPDAWIRGRSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC"
FT   CDS             complement(join(6522668..6522925,6523211..6523356,
FT                   6527193..6527333,6528485..6528571,6529941..6530136))
FT                   /codon_start=1
FT                   /gene="Cacng5"
FT                   /locus_tag="mCG_3310"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   5, isoform CRA_a"
FT                   /note="gene_id=mCG3310.1 transcript_id=mCT2352.1
FT                   protein_id=mCP14664.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q544Q4"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR008368"
FT                   /db_xref="InterPro:IPR008369"
FT                   /db_xref="MGI:MGI:2157946"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Q4"
FT                   /protein_id="EDL34338.1"
FT                   /translation="MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQN
FT                   QSTEVKMSLHSGLWRVCFLAGEERGRCFTIEYVMPMNSQMTSESTVNVLKMIRSATPFP
FT                   LVSLFFMFIGFILSNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNR
FT                   TKDAETYFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLS
FT                   NCSDYSGQFLHPDAWIRGRSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC"
FT   CDS             complement(join(6522668..6522925,6523211..6523356,
FT                   6525972..>6526128))
FT                   /codon_start=1
FT                   /gene="Cacng5"
FT                   /locus_tag="mCG_3310"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   5, isoform CRA_b"
FT                   /note="gene_id=mCG3310.1 transcript_id=mCT173456.0
FT                   protein_id=mCP96374.0 isoform=CRA_b"
FT                   /protein_id="EDL34339.1"
FT                   /translation="LLLGSVQGREVRQEPRKLGRSPSYQKYRRQAMVAQTGLTLQQKVR
FT                   GFVCHSEGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFAFAAISFLLTESAG
FT                   VMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWIRGRSPSDISSDASL
FT                   QMNSNYPALLKCPDYDQMSSSPC"
FT   assembly_gap    6524945..6524964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6534163..6535192
FT                   /estimated_length=1030
FT                   /gap_type="unknown"
FT   assembly_gap    6540895..6541018
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    6566025..6566106
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    6575747..6575766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6584941..6992698)
FT                   /gene="Prkca"
FT                   /locus_tag="mCG_140727"
FT                   /note="gene_id=mCG140727.0"
FT   mRNA            complement(join(6584941..6586622,6599025..6599165,
FT                   6601203..6601310,6615233..6615313,6631753..6631891,
FT                   6632725..6632787,6635086..6635177,6637351..6637524,
FT                   6639779..6639916,6666394..6666490,6666712..6666846,
FT                   6668013..6668169,6707970..6708098,6711753..6711864,
FT                   6840505..6840587,6989416..6989447,6992265..6992698))
FT                   /gene="Prkca"
FT                   /locus_tag="mCG_140727"
FT                   /product="protein kinase C, alpha"
FT                   /note="gene_id=mCG140727.0 transcript_id=mCT171102.0
FT                   created on 26-JUL-2002"
FT   CDS             complement(join(6586458..6586622,6599025..6599165,
FT                   6601203..6601310,6615233..6615313,6631753..6631891,
FT                   6632725..6632787,6635086..6635177,6637351..6637524,
FT                   6639779..6639916,6666394..6666490,6666712..6666846,
FT                   6668013..6668169,6707970..6708098,6711753..6711864,
FT                   6840505..6840587,6989416..6989447,6992265..6992437))
FT                   /codon_start=1
FT                   /gene="Prkca"
FT                   /locus_tag="mCG_140727"
FT                   /product="protein kinase C, alpha"
FT                   /note="gene_id=mCG140727.0 transcript_id=mCT171102.0
FT                   protein_id=mCP94020.0"
FT                   /db_xref="GOA:Q4VA93"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014375"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR020454"
FT                   /db_xref="MGI:MGI:97595"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VA93"
FT                   /protein_id="EDL34340.1"
FT                   /translation="MADVYPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFK
FT                   QPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKF
FT                   KIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIY
FT                   LKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQ
FT                   WNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQE
FT                   EGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFN
FT                   FLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPF
FT                   LTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRG
FT                   IIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGK
FT                   SVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKH
FT                   PAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQP
FT                   VLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV"
FT   assembly_gap    6593622..6593641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6603732..6603751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6604869..6604888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6606789..6607969
FT                   /estimated_length=1181
FT                   /gap_type="unknown"
FT   assembly_gap    6645505..6645712
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    6653050..6653069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6677839..6680679
FT                   /estimated_length=2841
FT                   /gap_type="unknown"
FT   assembly_gap    6706198..6706240
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    6716973..6717095
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    6717965..6718187
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    6724558..6724638
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    6733072..6733297
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    6743522..6743541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6764974..6764993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6766134..6766153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6781394..6781413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6783124..6783143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6784701..6784720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6787820..6787903
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    6789891..6790157
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    6798269..6798288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6816139..6816177
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    6819395..6819484
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    6823484..6823739
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    6836040..6836059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6846558..6846577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6857273..6857586
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    6886271..6886290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6909570..6909830
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    6914023..6914042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6918742..6918761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6942714..6942733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6950949..6950969
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    6963200..6963394
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    6970596..6970615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6971892..6971911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7003173..7003349
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    7014100..7014119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7028903..7029316
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   gene            7044659..7058539
FT                   /gene="Apoh"
FT                   /locus_tag="mCG_8732"
FT                   /note="gene_id=mCG8732.2"
FT   mRNA            join(7044659..7044772,7045181..7045357,7046664..7046760,
FT                   7049488..7049564,7051964..7052152,7053804..7053983,
FT                   7056140..7056337,7058374..7058539)
FT                   /gene="Apoh"
FT                   /locus_tag="mCG_8732"
FT                   /product="apolipoprotein H"
FT                   /note="gene_id=mCG8732.2 transcript_id=mCT7302.2 created on
FT                   26-JUL-2002"
FT   CDS             join(7044709..7044772,7045181..7045357,7046664..7046760,
FT                   7049488..7049564,7051964..7052152,7053804..7053983,
FT                   7056140..7056337,7058374..7058429)
FT                   /codon_start=1
FT                   /gene="Apoh"
FT                   /locus_tag="mCG_8732"
FT                   /product="apolipoprotein H"
FT                   /note="gene_id=mCG8732.2 transcript_id=mCT7302.2
FT                   protein_id=mCP11936.2"
FT                   /protein_id="EDL34341.1"
FT                   /translation="MVSPVLALFSAFLCHVAIAGRICPKPDDLPFATVVPLKTSYDPGE
FT                   QIVYSCKPGYVSRGGMRRFTCPLTGMWPINTLRCVPRVCPFAGILENGIVRYTSFEYPK
FT                   NISFACNPGFFLNGTSSSKCTEEGKWSPDIPACARITCPPPPVPKFALLKDYRPSAGNN
FT                   SLYQDTVVFKCLPHFAMIGNDTVMCTEQGNWTRLPECLEVKCPFPPRPENGYVNYPAKP
FT                   VLLYKDKATFGCHETYKLDGPEEAECTKTGTWSFLPTCRESCKLPVKKATVLYQGMRVK
FT                   IQEQFKNGMMHGDKIHFYCKNKEKKCSYTVEAHCRDGTIEIPSCFKEHSSLAFWKTDAS
FT                   ELTPC"
FT   assembly_gap    7049030..7049049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7067376..7067864
FT                   /pseudo
FT                   /locus_tag="mCG_1050479"
FT                   /note="gene_id=mCG1050479.0"
FT   mRNA            7067376..7067864
FT                   /pseudo
FT                   /locus_tag="mCG_1050479"
FT                   /note="gene_id=mCG1050479.0 transcript_id=mCT194508.0
FT                   created on 28-JUN-2004"
FT   gene            7069301..7505778
FT                   /gene="Ccdc46"
FT                   /locus_tag="mCG_131563"
FT                   /note="gene_id=mCG131563.1"
FT   mRNA            join(7069301..7069460,7078262..7078375,7081343..7081533,
FT                   7084561..7084733,7115158..7115248,7116884..7116961,
FT                   7136224..7136271,7136543..7136620,7147875..7147961,
FT                   7152701..7152800,7156168..7156286,7157851..7157994,
FT                   7168315..7168469,7168766..7168895,7169532..7169624,
FT                   7171193..7171252,7177956..7178035,7216842..7216977,
FT                   7237733..7237840,7252943..7253125,7309474..7309704,
FT                   7399748..7399810,7404854..7405003,7455380..7455469,
FT                   7500951..7501052,7504510..7504574,7505359..7505778)
FT                   /gene="Ccdc46"
FT                   /locus_tag="mCG_131563"
FT                   /product="coiled-coil domain containing 46, transcript
FT                   variant mCT132900"
FT                   /note="gene_id=mCG131563.1 transcript_id=mCT132900.2
FT                   created on 28-JUN-2004"
FT   mRNA            join(7069301..7069460,7078262..7078375,7081343..7081533,
FT                   7084561..7084733,7115158..7115248,7116884..7117660)
FT                   /gene="Ccdc46"
FT                   /locus_tag="mCG_131563"
FT                   /product="coiled-coil domain containing 46, transcript
FT                   variant mCT173443"
FT                   /note="gene_id=mCG131563.1 transcript_id=mCT173443.1
FT                   created on 28-JUN-2004"
FT   CDS             join(7069313..7069460,7078262..7078375,7081343..7081533,
FT                   7084561..7084733,7115158..7115248,7116884..7116961,
FT                   7136224..7136271,7136543..7136620,7147875..7147961,
FT                   7152701..7152800,7156168..7156286,7157851..7157994,
FT                   7168315..7168469,7168766..7168895,7169532..7169624,
FT                   7171193..7171252,7177956..7178035,7216842..7216977,
FT                   7237733..7237840,7252943..7253125,7309474..7309704,
FT                   7399748..7399810,7404854..7405003,7455380..7455469,
FT                   7500951..7501052,7504510..7504574,7505359..7505362)
FT                   /codon_start=1
FT                   /gene="Ccdc46"
FT                   /locus_tag="mCG_131563"
FT                   /product="coiled-coil domain containing 46, isoform CRA_a"
FT                   /note="gene_id=mCG131563.1 transcript_id=mCT132900.2
FT                   protein_id=mCP75390.2 isoform=CRA_a"
FT                   /protein_id="EDL34342.1"
FT                   /translation="MPAAARGGGTGEFASPAPGLLDGPQGFETVWLWRLGVGGRVDGLL
FT                   VGAPDRIMETGSEEEKWEKLDAEFDHFVVDMKPFVLKLPHRSERQRCALWIRKLCEPSG
FT                   TGAGLMGRKNRNLYAKLLLHMLRRGILEGPFTHRPEPGTLKTLPSYMSIYFDEPNQAQP
FT                   KDSSPEKLPDWVRGELQTGEQRLSDSWQCSSGEDNTLVLAASDAHREQYTGKLRMRSHS
FT                   VSPTYREDKQHITSKICEVHSKTSPISLDDSDIEVRLNSWNLGIENPRYLRQKPLPISL
FT                   MTPKGSLRKASSLHDDHFLSRMHEKELDMKTKMMEAKFSEEKLKLQQKHDAEVQKILER
FT                   KNNELEELKILYKKKQTETEETIRKLEKKVQILIRDCQVIRETKENQITELKKICEQST
FT                   ESLNNDWEKKLHNAVAEMEKDKFELQKHHTETIQELLEDTNVRLSKMEADYVVQMQSTN
FT                   HMIKELEGRVQQLMGEAENSNLQRQKLTQEKLELERCYQITCNELQELKTRRNILHKEK
FT                   EHLVNDYEQNVKLLKTKYDSDINLLRQEHALSTSKTSGVIEELEQNICQLKQQVQESEL
FT                   QRKQQVKDQENKFHMEKNHLKHTYEKKVHELQSELDKEKEDAQRKIHKFEEALKEKEEQ
FT                   LSRVTEVQRLQAQQADAALEEFKRQVEVNSEKVYGEMKEQMEKVEADLTRSKSLREKQS
FT                   KEFLWQLEDAKQRYEQQIVELKLEHEQEKTHLLQQHSAEKDSLVRDHDREIENLEKQLR
FT                   AANMEHENQIQESKKRDAQVIADMEAQVHKLREELISVNSQRKQQLIELGLLREEEKQR
FT                   AAKDHETAVKKLKAESERVKMELKKTHAAETEMTLEKANSRLKQIEKEYTQKLAKSSQI
FT                   IAELQTTISSLKEESSRQQLAAERRLQDVIQKFEDEKQQLIRDNDQAIKALQDELETRS
FT                   HQVRSAEKKLHHKELEAQEQIMYIRQEYETKFKGLMPASLRQELEDTISSLKSQVNFLQ
FT                   KRASILQEELTTYQSRR"
FT   CDS             join(7069313..7069460,7078262..7078375,7081343..7081533,
FT                   7084561..7084733,7115158..7115248,7116884..7117051)
FT                   /codon_start=1
FT                   /gene="Ccdc46"
FT                   /locus_tag="mCG_131563"
FT                   /product="coiled-coil domain containing 46, isoform CRA_c"
FT                   /note="gene_id=mCG131563.1 transcript_id=mCT173443.1
FT                   protein_id=mCP96362.1 isoform=CRA_c"
FT                   /protein_id="EDL34344.1"
FT                   /translation="MPAAARGGGTGEFASPAPGLLDGPQGFETVWLWRLGVGGRVDGLL
FT                   VGAPDRIMETGSEEEKWEKLDAEFDHFVVDMKPFVLKLPHRSERQRCALWIRKLCEPSG
FT                   TGAGLMGRKNRNLYAKLLLHMLRRGILEGPFTHRPEPGTLKTLPSYMSIYFDEPNQAQP
FT                   KDSSPEKLPDWVRGELQTGEQRLSDSWQCSSGEDNTLVLAASDAHREQYTGKLRMRSHS
FT                   VSPTYREDKQHITSKICEVHSKTSPISLDDSDIEVRLNSWNLGVKPVFILYAYWHVRVI
FT                   SYVENILNNNSIQ"
FT   assembly_gap    7113659..7113678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7123181..7124702
FT                   /estimated_length=1522
FT                   /gap_type="unknown"
FT   assembly_gap    7125720..7126167
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   assembly_gap    7127538..7127557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7289474..7289493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7317052..7317071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7326015..7326034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(7329344..7329597,7399748..7399810,7404854..7405003,
FT                   7455380..7455469,7500951..7501052,7504510..7504574,
FT                   7505359..7505778)
FT                   /gene="Ccdc46"
FT                   /locus_tag="mCG_131563"
FT                   /product="coiled-coil domain containing 46, transcript
FT                   variant mCT194505"
FT                   /note="gene_id=mCG131563.1 transcript_id=mCT194505.0
FT                   created on 28-JUN-2004"
FT   CDS             join(7329550..7329597,7399748..7399810,7404854..7405003,
FT                   7455380..7455469,7500951..7501052,7504510..7504574,
FT                   7505359..7505362)
FT                   /codon_start=1
FT                   /gene="Ccdc46"
FT                   /locus_tag="mCG_131563"
FT                   /product="coiled-coil domain containing 46, isoform CRA_b"
FT                   /note="gene_id=mCG131563.1 transcript_id=mCT194505.0
FT                   protein_id=mCP115534.0 isoform=CRA_b"
FT                   /protein_id="EDL34343.1"
FT                   /translation="MRPLRDTGPSVPKENMANSRLKQIEKEYTQKLAKSSQIIAELQTT
FT                   ISSLKEESSRQQLAAERRLQDVIQKFEDEKQQLIRDNDQAIKALQDELETRSHQVRSAE
FT                   KKLHHKELEAQEQIMYIRQEYETKFKGLMPASLRQELEDTISSLKSQVNFLQKRASILQ
FT                   EELTTYQSRR"
FT   gene            complement(7333800..7334761)
FT                   /pseudo
FT                   /locus_tag="mCG_52404"
FT                   /note="gene_id=mCG52404.1"
FT   mRNA            complement(7333800..7334761)
FT                   /pseudo
FT                   /locus_tag="mCG_52404"
FT                   /note="gene_id=mCG52404.1 transcript_id=mCT52587.2 created
FT                   on 28-JUN-2004"
FT   assembly_gap    7338241..7338260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7409352..7409381
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    7444551..7444570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7467291..7473896
FT                   /locus_tag="mCG_148163"
FT                   /note="gene_id=mCG148163.0"
FT   mRNA            join(7467291..7467431,7469234..7473896)
FT                   /locus_tag="mCG_148163"
FT                   /product="mCG148163"
FT                   /note="gene_id=mCG148163.0 transcript_id=mCT188426.0
FT                   created on 13-JAN-2004"
FT   CDS             7472751..7473428
FT                   /codon_start=1
FT                   /locus_tag="mCG_148163"
FT                   /product="mCG148163"
FT                   /note="gene_id=mCG148163.0 transcript_id=mCT188426.0
FT                   protein_id=mCP109340.0"
FT                   /protein_id="EDL34345.1"
FT                   /translation="MVTVPGFLIPGFLVPGFLVPEFLVPGFLVPGLLVPGLLVPGFGTN
FT                   SYTHSRPARKDATNRNLLRQKLYCLHLQEPESKSKSKKARKRTRTRKQERENKKAREER
FT                   EQESKNKREKKQEQEREKESKSKKKQEKEWQNPVPFKENYPPPRTYYSLIGCSPSAQLS
FT                   SRERQNTWRENCPCTCADYVYHLEHSCQRHLIMANVRAAPNRAPALALAHILPSLCDGH
FT                   TFV"
FT   assembly_gap    7485952..7492739
FT                   /estimated_length=6788
FT                   /gap_type="unknown"
FT   assembly_gap    7524778..7524971
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   gene            7565374..7594992
FT                   /gene="Axin2"
FT                   /locus_tag="mCG_19631"
FT                   /note="gene_id=mCG19631.2"
FT   mRNA            join(7565374..7565530,7568249..7569199,7576636..7576776,
FT                   7584511..7584613,7587103..7587243,7587391..7587896,
FT                   7588135..7588329,7588856..7589086,7589710..7589805,
FT                   7591080..7591247,7594467..7594992)
FT                   /gene="Axin2"
FT                   /locus_tag="mCG_19631"
FT                   /product="axin2"
FT                   /note="gene_id=mCG19631.2 transcript_id=mCT20890.2 created
FT                   on 26-JUL-2002"
FT   assembly_gap    7566773..7566792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(7568385..7569199,7576636..7576776,7584511..7584613,
FT                   7587103..7587243,7587391..7587896,7588135..7588329,
FT                   7588856..7589086,7589710..7589805,7591080..7591247,
FT                   7594467..7594593)
FT                   /codon_start=1
FT                   /gene="Axin2"
FT                   /locus_tag="mCG_19631"
FT                   /product="axin2"
FT                   /note="gene_id=mCG19631.2 transcript_id=mCT20890.2
FT                   protein_id=mCP11946.2"
FT                   /db_xref="GOA:O88566"
FT                   /db_xref="InterPro:IPR001158"
FT                   /db_xref="InterPro:IPR014936"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR032101"
FT                   /db_xref="MGI:MGI:1270862"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88566"
FT                   /protein_id="EDL34346.1"
FT                   /translation="MSSAVLVTLLPDPSSSFREDAPRPPVPGEEGETPPCQPSVGKVQS
FT                   TKPMPVSSNARRNEDGLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKC
FT                   VDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKK
FT                   QQIGSVMFDQAQTEIQAVMEENAYQVFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVLC
FT                   GYLPTLNEEEEWTCADLKCKLSPTVVGLSSKTLRATASVRSTETAENGFRSFKRSDPVN
FT                   PYHVGSGYVFAPATSANDSELSSDALTDDSMSMTDSSVDGVPPYRMGSKKQLQREMHRS
FT                   VKANGQVSLPHFPRTHRLPKEMTPVEPAAFAAELISRLEKLKLELESRHSLEERLQQIR
FT                   EDEEKEGSEQALSSRDGAPVQHPLALLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVG
FT                   RYSPRSRSPDHHHQHHHHQQCHTLLPTGGKLPPVAACPLLGGKSFLTKQTTKHVHHHYI
FT                   HHHAVPKTKEEIEAEATQRVRCLCPGGTDYYCYSKCKSHPKAPEPLPGEQFCGSRGGTL
FT                   PKRNAKGTEPGLALSARDGGMSSAAGAPQLPGEEGDRSQDVWQWMLESERQSKSKPHSA
FT                   QSIRKSYPLESACAAPGERVSRHHLLGASGHSRSVARAHPFTQDPAMPPLTPPNTLAQL
FT                   EEACRRLAEVSKPQKQRCCVASQQRDRNHSAAGQAGASPFANPSLAPEDHKEPKKLASV
FT                   HALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACG
FT                   AVFEEIWDDETVLPMYEGRILGKVERID"
FT   assembly_gap    7575694..7575761
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    7607470..7607524
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    7611986..7612070
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   gene            <7656881..7657338
FT                   /locus_tag="mCG_50443"
FT                   /note="gene_id=mCG50443.1"
FT   mRNA            <7656881..7657338
FT                   /locus_tag="mCG_50443"
FT                   /product="mCG50443"
FT                   /note="gene_id=mCG50443.1 transcript_id=mCT50626.1 created
FT                   on 20-SEP-2002"
FT   CDS             7656881..7657168
FT                   /codon_start=1
FT                   /locus_tag="mCG_50443"
FT                   /product="mCG50443"
FT                   /note="gene_id=mCG50443.1 transcript_id=mCT50626.1
FT                   protein_id=mCP33709.0"
FT                   /protein_id="EDL34347.1"
FT                   /translation="MPEAVHLGDLLRIWVRPGDLQALPRIFKGQRELTGCRRNHDAFQG
FT                   TCPSLRANPFQGALPFTKKRELSPGLLRDRSRYRTGRLAAPISATLDLGI"
FT   assembly_gap    7671244..7671464
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    7675136..7675554
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    7693930..7693949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7702588..7702607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7720548..7720567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7728141..7728160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7732034..7732053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7738039..7738058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7741259..7741512
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    7750771..7750965
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    7754158..7754177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7765628..7765944
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    7768434..7768624
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    7784109..7784267
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   gene            complement(7784420..>7789238)
FT                   /locus_tag="mCG_145521"
FT                   /note="gene_id=mCG145521.0"
FT   mRNA            complement(join(7784420..7784758,7785117..7785306,
FT                   7788685..>7789238))
FT                   /locus_tag="mCG_145521"
FT                   /product="mCG145521"
FT                   /note="gene_id=mCG145521.0 transcript_id=mCT184945.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(7784633..7784758,7785117..7785306,
FT                   7788685..>7788947))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145521"
FT                   /product="mCG145521"
FT                   /note="gene_id=mCG145521.0 transcript_id=mCT184945.0
FT                   protein_id=mCP105791.0"
FT                   /protein_id="EDL34348.1"
FT                   /translation="HLGSFEWMSQTTPKKKKKTYQEPEFSQPFRYCVSMSQIWGKDCPH
FT                   LTPGSSRRWVNFSQDQDGRDPTVRRVAVRDTEDTANRMQKRPREKHMADCPSSRRDPAQ
FT                   GGRKNKGALVPLIPVILHSHRRRPNREQGPGEAPTGMWPRGHHLEWKPDTQPWECPYLT
FT                   PAMEVPFLQLCYVTGSPWSVLTSLSFRDE"
FT   assembly_gap    7785630..7787227
FT                   /estimated_length=1598
FT                   /gap_type="unknown"
FT   gene            complement(<7804055..7805062)
FT                   /locus_tag="mCG_49456"
FT                   /note="gene_id=mCG49456.2"
FT   mRNA            complement(<7804055..7805062)
FT                   /locus_tag="mCG_49456"
FT                   /product="mCG49456"
FT                   /note="gene_id=mCG49456.2 transcript_id=mCT49639.2 created
FT                   on 20-SEP-2002"
FT   CDS             complement(7804055..7804936)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49456"
FT                   /product="mCG49456"
FT                   /note="gene_id=mCG49456.2 transcript_id=mCT49639.2
FT                   protein_id=mCP33708.2"
FT                   /protein_id="EDL34349.1"
FT                   /translation="MVYVFQYDSTHGKSNGTVKVENGKLVINGKPITVFQERDPANIKW
FT                   GDAGAEYVMESTGIFTTMEKFQTHLKDGVERVIISTPSANAPMFVMGVNHEKYDNSLKI
FT                   VSNASCTTNCLAPLAKVIHDNFGIGEGLMTTVHAITATQKTVDGPSGKLWRIGRGAAQN
FT                   IIPASTGVVKAVGKVTPELSRKLTGMAFCDPTPNISVVGLICCLEKPAKYEDIKKVVKQ
FT                   ASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNR
FT                   VVDFMAYMASKD"
FT   assembly_gap    7812022..7812490
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   assembly_gap    7827386..7827405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7856418..7856487
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   gene            complement(7870528..7943465)
FT                   /gene="Rgs9"
FT                   /locus_tag="mCG_19636"
FT                   /note="gene_id=mCG19636.1"
FT   mRNA            complement(join(7870528..7870949,7872299..7872777,
FT                   7881073..7881190,7883578..7883663,7884938..7885076,
FT                   7886334..7886421,7891841..7891956,7893452..7893565,
FT                   7894367..7894428,7895415..7895444,7905231..7905293,
FT                   7914392..7914473,7918332..7918408,7920478..7920536,
FT                   7920796..7920847,7921037..7921143,7921787..7921837,
FT                   7926673..7926769,7943274..7943465))
FT                   /gene="Rgs9"
FT                   /locus_tag="mCG_19636"
FT                   /product="regulator of G-protein signaling 9, transcript
FT                   variant mCT20896"
FT                   /note="gene_id=mCG19636.1 transcript_id=mCT20896.2 created
FT                   on 26-JUL-2002"
FT   CDS             complement(join(7870799..7870949,7872299..7872777,
FT                   7881073..7881190,7883578..7883663,7884938..7885076,
FT                   7886334..7886421,7891841..7891956,7893452..7893565,
FT                   7894367..7894428,7895415..7895444,7905231..7905293,
FT                   7914392..7914473,7918332..7918408,7920478..7920536,
FT                   7920796..7920847,7921037..7921143,7921787..7921837,
FT                   7926673..7926769,7943274..7943330))
FT                   /codon_start=1
FT                   /gene="Rgs9"
FT                   /locus_tag="mCG_19636"
FT                   /product="regulator of G-protein signaling 9, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19636.1 transcript_id=mCT20896.2
FT                   protein_id=mCP11938.2 isoform=CRA_b"
FT                   /db_xref="GOA:O54828"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="MGI:MGI:1338824"
FT                   /db_xref="PDB:2PBI"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54828"
FT                   /protein_id="EDL34351.1"
FT                   /translation="MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMHNQRVLVTS
FT                   VPHAMTGGDVLQWITQRLWISNLEAQNLGNFIVKYGYIYPLQDPKNLILKPDSSLYRFQ
FT                   TPYFWPTQQWPAEDTDYAIYLAKRNIKKKGILEEYEKENYDFLNKKINYKWDFVIMQAK
FT                   EQYRTGKERNKADRYALDCQEKAYWLVHRSPPGMNNVLDYGLDRVTNPNEVKKQTVTAV
FT                   RKEIMYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFWDLN
FT                   AKLVEIPTKMRVERWAFNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQ
FT                   SKVKEKAEEIYKLFLAPGARRWINIDGKTMDITVKGLRHPHRYVLDAAQTHIYMLMKKD
FT                   SYARYLKSPIYKEMLAKAIEPQETTKRSSTLPFMRRHLRSSPSPVILRQLEEEEKAREA
FT                   ANTVDITQPGQHLAPSPHLAVYTGTCVPPSPSSPFSPSCRSPRKPFASPSRFIRRPSIA
FT                   ICPSPSRVALEGSSGLEPKGEASWSGANSGPSVTENREPSADHSRPQPRAPPKARAALS
FT                   LGRFLRRGCLASPVFARLSPKCPSVSHGKVQPLGDMGQQLPRLKPKKVANFFQIKMEMP
FT                   TDSGTCLMDSDDPRAGESGDQTTEKEVICPWESLAEGKAG"
FT   mRNA            complement(join(7880230..7881190,7883578..7883663,
FT                   7884938..7885076,7886334..7886421,7891841..7891956,
FT                   7893452..7893565,7894367..7894428,7895415..7895444,
FT                   7905231..7905293,7914392..7914473,7918332..7918408,
FT                   7920478..7920536,7920796..7920847,7921037..7921143,
FT                   7921787..7921837,7926673..7926769,7943274..>7943402))
FT                   /gene="Rgs9"
FT                   /locus_tag="mCG_19636"
FT                   /product="regulator of G-protein signaling 9, transcript
FT                   variant mCT193210"
FT                   /note="gene_id=mCG19636.1 transcript_id=mCT193210.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(7881016..7881190,7883578..7883663,
FT                   7884938..7885076,7886334..7886421,7891841..7891956,
FT                   7893452..7893565,7894367..7894428,7895415..7895444,
FT                   7905231..7905293,7914392..7914473,7918332..7918408,
FT                   7920478..7920536,7920796..7920847,7921037..7921143,
FT                   7921787..7921837,7926673..7926769,7943274..>7943348))
FT                   /codon_start=1
FT                   /gene="Rgs9"
FT                   /locus_tag="mCG_19636"
FT                   /product="regulator of G-protein signaling 9, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19636.1 transcript_id=mCT193210.0
FT                   protein_id=mCP114159.0 isoform=CRA_a"
FT                   /protein_id="EDL34350.1"
FT                   /translation="IHPGSRMTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMHNQ
FT                   RVLVTSVPHAMTGGDVLQWITQRLWISNLEAQNLGNFIVKYGYIYPLQDPKNLILKPDS
FT                   SLYRFQTPYFWPTQQWPAEDTDYAIYLAKRNIKKKGILEEYEKENYDFLNKKINYKWDF
FT                   VIMQAKEQYRTGKERNKADRYALDCQEKAYWLVHRSPPGMNNVLDYGLDRVTNPNEVKK
FT                   QTVTAVRKEIMYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDT
FT                   QFWDLNAKLVEIPTKMRVERWAFNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACED
FT                   LKYGDQSKVKEKAEEIYKLFLAPGARRWINIDGKTMDITVKGLRHPHRYVLDAAQTHIY
FT                   MLMKKDSYARYLKSPIYKEMLAKAIEPQETTKRSSTLPFMRRHLRSSPSPVILRQLEEE
FT                   EKAREAANTVDITQVMSKLDRRSQLKKELPPK"
FT   assembly_gap    7881828..7882862
FT                   /estimated_length=1035
FT                   /gap_type="unknown"
FT   assembly_gap    7889406..7889541
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    7891127..7891734
FT                   /estimated_length=608
FT                   /gap_type="unknown"
FT   assembly_gap    7917598..7917696
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    7919897..7919916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7954344..7954970
FT                   /estimated_length=627
FT                   /gap_type="unknown"
FT   assembly_gap    7955991..7958658
FT                   /estimated_length=2668
FT                   /gap_type="unknown"
FT   assembly_gap    7960249..7960284
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    7961990..7962009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7971551..7971816
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    7986905..7987018
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    7993521..7993598
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   gene            7994229..8000953
FT                   /locus_tag="mCG_148160"
FT                   /note="gene_id=mCG148160.0"
FT   mRNA            join(7994229..7994401,8000686..8000953)
FT                   /locus_tag="mCG_148160"
FT                   /product="mCG148160"
FT                   /note="gene_id=mCG148160.0 transcript_id=mCT188423.0
FT                   created on 13-JAN-2004"
FT   CDS             join(7994281..7994401,8000686..8000750)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148160"
FT                   /product="mCG148160"
FT                   /note="gene_id=mCG148160.0 transcript_id=mCT188423.0
FT                   protein_id=mCP109337.0"
FT                   /protein_id="EDL34352.1"
FT                   /translation="MSPVPKASCEVKTGESTEAEKPASLWALQWTGDPVLDEVQGHGGA
FT                   NLSGNKIWKQVEGSWF"
FT   assembly_gap    7998658..7998765
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    8002073..8002146
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    8010218..8010237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8010246..8048628
FT                   /gene="Gna13"
FT                   /locus_tag="mCG_19634"
FT                   /note="gene_id=mCG19634.2"
FT   mRNA            join(8010246..8010672,8012942..8013168,8039668..8039718,
FT                   8043199..8048628)
FT                   /gene="Gna13"
FT                   /locus_tag="mCG_19634"
FT                   /product="guanine nucleotide binding protein, alpha 13,
FT                   transcript variant mCT20894"
FT                   /note="gene_id=mCG19634.2 transcript_id=mCT20894.2 created
FT                   on 26-JUL-2002"
FT   mRNA            join(<8010356..8010672,8012942..8013168,8039668..8039718,
FT                   8043199..8044238,8044324..8045464)
FT                   /gene="Gna13"
FT                   /locus_tag="mCG_19634"
FT                   /product="guanine nucleotide binding protein, alpha 13,
FT                   transcript variant mCT193205"
FT                   /note="gene_id=mCG19634.2 transcript_id=mCT193205.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<8010357..8010672,8012942..8013168,8039668..8039718,
FT                   8043199..8043771)
FT                   /codon_start=1
FT                   /gene="Gna13"
FT                   /locus_tag="mCG_19634"
FT                   /product="guanine nucleotide binding protein, alpha 13,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19634.2 transcript_id=mCT193205.0
FT                   protein_id=mCP114158.0 isoform=CRA_a"
FT                   /protein_id="EDL34353.1"
FT                   /translation="AGARRGGGGGKMADFLPSRSVLSVCFPGCVLTNGEAEQQRKSKEI
FT                   DKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVI
FT                   KGMRVLVDAREKLHIPWGDNKNQLHGDKLMAFDTRAPMAAQGMVETRVFLQYLPAIRAL
FT                   WEDSGIQNAYDRRREFQLGESVKYFLDNLDKLGVPDYIPSQQDILLARRPTKGIHEYDF
FT                   EIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRQTNRLTESLN
FT                   IFETIVNNRVFSNVSIILFLNKTDLLEEKVQVVSIKDYFLEFEGDPHCLRDVQKFLVEC
FT                   FRGKRRDQQQRPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ"
FT   CDS             join(8010390..8010672,8012942..8013168,8039668..8039718,
FT                   8043199..8043771)
FT                   /codon_start=1
FT                   /gene="Gna13"
FT                   /locus_tag="mCG_19634"
FT                   /product="guanine nucleotide binding protein, alpha 13,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19634.2 transcript_id=mCT20894.2
FT                   protein_id=mCP11937.2 isoform=CRA_b"
FT                   /protein_id="EDL34354.1"
FT                   /translation="MADFLPSRSVLSVCFPGCVLTNGEAEQQRKSKEIDKCLSREKTYV
FT                   KRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDARE
FT                   KLHIPWGDNKNQLHGDKLMAFDTRAPMAAQGMVETRVFLQYLPAIRALWEDSGIQNAYD
FT                   RRREFQLGESVKYFLDNLDKLGVPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVD
FT                   VGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRQTNRLTESLNIFETIVNNRVF
FT                   SNVSIILFLNKTDLLEEKVQVVSIKDYFLEFEGDPHCLRDVQKFLVECFRGKRRDQQQR
FT                   PLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ"
FT   assembly_gap    8022891..8022984
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    8024101..8024221
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   gene            8061456..8065905
FT                   /gene="9930022D16Rik"
FT                   /locus_tag="mCG_1042111"
FT                   /note="gene_id=mCG1042111.1"
FT   mRNA            join(8061456..8061588,8065343..8065905)
FT                   /gene="9930022D16Rik"
FT                   /locus_tag="mCG_1042111"
FT                   /product="RIKEN cDNA 9930022D16"
FT                   /note="gene_id=mCG1042111.1 transcript_id=mCT159815.1
FT                   created on 20-SEP-2002"
FT   CDS             join(8061481..8061588,8065343..8065696)
FT                   /codon_start=1
FT                   /gene="9930022D16Rik"
FT                   /locus_tag="mCG_1042111"
FT                   /product="RIKEN cDNA 9930022D16"
FT                   /note="gene_id=mCG1042111.1 transcript_id=mCT159815.1
FT                   protein_id=mCP75189.1"
FT                   /protein_id="EDL34355.1"
FT                   /translation="MQMTEGEVFSILSSTPAAPFKAQPRALLSKTPEVSQSILMSSFGN
FT                   QDTRRTIVSSSFEMSHQGSGRAQLEHKPISHRSCGLSVLRRESQEHRERRWLTPHRVPT
FT                   QPNHRGSAPHSLRAFVGSWLAGWSLGTTVTQKTQRHSVKWQSKLCQQRI"
FT   assembly_gap    8064853..8064872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8069211..8069230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8070936..8070955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8073795..8073814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8075377..8101868
FT                   /locus_tag="mCG_19632"
FT                   /note="gene_id=mCG19632.2"
FT   mRNA            join(8075377..8075517,8075970..8076059,8076454..8076581,
FT                   8078128..8078410,8078990..8079163,8079250..8079378,
FT                   8083195..8083358,8083885..8084061,8085871..8086290)
FT                   /locus_tag="mCG_19632"
FT                   /product="mCG19632, transcript variant mCT20892"
FT                   /note="gene_id=mCG19632.2 transcript_id=mCT20892.1 created
FT                   on 26-JUL-2002"
FT   mRNA            join(8075458..8075517,8075970..8076059,8076454..8076581,
FT                   8078128..8078410,8078990..8079163,8079250..8079378,
FT                   8083195..8083358,8083885..8084061,8101264..8101868)
FT                   /locus_tag="mCG_19632"
FT                   /product="mCG19632, transcript variant mCT171086"
FT                   /note="gene_id=mCG19632.2 transcript_id=mCT171086.0 created
FT                   on 26-JUL-2002"
FT   mRNA            join(8075736..8076059,8076454..8076581,8078128..8078410,
FT                   8078990..8079163,8079250..8079378,8083195..8083358,
FT                   8085871..8086290)
FT                   /locus_tag="mCG_19632"
FT                   /product="mCG19632, transcript variant mCT171085"
FT                   /note="gene_id=mCG19632.2 transcript_id=mCT171085.0 created
FT                   on 26-JUL-2002"
FT   assembly_gap    8077125..8077177
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   CDS             join(8079315..8079378,8083195..8083358,8083885..8084061,
FT                   8101264..8101305)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19632"
FT                   /product="mCG19632, isoform CRA_b"
FT                   /note="gene_id=mCG19632.2 transcript_id=mCT171086.0
FT                   protein_id=mCP94003.0 isoform=CRA_b"
FT                   /protein_id="EDL34357.1"
FT                   /translation="MIDLYPRDSWNFVFGQASLSSGVGIFSFARYGKDFYTSKYEGNVT
FT                   SLQLTSPTDYSIFDNYYIPEITSVLLLRSCKTLTHEIGHILGLRHCQWLACLMQGSNHL
FT                   EESDRRPLNVCPICLRKLQSAIGFNIVERYRMNEERLQQQLQIE"
FT   CDS             join(8079315..8079378,8083195..8083358,8083885..8084061,
FT                   8085871..8086023)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19632"
FT                   /product="mCG19632, isoform CRA_c"
FT                   /note="gene_id=mCG19632.2 transcript_id=mCT20892.1
FT                   protein_id=mCP11935.1 isoform=CRA_c"
FT                   /protein_id="EDL34358.1"
FT                   /translation="MIDLYPRDSWNFVFGQASLSSGVGIFSFARYGKDFYTSKYEGNVT
FT                   SLQLTSPTDYSIFDNYYIPEITSVLLLRSCKTLTHEIGHILGLRHCQWLACLMQGSNHL
FT                   EESDRRPLNVCPICLRKLQSAIGFNIVERYRALVKWIDDESCNESGATPKSSSEHAHLP
FT                   KPVEAFKDWREWLMRCIALLEK"
FT   CDS             join(8079315..8079378,8083195..8083358,8085871..8086023)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19632"
FT                   /product="mCG19632, isoform CRA_a"
FT                   /note="gene_id=mCG19632.2 transcript_id=mCT171085.0
FT                   protein_id=mCP94004.0 isoform=CRA_a"
FT                   /protein_id="EDL34356.1"
FT                   /translation="MIDLYPRDSWNFVFGQASLSSGVGIFSFARYGKDFYTSKYEGNVT
FT                   SLQLTSPTDYSIFDNYYIPEITSVLLLRSCKALVKWIDDESCNESGATPKSSSEHAHLP
FT                   KPVEAFKDWREWLMRCIALLEK"
FT   assembly_gap    8086549..8086624
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    8088443..8089151
FT                   /estimated_length=709
FT                   /gap_type="unknown"
FT   assembly_gap    8091551..8091797
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    8095492..8095567
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    8100808..8100827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8102032..8124426)
FT                   /gene="Slc16a6"
FT                   /locus_tag="mCG_19635"
FT                   /note="gene_id=mCG19635.2"
FT   mRNA            complement(join(8102032..8102896,8104365..8105180,
FT                   8107979..8108107,8109294..8109437,8112837..8113075,
FT                   8124357..8124426))
FT                   /gene="Slc16a6"
FT                   /locus_tag="mCG_19635"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 6, transcript variant mCT171087"
FT                   /note="gene_id=mCG19635.2 transcript_id=mCT171087.0 created
FT                   on 26-JUL-2002"
FT   mRNA            complement(join(8102032..8102434,8102765..8102896,
FT                   8104365..8105180,8107979..8108107,8109294..8109437,
FT                   8112837..8113075,8122767..8123119))
FT                   /gene="Slc16a6"
FT                   /locus_tag="mCG_19635"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 6, transcript variant mCT171088"
FT                   /note="gene_id=mCG19635.2 transcript_id=mCT171088.0 created
FT                   on 26-JUL-2002"
FT   mRNA            complement(join(8102032..8102896,8104365..8105180,
FT                   8107979..8108107,8109294..8109437,8112837..8113075,
FT                   8122456..8122730))
FT                   /gene="Slc16a6"
FT                   /locus_tag="mCG_19635"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 6, transcript variant mCT20895"
FT                   /note="gene_id=mCG19635.2 transcript_id=mCT20895.2 created
FT                   on 26-JUL-2002"
FT   CDS             complement(join(8102400..8102434,8102765..8102896,
FT                   8104365..8105180,8107979..8108107,8109294..8109437,
FT                   8112837..8113068))
FT                   /codon_start=1
FT                   /gene="Slc16a6"
FT                   /locus_tag="mCG_19635"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 6, isoform CRA_b"
FT                   /note="gene_id=mCG19635.2 transcript_id=mCT171088.0
FT                   protein_id=mCP94005.0 isoform=CRA_b"
FT                   /protein_id="EDL34360.1"
FT                   /translation="MTQKNSKLCARANVYTQVPDGGWGWAVAVSFFFVEVFTYGIIKSF
FT                   GVFFNDLMDSFDESNSKISWIISICVFVLTFTAPLSTVLSNRFGHRLVVMAGGLLISLG
FT                   MITASFSQRVYHMYISIGVISGLGYCFSFLPTVTILSQYFDKRRSVVTAVASTGECFAV
FT                   FAFAPAITALKEHIGWRYSLLFVGLLQLNIMVCGALLRPIIIQGPGQSPKAVTLEPRRE
FT                   VQYMLENEKTRTSIDSIDSGVELTTSPKNVPSEAKMEQETRAEQQQTLVTAPKHSQMKA
FT                   PLLDFSVLKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDPDRAAFLLSTMAIAE
FT                   VFGRIGAGFVLNREPIRKIYIELICVILLTASLFAFTFATEFWGLMLCSVFFGSMVGTI
FT                   GGTHIPMLAEDDVVGIEKMSSAAGVYVFIQSISGLAGPPLAGLLVDQSKIYSRAFYSCA
FT                   AGMCLAAVCLALVRPCKKGLCQNSHSGIQPCSVAIQR"
FT   CDS             complement(join(8102646..8102896,8104365..8105180,
FT                   8107979..8108107,8109294..8109437,8112837..8113068))
FT                   /codon_start=1
FT                   /gene="Slc16a6"
FT                   /locus_tag="mCG_19635"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 6, isoform CRA_a"
FT                   /note="gene_id=mCG19635.2 transcript_id=mCT171087.0
FT                   protein_id=mCP94006.0 isoform=CRA_a"
FT                   /db_xref="GOA:B1AT66"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:2144585"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1AT66"
FT                   /protein_id="EDL34359.1"
FT                   /translation="MTQKNSKLCARANVYTQVPDGGWGWAVAVSFFFVEVFTYGIIKSF
FT                   GVFFNDLMDSFDESNSKISWIISICVFVLTFTAPLSTVLSNRFGHRLVVMAGGLLISLG
FT                   MITASFSQRVYHMYISIGVISGLGYCFSFLPTVTILSQYFDKRRSVVTAVASTGECFAV
FT                   FAFAPAITALKEHIGWRYSLLFVGLLQLNIMVCGALLRPIIIQGPGQSPKAVTLEPRRE
FT                   VQYMLENEKTRTSIDSIDSGVELTTSPKNVPSEAKMEQETRAEQQQTLVTAPKHSQMKA
FT                   PLLDFSVLKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDPDRAAFLLSTMAIAE
FT                   VFGRIGAGFVLNREPIRKIYIELICVILLTASLFAFTFATEFWGLMLCSVFFGSMVGTI
FT                   GGTHIPMLAEDDVVGIEKMSSAAGVYVFIQSISGLAGPPLAGLLVDQSKIYSRAFYSCA
FT                   AGMCLAAVCLALVRPCKKGLCQNSHSGENQTDRQRGKALQDIPEDFLEMDLGKCEHRAH
FT                   MKMDPV"
FT   CDS             complement(join(8102646..8102896,8104365..8105180,
FT                   8107979..8108107,8109294..8109437,8112837..8113068))
FT                   /codon_start=1
FT                   /gene="Slc16a6"
FT                   /locus_tag="mCG_19635"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 6, isoform CRA_a"
FT                   /note="gene_id=mCG19635.2 transcript_id=mCT20895.2
FT                   protein_id=mCP11951.1 isoform=CRA_a"
FT                   /db_xref="GOA:B1AT66"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:2144585"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1AT66"
FT                   /protein_id="EDL34361.1"
FT                   /translation="MTQKNSKLCARANVYTQVPDGGWGWAVAVSFFFVEVFTYGIIKSF
FT                   GVFFNDLMDSFDESNSKISWIISICVFVLTFTAPLSTVLSNRFGHRLVVMAGGLLISLG
FT                   MITASFSQRVYHMYISIGVISGLGYCFSFLPTVTILSQYFDKRRSVVTAVASTGECFAV
FT                   FAFAPAITALKEHIGWRYSLLFVGLLQLNIMVCGALLRPIIIQGPGQSPKAVTLEPRRE
FT                   VQYMLENEKTRTSIDSIDSGVELTTSPKNVPSEAKMEQETRAEQQQTLVTAPKHSQMKA
FT                   PLLDFSVLKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDPDRAAFLLSTMAIAE
FT                   VFGRIGAGFVLNREPIRKIYIELICVILLTASLFAFTFATEFWGLMLCSVFFGSMVGTI
FT                   GGTHIPMLAEDDVVGIEKMSSAAGVYVFIQSISGLAGPPLAGLLVDQSKIYSRAFYSCA
FT                   AGMCLAAVCLALVRPCKKGLCQNSHSGENQTDRQRGKALQDIPEDFLEMDLGKCEHRAH
FT                   MKMDPV"
FT   assembly_gap    8109162..8109181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8119523..8119542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8126929..8126948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8127959..8127978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <8138070..8221136
FT                   /gene="Arsg"
FT                   /locus_tag="mCG_145523"
FT                   /note="gene_id=mCG145523.0"
FT   mRNA            join(<8138070..8138567,8164895..8165082,8169310..8169357,
FT                   8173036..8173147,8175399..8175536,8181562..8181758,
FT                   8182910..8182990,8195668..8195776,8205790..8205910,
FT                   8211021..8211111,8220059..8221136)
FT                   /gene="Arsg"
FT                   /locus_tag="mCG_145523"
FT                   /product="arylsulfatase G"
FT                   /note="gene_id=mCG145523.0 transcript_id=mCT184947.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<8138281..8138567,8164895..8165082,8169310..8169357,
FT                   8173036..8173147,8175399..8175536,8181562..8181758,
FT                   8182910..8182990,8195668..8195776,8205790..8205910,
FT                   8211021..8211111,8220059..8220333)
FT                   /codon_start=1
FT                   /gene="Arsg"
FT                   /locus_tag="mCG_145523"
FT                   /product="arylsulfatase G"
FT                   /note="gene_id=mCG145523.0 transcript_id=mCT184947.0
FT                   protein_id=mCP105792.0"
FT                   /protein_id="EDL34362.1"
FT                   /translation="NSRDSQWCSVIIYPRQRESSCLTMGWLFLKVLLVGMAFSGFFYPL
FT                   VDFSISGKTRAPQPNIVIILADDMGWGDLGANWAETKDTTNLDKMASEGMRFVDFHAAA
FT                   STCSPSRASLLTGRLGLRNGVTHNFAVTSVGGLPVNETTLAEVLRQEGYVTAMIGKWHL
FT                   GHHGSYHPNFRGFDYYFGIPYSNDMGCTDAPGYNYPPCPACPQRDGLWRNPGRDCYTDV
FT                   ALPLYENLNIVEQPVNLSGLAQKYAERAVEFIEQASTSGRPFLLYVGLAHMHVPLSVTP
FT                   PLAHPQRQSLYRASLREMDSLVGQIKDKVDHVARENTLLWFTGDNGPWAQKCELAGSVG
FT                   PFFGLWQTHQGGSPTKQTTWEGGHRVPALAYWPGRVPANVTSTALLSLLDIFPTVIALA
FT                   GASLPPNRKFDGRDVSEVLFGKSQMGHRVLFHPNSGAAGEYGALQTVRLNHYKAFYITG
FT                   GAKACDGSVGPEQHHVAPLIFNLEDAADEGMPLQKGSPEYQEVLQQVTRALADVLQDIA
FT                   DDNSSRADYTQDPSVIPCCNPYQTTCRCQPV"
FT   assembly_gap    8203957..8203976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8221171..8259413)
FT                   /gene="Wipi1"
FT                   /locus_tag="mCG_19633"
FT                   /note="gene_id=mCG19633.1"
FT   mRNA            complement(join(8221171..8221807,8224897..8224997,
FT                   8225415..8225533,8226131..8226238,8227467..8227631,
FT                   8230212..8230319,8230967..8231037,8231915..8232007,
FT                   8232935..8233032,8244943..8245039,8251514..8251683,
FT                   8253760..8253842,8259269..8259413))
FT                   /gene="Wipi1"
FT                   /locus_tag="mCG_19633"
FT                   /product="WD repeat domain, phosphoinositide interacting 1,
FT                   transcript variant mCT20893"
FT                   /note="gene_id=mCG19633.1 transcript_id=mCT20893.2 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(8221760..8221807,8224897..8224997,
FT                   8225415..8225533,8226131..8226238,8227467..8227631,
FT                   8230212..8230319,8230967..8231037,8231915..8232007,
FT                   8232935..8233032,8244943..8245039,8251514..8251683,
FT                   8253760..8253842,8259269..8259348))
FT                   /codon_start=1
FT                   /gene="Wipi1"
FT                   /locus_tag="mCG_19633"
FT                   /product="WD repeat domain, phosphoinositide interacting 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19633.1 transcript_id=mCT20893.2
FT                   protein_id=mCP11947.2 isoform=CRA_c"
FT                   /protein_id="EDL34365.1"
FT                   /translation="MEAEAADAPPGRVEAALSCFSFNQDCTSLAIGTKAGYKLFSLSSV
FT                   EQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNIL
FT                   SIRLNRQRLLVCLEESIYIHNIKDMKLLKTVLDIPSNPTGLCALSINHSNSYLAYPGSQ
FT                   STGEIVLYDGNSLKTVCTIAAHEGTLAAITFNSSGSKLASASEKGTVIRVFSVPEGQKL
FT                   YEFRRGMKRYVTISSLVFSMDSQFLCASSNTETVHIFKMEHLTDSRPEEPSTWSGYMGK
FT                   MFMAATNYLPAQVSDMMNQDRAFATGRLNFSGQKNICTLSTIQKLPRLLVASSDGHLYI
FT                   YNLDPQDGGECVLIKTHSLLSSGTTEENKENDLRPSLPPSYAATVARPSTSAASTVPGY
FT                   SEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGSQKGKTKQS"
FT   mRNA            complement(join(8224058..8224997,8225415..8225533,
FT                   8226131..8226238,8227467..8227552,8230212..8230319,
FT                   8230967..8231037,8231915..8232007,8232935..8233032,
FT                   8244943..8245039,8251514..8251683,8253760..8253842,
FT                   8259269..>8259393))
FT                   /gene="Wipi1"
FT                   /locus_tag="mCG_19633"
FT                   /product="WD repeat domain, phosphoinositide interacting 1,
FT                   transcript variant mCT193199"
FT                   /note="gene_id=mCG19633.1 transcript_id=mCT193199.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(8224058..8224997,8225415..8225533,
FT                   8226131..8226238,8227467..8227631,8230212..8230319,
FT                   8230967..8231037,8231915..8232007,8232935..8233032,
FT                   8244943..8245039,8251514..8251683,8253760..8253842,
FT                   8259269..8259393))
FT                   /gene="Wipi1"
FT                   /locus_tag="mCG_19633"
FT                   /product="WD repeat domain, phosphoinositide interacting 1,
FT                   transcript variant mCT173445"
FT                   /note="gene_id=mCG19633.1 transcript_id=mCT173445.0 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(8224876..8224997,8225415..8225533,
FT                   8226131..8226238,8227467..8227631,8230212..8230319,
FT                   8230967..8231037,8231915..8232007,8232935..8233032,
FT                   8244943..8245039,8251514..8251683,8253760..8253842,
FT                   8259269..8259348))
FT                   /codon_start=1
FT                   /gene="Wipi1"
FT                   /locus_tag="mCG_19633"
FT                   /product="WD repeat domain, phosphoinositide interacting 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19633.1 transcript_id=mCT173445.0
FT                   protein_id=mCP96364.0 isoform=CRA_a"
FT                   /protein_id="EDL34363.1"
FT                   /translation="MEAEAADAPPGRVEAALSCFSFNQDCTSLAIGTKAGYKLFSLSSV
FT                   EQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNIL
FT                   SIRLNRQRLLVCLEESIYIHNIKDMKLLKTVLDIPSNPTGLCALSINHSNSYLAYPGSQ
FT                   STGEIVLYDGNSLKTVCTIAAHEGTLAAITFNSSGSKLASASEKGTVIRVFSVPEGQKL
FT                   YEFRRGMKRYVTISSLVFSMDSQFLCASSNTETVHIFKMEHLTDSRPEEPSTWSGYMGK
FT                   MFMAATNYLPAQVSDMMNQDRAFATGRLNFSGQKNICTLSTIQKLPRLLVASSDGHLYI
FT                   YNLDPQDGGECVLIKTHSLLSSGTTEENKENDLRPSLPPSYAATVARPSTSAASTVPGY
FT                   SEDGGALRGEVIPEHEFATGPVCLDDENEFPPVSIRNP"
FT   CDS             complement(join(8227540..8227552,8230212..8230319,
FT                   8230967..8231037,8231915..8232007,8232935..8233032,
FT                   8244943..8245039,8251514..8251683,8253760..8253842,
FT                   8259269..>8259393))
FT                   /codon_start=1
FT                   /gene="Wipi1"
FT                   /locus_tag="mCG_19633"
FT                   /product="WD repeat domain, phosphoinositide interacting 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19633.1 transcript_id=mCT193199.0
FT                   protein_id=mCP114157.0 isoform=CRA_b"
FT                   /protein_id="EDL34364.1"
FT                   /translation="GCPPLRAAASRVEPPMEAEAADAPPGRVEAALSCFSFNQDCTSLA
FT                   IGTKAGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMNVYHFK
FT                   KGTEICNYSYSSNILSIRLNRQRLLVCLEESIYIHNIKDMKLLKTVLDIPSNPTGLCAL
FT                   SINHSNSYLAYPGSQSTGEIVLYDGNSLKTVCTIAAHEGTLAAITFNSSGSKLASASEK
FT                   GTVIRVFSVPEGQKLYEFRRGMKRYVTISSLVFSMDSQFLCASSNTETVHIFKMEHLTD
FT                   RCRT"
FT   assembly_gap    8245304..8245404
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    8251767..8251786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8256390..8256553
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   gene            8264356..8290140
FT                   /locus_tag="mCG_148179"
FT                   /note="gene_id=mCG148179.0"
FT   mRNA            join(8264356..8264410,8288864..8290140)
FT                   /locus_tag="mCG_148179"
FT                   /product="mCG148179"
FT                   /note="gene_id=mCG148179.0 transcript_id=mCT188442.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    8265300..8265533
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    8272956..8273765
FT                   /estimated_length=810
FT                   /gap_type="unknown"
FT   CDS             8289150..8289284
FT                   /codon_start=1
FT                   /locus_tag="mCG_148179"
FT                   /product="mCG148179"
FT                   /note="gene_id=mCG148179.0 transcript_id=mCT188442.0
FT                   protein_id=mCP109356.0"
FT                   /protein_id="EDL34366.1"
FT                   /translation="MMMMMMTTVVVVVVVCVCVHTCVLECVGLCMHMYGYTYHVEVRG"
FT   gene            8297810..8318000
FT                   /gene="Prkar1a"
FT                   /locus_tag="mCG_19628"
FT                   /note="gene_id=mCG19628.2"
FT   mRNA            join(8297810..8297878,8298792..8298975,8302128..8302310,
FT                   8308348..8308518,8309384..8309475,8309637..8309698,
FT                   8310625..8310671,8311298..8311456,8313108..8313168,
FT                   8314217..8314338,8314996..8315077,8315782..8318000)
FT                   /gene="Prkar1a"
FT                   /locus_tag="mCG_19628"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   I, alpha, transcript variant mCT173444"
FT                   /note="gene_id=mCG19628.2 transcript_id=mCT173444.0 created
FT                   on 20-SEP-2002"
FT   mRNA            join(8299287..8299423,8302128..8302310,8308348..8308518,
FT                   8309384..8309475,8309637..8309698,8310625..8310671,
FT                   8311298..8311456,8313108..8313168,8314217..8314338,
FT                   8314996..8315077,8315782..8317984)
FT                   /gene="Prkar1a"
FT                   /locus_tag="mCG_19628"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   I, alpha, transcript variant mCT20888"
FT                   /note="gene_id=mCG19628.2 transcript_id=mCT20888.2 created
FT                   on 20-SEP-2002"
FT   CDS             join(8302134..8302310,8308348..8308518,8309384..8309475,
FT                   8309637..8309698,8310625..8310671,8311298..8311456,
FT                   8313108..8313168,8314217..8314338,8314996..8315077,
FT                   8315782..8315954)
FT                   /codon_start=1
FT                   /gene="Prkar1a"
FT                   /locus_tag="mCG_19628"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   I, alpha, isoform CRA_a"
FT                   /note="gene_id=mCG19628.2 transcript_id=mCT173444.0
FT                   protein_id=mCP96363.0 isoform=CRA_a"
FT                   /protein_id="EDL34367.1"
FT                   /translation="MASGSMATSEEERSLRECELYVQKHNIQALLKDSIVQLCTTRPER
FT                   PMAFLREYFERLEKEEARQIQCLQKTGIRTDSREDEISPPPPNPVVKGRRRRGAISAEV
FT                   YTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGET
FT                   VIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVK
FT                   LWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQK
FT                   IVVQGEPGDEFFIILEGTAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVV
FT                   ARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV"
FT   CDS             join(8302134..8302310,8308348..8308518,8309384..8309475,
FT                   8309637..8309698,8310625..8310671,8311298..8311456,
FT                   8313108..8313168,8314217..8314338,8314996..8315077,
FT                   8315782..8315954)
FT                   /codon_start=1
FT                   /gene="Prkar1a"
FT                   /locus_tag="mCG_19628"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   I, alpha, isoform CRA_a"
FT                   /note="gene_id=mCG19628.2 transcript_id=mCT20888.2
FT                   protein_id=mCP11949.2 isoform=CRA_a"
FT                   /protein_id="EDL34368.1"
FT                   /translation="MASGSMATSEEERSLRECELYVQKHNIQALLKDSIVQLCTTRPER
FT                   PMAFLREYFERLEKEEARQIQCLQKTGIRTDSREDEISPPPPNPVVKGRRRRGAISAEV
FT                   YTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGET
FT                   VIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVK
FT                   LWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQK
FT                   IVVQGEPGDEFFIILEGTAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVV
FT                   ARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV"
FT   gene            complement(8321273..8370628)
FT                   /gene="BC029169"
FT                   /locus_tag="mCG_19630"
FT                   /note="gene_id=mCG19630.1"
FT   mRNA            complement(join(8321273..8321916,8322976..8323035,
FT                   8323459..8323540,8324196..8324305,8325507..8325687,
FT                   8326124..8326239,8326709..8326801,8331190..8331268,
FT                   8332975..8333025,8333680..8333864,8369685..8370628))
FT                   /gene="BC029169"
FT                   /locus_tag="mCG_19630"
FT                   /product="cDNA sequence BC029169"
FT                   /note="gene_id=mCG19630.1 transcript_id=mCT20889.2 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(8321652..8321916,8322976..8323035,
FT                   8323459..8323540,8324196..8324305,8325507..8325687,
FT                   8326124..8326239,8326709..8326801,8331190..8331268,
FT                   8332975..8333025,8333680..8333864,8369685..8370088))
FT                   /codon_start=1
FT                   /gene="BC029169"
FT                   /locus_tag="mCG_19630"
FT                   /product="cDNA sequence BC029169"
FT                   /note="gene_id=mCG19630.1 transcript_id=mCT20889.2
FT                   protein_id=mCP11943.2"
FT                   /protein_id="EDL34369.1"
FT                   /translation="MPGLRRDRLLALLLLGALFSADLYFHLWPQVQRQLRPGERPAACP
FT                   CSGRAPSASLHSAAASRDLGTASHNFSGALPRVEHPSRGHPAPRSKLQALFAHSLYQVL
FT                   EDPPLLGPEDWLLASQEALRYYRRKVARWNRRHKIYKEQFNLTSLDPPLQFRPEASWVQ
FT                   FHLGINSHGLYSRSSLAISKLLHDMRHFPTISADYSQDEKALLGACDCSQIVKPSGVHL
FT                   KLVLRFSDFGKAMFKPMRQQREEETPEDFFYFIDFQRHNAEIAAFHLDRILDFRRVPPT
FT                   VGRLVNVTKEILEVTKNEILQSVFFVSPANNVCFFAKCPYMCKTEYAVCGNPHLLEGSL
FT                   SAFLPSLNLAPRLSVPNPWIRSYSLSGKEEWELNPLYCDTVKQIYPYNSSNRLLGIIDM
FT                   AVFDFLIGNMDRHHYEMFTKFGDDGYLIHLDNARGFGRHSQDEISILAPLAQCCMIKRK
FT                   TLLHLQLLAQADYRLSDVMRESLLEDQLSPVLTEPHLLALDRRLQIILKTVEDCIEAHG
FT                   ERRVIAEGSAQRSAPDSGQANLTS"
FT   assembly_gap    8331905..8331924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8338986..8339803
FT                   /locus_tag="mCG_64236"
FT                   /note="gene_id=mCG64236.2"
FT   mRNA            8338986..8339803
FT                   /locus_tag="mCG_64236"
FT                   /product="mCG64236"
FT                   /note="gene_id=mCG64236.2 transcript_id=mCT64419.2 created
FT                   on 20-SEP-2002"
FT   CDS             8339116..8339415
FT                   /codon_start=1
FT                   /locus_tag="mCG_64236"
FT                   /product="mCG64236"
FT                   /note="gene_id=mCG64236.2 transcript_id=mCT64419.2
FT                   protein_id=mCP33705.2"
FT                   /protein_id="EDL34370.1"
FT                   /translation="MAQVKGKDHQPITKNEMAQVKGKDHQPITKDEMAQVKGKDHQPIT
FT                   KNEMAQVKGKDHQPITKNEMAQVKGKDHQPITKNEMAQVKGKDHQPIIIRLFPG"
FT   assembly_gap    8362613..8362708
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    8388725..8390553
FT                   /estimated_length=1829
FT                   /gap_type="unknown"
FT   assembly_gap    8392020..8395171
FT                   /estimated_length=3152
FT                   /gap_type="unknown"
FT   gene            complement(8417227..>8435498)
FT                   /locus_tag="mCG_1042115"
FT                   /note="gene_id=mCG1042115.1"
FT   mRNA            complement(join(8417227..8417587,8419658..8419773,
FT                   8426413..8426543,8433130..8433332,8435444..>8435498))
FT                   /locus_tag="mCG_1042115"
FT                   /product="mCG1042115"
FT                   /note="gene_id=mCG1042115.1 transcript_id=mCT159819.1
FT                   created on 20-SEP-2002"
FT   CDS             complement(join(8417505..8417587,8419658..8419773,
FT                   8426413..8426543,8433130..8433332,8435444..8435498))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042115"
FT                   /product="mCG1042115"
FT                   /note="gene_id=mCG1042115.1 transcript_id=mCT159819.1
FT                   protein_id=mCP75225.1"
FT                   /protein_id="EDL34371.1"
FT                   /translation="MMGADMDTDMGDDMGKNMGGVLLVSIESKARSAQRAEVSASTIVF
FT                   RSAGQHQCVDERKPWTWYPSLSNTEREDNDPHLTLKVLVYKDPEVLDNPEIKLLLFSVE
FT                   QVKCVGITRGWKSDQNKESQPLETRSGECAKHFSRSRSRRAMPGAFTLCHVGMVLHPQT
FT                   QDTVGGTGITSALHPGSWGWNSGPDACKASTY"
FT   assembly_gap    8417990..8418109
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   gene            complement(8436517..8475838)
FT                   /locus_tag="mCG_19638"
FT                   /note="gene_id=mCG19638.2"
FT   mRNA            complement(join(8436517..8437050,8439865..8440023,
FT                   8442335..8442508,8445507..8445640,8461759..8461946,
FT                   8475648..8475837))
FT                   /locus_tag="mCG_19638"
FT                   /product="mCG19638, transcript variant mCT20891"
FT                   /note="gene_id=mCG19638.2 transcript_id=mCT20891.1 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(8436943..8437050,8439865..8440023,
FT                   8442335..8442508,8445507..8445640,8461759..8461946,
FT                   8475648..8475715))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19638"
FT                   /product="mCG19638, isoform CRA_b"
FT                   /note="gene_id=mCG19638.2 transcript_id=mCT20891.1
FT                   protein_id=mCP11948.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V0S8"
FT                   /db_xref="MGI:MGI:1916574"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V0S8"
FT                   /protein_id="EDL34373.1"
FT                   /translation="MSHFNNWKSAQTSQSLTSQDSIRVSHERKSENKNHEELPESHHSS
FT                   HGQDKEGVWLPGSRTEEAEEDPAAEEGPFLSKTELQKDTQGACDSKVVGQGRELSPPTT
FT                   KSIRIYDASPFSSYPLQAEKMSPHRRARMARLPQQGPFRHLMDMKAEKRLAGWKERRSR
FT                   FGDINVHKCYQFGQVFSPFQALATTEMRRLVLPRDLPMSSHRRRINPSSLGDMNLQDSP
FT                   LSPELTLGNDDGHHEKDKPVHHSIIRVLSHVMDVTEASNLCLHLITAPGRLFHP"
FT   mRNA            complement(join(8439790..8440023,8442335..8442508,
FT                   8445507..8445640,8461759..8461946,8475648..8475838))
FT                   /locus_tag="mCG_19638"
FT                   /product="mCG19638, transcript variant mCT173446"
FT                   /note="gene_id=mCG19638.2 transcript_id=mCT173446.0 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(8439796..8440023,8442335..8442508,
FT                   8445507..8445640,8461759..8461946,8475648..8475715))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19638"
FT                   /product="mCG19638, isoform CRA_a"
FT                   /note="gene_id=mCG19638.2 transcript_id=mCT173446.0
FT                   protein_id=mCP96365.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DAE9"
FT                   /db_xref="MGI:MGI:1916574"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DAE9"
FT                   /protein_id="EDL34372.1"
FT                   /translation="MSHFNNWKSAQTSQSLTSQDSIRVSHERKSENKNHEELPESHHSS
FT                   HGQDKEGVWLPGSRTEEAEEDPAAEEGPFLSKTELQKDTQGACDSKVVGQGRELSPPTT
FT                   KSIRIYDASPFSSYPLQAEKMSPHRRARMARLPQQGPFRHLMDMKAEKRLAGWKERRSR
FT                   FGDINVHKCYQFGQVFSPFQALATTEMRRLVLPRDLPMSSHRRRINPSSLGDMNLQDSP
FT                   LSPELTLGNDDGHHEKDKPVSHIKKPLFPPIVKTMKYNDMK"
FT   assembly_gap    8449974..8449993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8451926..8452048
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    8462515..8463363
FT                   /estimated_length=849
FT                   /gap_type="unknown"
FT   assembly_gap    8476389..8476592
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   gene            8493828..8496430
FT                   /locus_tag="mCG_1042116"
FT                   /note="gene_id=mCG1042116.0"
FT   mRNA            join(8493828..8494019,8495601..8495641,8496271..8496430)
FT                   /locus_tag="mCG_1042116"
FT                   /product="mCG1042116"
FT                   /note="gene_id=mCG1042116.0 transcript_id=mCT159820.0
FT                   created on 20-SEP-2002"
FT   CDS             join(8493971..8494019,8495601..8495641,8496271..8496417)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042116"
FT                   /product="mCG1042116"
FT                   /note="gene_id=mCG1042116.0 transcript_id=mCT159820.0
FT                   protein_id=mCP75237.1"
FT                   /protein_id="EDL34374.1"
FT                   /translation="MRLRAVCCCCAGRGQMVLAIKPRTSHMLFKVTSVDRLKNLVLLSK
FT                   ICKENHTIVYPNWDKISKTIKSRKNYNTEKITK"
FT   assembly_gap    8517720..8518114
FT                   /estimated_length=395
FT                   /gap_type="unknown"
FT   assembly_gap    8519545..8519564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8521334..8521353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8525385..8525404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8530327..8530389
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    8550365..8550462
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    8553389..8553583
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    8561866..8562055
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    8577741..8577760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8581386..>8641986)
FT                   /locus_tag="mCG_118047"
FT                   /note="gene_id=mCG118047.0"
FT   mRNA            complement(join(8581386..8581731,8581843..8581898,
FT                   8582862..8582941,8583488..8583628,8583843..8583962,
FT                   8584853..8584947,8585039..8585114,8585585..8585745,
FT                   8587958..8588049,8588692..8588809,8589383..8589503,
FT                   8592913..8593004,8593391..8593453,8594211..8594330,
FT                   8595908..8596021,8596170..8596343,8596765..8596872,
FT                   8598689..8598826,8599635..8599762,8601173..8601339,
FT                   8603201..8603396,8607928..8608047,8608715..8608854,
FT                   8611075..8611165,8612815..8612953,8613163..8613282,
FT                   8613724..8613899,8615196..8615306,8615952..8616010,
FT                   8617819..8617987,8619805..8619952,8620642..8620827,
FT                   8621124..8621265,8622571..8622797,8623904..8624007,
FT                   8625996..8626157,8626984..8627188,8627812..8627913,
FT                   8641749..>8641986))
FT                   /locus_tag="mCG_118047"
FT                   /product="mCG118047, transcript variant mCT119195"
FT                   /note="gene_id=mCG118047.0 transcript_id=mCT119195.2
FT                   created on 02-APR-2003"
FT   mRNA            complement(join(8581393..8581731,8581843..8581898,
FT                   8582862..8582941,8583488..8583628,8583843..8583962,
FT                   8584853..8584947,8585039..8585114,8585585..8585745,
FT                   8587958..8588049,8588692..8588809,8589383..8589503,
FT                   8592913..8593004,8593391..8593453,8594211..8594330,
FT                   8595908..8596021,8596170..8596343,8596765..8596872,
FT                   8598689..8598826,8599635..8599769,8601173..8601339,
FT                   8603201..8603396,8607928..8608047,8608715..8608854,
FT                   8611075..8611165,8612815..8612953,8613163..8613282,
FT                   8613724..8613899,8615196..8615306,8615952..8616010,
FT                   8617819..8617987,8619805..8619952,8620642..8620827,
FT                   8621124..8621265,8622571..8622797,8623904..8624007,
FT                   8625996..8626157,8626984..8627188,8627812..8627913,
FT                   8641749..>8641953))
FT                   /locus_tag="mCG_118047"
FT                   /product="mCG118047, transcript variant mCT193183"
FT                   /note="gene_id=mCG118047.0 transcript_id=mCT193183.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(8581630..8581731,8581843..8581898,
FT                   8582862..8582941,8583488..8583628,8583843..8583962,
FT                   8584853..8584947,8585039..8585114,8585585..8585745,
FT                   8587958..8588049,8588692..8588809,8589383..8589503,
FT                   8592913..8593004,8593391..8593453,8594211..8594330,
FT                   8595908..8596021,8596170..8596343,8596765..8596872,
FT                   8598689..8598826,8599635..8599762,8601173..8601339,
FT                   8603201..8603396,8607928..8608047,8608715..8608854,
FT                   8611075..8611165,8612815..8612953,8613163..8613282,
FT                   8613724..8613899,8615196..8615306,8615952..8616010,
FT                   8617819..8617987,8619805..8619952,8620642..8620827,
FT                   8621124..8621265,8622571..8622797,8623904..8624007,
FT                   8625996..8626157,8626984..8627188,8627812..8627913,
FT                   8641749..>8641790))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118047"
FT                   /product="mCG118047, isoform CRA_a"
FT                   /note="gene_id=mCG118047.0 transcript_id=mCT119195.2
FT                   protein_id=mCP75093.2 isoform=CRA_a"
FT                   /protein_id="EDL34375.1"
FT                   /translation="LNGAAGVPAWHFPKGNMIKREISVRQQTCALLQKNLLKKWRLKRE
FT                   SLMEWVSSLLLLLFLYWYPHGHGATDLSSVPTKDLGRVDSFRQSGFMIGYTPVTSMTQQ
FT                   IMEKVAATPFMADKKVLGLLDEENIKELTESHAEIIRVIFSDTFSYHLKFQFDQRIPTS
FT                   RELRDHNAHCDGLYEDVNCLIAIFWKEGFVALQAAINAAIIETTTNHSVMEELLSVSGK
FT                   FMKIHPFVRQEGILTDFFIFTCIISFSPITYYVSINVARERKRMKGLMMMMGLRDPAFW
FT                   LSWGLLYAGFVFIMALSLALVIKSVQFFILTSFMVVFSLFLLYGLSMITLAFLMSALVR
FT                   KSVLTGLSVFLLTIFWGSLGFTSLYRYLPAPVEWTLSLFSPFAFTLGMAQLLRVDYDLN
FT                   SNAPPDPASGSNLIIATNFMLVFDAFLYLALMMYFEKVLPNEYGHQHSPLFFLKSSFWL
FT                   QTRKPAHVILEDGIDPVPSSGDSFEPVSPEFHGKESIRIRNISKEYKGKPNKIEALKDL
FT                   TLDIYEGQITAVLGHSGAGKSTLLNILSGLSVPTKGSVTIYNNNLSEMADLENILRIAG
FT                   VCPQANVQFDFLTVRENLRLFAKIRGIPPQDVEKEVQRVLLELEMKNIQNILAQNLSGG
FT                   QKRKLTFGIAILGDSQIFLLDEPTAGLDPFSRHRVWNLLKERRADRVVLFSTQFMDEAD
FT                   ILADRKVFISNGRLKCAGSSLFLKKKWGVGYHLSLQLKEVCVPENITSLVKQHIPAAKL
FT                   SAEGEGKLLYTLPLETTYRFPELCQSLDSCPGLGIENYGVSMTTLNEVFLKLEGKASID
FT                   EPEVDIVGEGQTERSGDTERLMEMEQTLSSLRETEKTDGMALWRQQTCAIAKVRLLKLK
FT                   HERKTLLSVLLILVVGICPFLFENISTKIRQSSYTWELSPHDYFLAPGQQPQGMLTQLL
FT                   IINKTALTTLSILWERQNIALEVDASGTRDGTDDPSYNGALIVSGNEKNHSFSFACNTK
FT                   RLNCFPVLMDILSNGLLGMVKPSARIQTDRSTYLMDETIHPLEDLWKTAFWLILTSACP
FT                   PYIAMSSVTDYKNRAWFQLRVSGLFPSAYWVGQAMVDIPLYCFVFLFMSLMDYLFRFPD
FT                   TMFSIISHVIQIPCSVGYAISLIFLTYVISFISRKGKKNSGIWSLSFYIITVFSVAVIL
FT                   LAFDVDGTQYYIIFLIPPSTLVGCLILSLHLFIGQIFEEGQVIEPFLVFLIPFLHVFIF
FT                   IFTLRCLEWKFGKKTMRKDPIFRISPRNNDVYQNPEEPEDEDEDVQMERMRTANALVST
FT                   SFDEKPVIIASCLRKEYAGKQKHCLSKKKAKIATRNVSFCVRKGEILGLLGHNGAGKST
FT                   SLKMISGDTKVTAGQVLLKGSREGDTPGFLGYCPQENALWPNLTVKEHLEIFAAVRGLR
FT                   KSHAAVAITRLADALKLQDQLKSPVKTLSEGVKRKLCFVLSILGNPSILLLDEPSTGLD
FT                   PEGQQQIWQAIRAIIKNTDRGALLTTHYMAEAEALCDRVAILVSGRLRCIGSIQHLKSK
FT                   FGKDYLLEMKVKTLEQVEPLNTEILRLFPQASRQERYSSLMAYKLPVEAVQPLSQAFFK
FT                   LEKVKQTFDLEEYSLSQSTLEQVFLELSKEQELDGLELEELDSSIKWKLLPQEEA"
FT   assembly_gap    8582574..8582705
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    8595388..8595407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(8599678..8599769,8601173..8601339,
FT                   8603201..8603396,8607928..8608047,8608715..8608854,
FT                   8611075..8611165,8612815..8612953,8613163..8613282,
FT                   8613724..8613899,8615196..8615306,8615952..8616010,
FT                   8617819..8617987,8619805..8619952,8620642..8620827,
FT                   8621124..8621265,8622571..8622797,8623904..8624007,
FT                   8625996..8626157,8626984..8627188,8627812..8627913,
FT                   8641749..>8641790))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118047"
FT                   /product="mCG118047, isoform CRA_b"
FT                   /note="gene_id=mCG118047.0 transcript_id=mCT193183.0
FT                   protein_id=mCP114137.0 isoform=CRA_b"
FT                   /protein_id="EDL34376.1"
FT                   /translation="LNGAAGVPAWHFPKGNMIKREISVRQQTCALLQKNLLKKWRLKRE
FT                   SLMEWVSSLLLLLFLYWYPHGHGATDLSSVPTKDLGRVDSFRQSGFMIGYTPVTSMTQQ
FT                   IMEKVAATPFMADKKVLGLLDEENIKELTESHAEIIRVIFSDTFSYHLKFQFDQRIPTS
FT                   RELRDHNAHCDGLYEDVNCLIAIFWKEGFVALQAAINAAIIETTTNHSVMEELLSVSGK
FT                   FMKIHPFVRQEGILTDFFIFTCIISFSPITYYVSINVARERKRMKGLMMMMGLRDPAFW
FT                   LSWGLLYAGFVFIMALSLALVIKSVQFFILTSFMVVFSLFLLYGLSMITLAFLMSALVR
FT                   KSVLTGLSVFLLTIFWGSLGFTSLYRYLPAPVEWTLSLFSPFAFTLGMAQLLRVDYDLN
FT                   SNAPPDPASGSNLIIATNFMLVFDAFLYLALMMYFEKVLPNEYGHQHSPLFFLKSSFWL
FT                   QTRKPAHVILEDGIDPVPSSGDSFEPVSPEFHGKESIRIRNISKEYKGKPNKIEALKDL
FT                   TLDIYEGQITAVLGHSGAGKSTLLNILSGLSVPTKGSVTIYNNNLSEMADLENILRIAG
FT                   VCPQANVQFDFLTVRENLRLFAKIRGIPPQDVEKEVQRVLLELEMKNIQNILAQNLSGG
FT                   QKRKLTFGIAILGDSQIFLLDEPTAGLDPFSRHRVWNLLKERRADRVVLFSTQFMDEAD
FT                   ILADRKVFISNGRLKCAGSSLFLKKKWGVGYHLSLQLKEVCVPENITSLVKQHIPAAKL
FT                   SAEGEGKLLYTLPLETTYRFPELCQSLDSCPGLGIENYGVSMTTLNEVFLKLEGKASID
FT                   EPEVDIVGEGQTERSGDTERLMEMEQTLSSLRETEKTDGMALWRQQTCAIAKVRLLKLK
FT                   HERKTLLSVLLILVVGICPFLFENISTKIRQSSYTWELSPHDYFLAPGQQPQGMLTQLL
FT                   IINKTEASIDDFIHSVGTPEHSFGSRCFWNQRWYR"
FT   assembly_gap    8644324..8645025
FT                   /estimated_length=702
FT                   /gap_type="unknown"
FT   assembly_gap    8662736..8662755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8668124..8668143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8671591..8737575)
FT                   /locus_tag="mCG_118044"
FT                   /note="gene_id=mCG118044.1"
FT   mRNA            complement(join(8671591..8672363,8672804..8672859,
FT                   8674087..8674166,8675875..8676015,8676237..8676356,
FT                   8676816..8676910,8677001..8677076,8677516..8677676,
FT                   8682447..8682538,8684299..8684416,8686457..8686577,
FT                   8688049..8688140,8688922..8688987,8696858..8696977,
FT                   8698974..8699087,8700441..8700614,8702269..8702376,
FT                   8703105..8703242,8704382..8704515,8705838..8706004,
FT                   8708980..8709178,8711120..8711239,8713980..8714119,
FT                   8714733..8714823,8715330..8715468,8715744..8715863,
FT                   8716268..8716443,8717375..8717485,8717783..8717841,
FT                   8719992..8720083,8721417..8721635,8724579..8724764,
FT                   8725028..8725169,8729265..8729491,8730117..8730220,
FT                   8732421..8732585,8735865..8736069,8737474..8737575))
FT                   /locus_tag="mCG_118044"
FT                   /product="mCG118044"
FT                   /note="gene_id=mCG118044.1 transcript_id=mCT119192.1
FT                   created on 20-SEP-2002"
FT   CDS             complement(join(8672265..8672363,8672804..8672859,
FT                   8674087..8674166,8675875..8676015,8676237..8676356,
FT                   8676816..8676910,8677001..8677076,8677516..8677676,
FT                   8682447..8682538,8684299..8684416,8686457..8686577,
FT                   8688049..8688140,8688922..8688987,8696858..8696977,
FT                   8698974..8699087,8700441..8700614,8702269..8702376,
FT                   8703105..8703242,8704382..8704515,8705838..8706004,
FT                   8708980..8709178,8711120..8711239,8713980..8714119,
FT                   8714733..8714823,8715330..8715468,8715744..8715863,
FT                   8716268..8716443,8717375..8717485,8717783..8717841,
FT                   8719992..8720083,8721417..8721635,8724579..8724764,
FT                   8725028..8725169,8729265..8729491,8730117..8730220,
FT                   8732421..8732550))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118044"
FT                   /product="mCG118044"
FT                   /note="gene_id=mCG118044.1 transcript_id=mCT119192.1
FT                   protein_id=mCP75395.1"
FT                   /protein_id="EDL34377.1"
FT                   /translation="MTELISMRFSDVVGVIFTNAYSYNLKFIKGARIPTIKEHQDHTAH
FT                   CHSYGEIIYCGLSEFWRDGFVALQAAINAAIIEVTTNHSVMEEMMSLTGKYIKIDSFVG
FT                   QEGTTTDCFLFFCIIRFSPLTYYISAGVTRERKKMKGLMAVMGLRDSAFWLSWGLLYGV
FT                   IVFVVTLLSTTIVKLVQFVFLTGFMVIFSLFFFYGLSLISLSFLMSVLLKKSFLTDLVV
FT                   FLLTVSCGSLGFTALYRYLPVSLEWLLSLLSPFAFMLGMVQLLRLDYDVNSNADPMGNP
FT                   NEVIGTIFMLFFDGVFYLLLTFYFEKVLPSKSFHDKTYWHACKSHFFLIDYSFYIRTAL
FT                   DNETDYEFSDDSFEPVSMEFHGKEAIRIRNLTKDYIQKSKRTEALKDLTLDVYKGQITA
FT                   ILGHSGAGKSTLLNVLSGLCVPTKGWVTIHNNKLSEMTDLENISKLTGVCPQCNVQFDF
FT                   LTVRENLRLFAKIKGIQAHEVDNEVQRVLLELDMKNTQNILVQNLSGGQKRKLTFGIAI
FT                   LGDPQIFLLDEPTAGLDPFSRHRVWNFLKERRADRVVLFSTQFMDEADILADRKVFISK
FT                   GKLKCAGSSLFLKKKWGIGYHLSLQLSETCVHERITSLVKQHIPDSKLSAESEGKLSYI
FT                   LPLERTNKFPDLYRDLERSPDLGIENYGVSITTLTEVFLKLEGKSSIDQSDIGMTEDVQ
FT                   AGGARSPERFAEVEQLVSLLNGRCKMKGGMALWWQQLCAVTRLRFLKLKHERKSIVILI
FT                   LVLGIGLLHILSANIYRMVRQSDYCWELAPHMYFLTPGQQPQPPLTNLLIVNKTGAKID
FT                   DFIHSLEQQNIALEVDAFGTRNGTEDSQYNGAIILSGDEKNYNFTLACNTKRLNCFPVL
FT                   VDIVSNGLLGLFAPSAHIQTDRSTFPEENDHRKFDYLAYFFLWVLLMACVPPYISMTSI
FT                   DDYKNRAQFQLWISGLSPSAYWFGQALFEVPVYCALILSIFIAFYASAPPESKFTVGDL
FT                   FIQILYVGGYAMSVIFMTYVISFIYRKGRKNSGLWSLCFYIVSFFSMCFMLIDYFRDIS
FT                   LFVLIALVPPATLGGCTLLHFENREFSEIIFEPEREYSYLFFLAPLLHFAIFVVILRCM
FT                   ERKFGMKTMRTDPVFRISPRSDRVFNNPEDPDGEDEDVSQERVWTANALTSADFQEKPA
FT                   IIASCLRKEYKGKKKCFVLKSKKKIATRNISFCVRKGEVVGLLGHNGAGKSTSIKMITG
FT                   ETKPSAGQVLLKGSSTGDTPGFLGYCPQENALWLNLTVREHLEIFAAIKGMRKSDANVA
FT                   IERLADALKLQDQLKSPVKTLSEGVKRKLCFVLSILGNPSVVLLDEPSTGMDPEGQQQM
FT                   WQAIQATFSNTERGALLTTHYMAEAEAVCDRVAIMVSGRLRCIGSIQHLKSKFGKEYLL
FT                   EMKVKTPSQVEPLNTEIMRLFPQAARQERYSSLMVYKLPREDVQPLSQAFFKLETVKQS
FT                   FDLEEYSLSQSTLEQVFLELSKEQELDGFEEELDPSVKWKLLPQEEA"
FT   assembly_gap    8689528..8689547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8742579..8742598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8746025..8814197)
FT                   /gene="Abca9"
FT                   /locus_tag="mCG_11458"
FT                   /note="gene_id=mCG11458.1"
FT   mRNA            complement(join(8746025..8747994,8748442..8748497,
FT                   8752452..8752531,8753058..8753198,8753393..8753512,
FT                   8754580..8754674,8754749..8754824,8756215..8756375,
FT                   8759120..8759211,8760106..8760223,8761326..8761446,
FT                   8762941..8763032,8763967..8764035,8766550..8766669,
FT                   8773247..8773360,8776652..8776825,8777854..8777961,
FT                   8780267..8780404,8781422..8781555,8782125..8782291,
FT                   8784221..8784416,8785606..8785725,8787619..8787758,
FT                   8790309..8790399,8790853..8790991,8791189..8791308,
FT                   8791601..8791776,8793018..8793128,8793325..8793383,
FT                   8794851..8795019,8798056..8798203,8800488..8800673,
FT                   8801265..8801406,8804291..8804517,8805064..8805167,
FT                   8806517..8806681,8809216..8809423,8811933..8812078,
FT                   8813987..8814197))
FT                   /gene="Abca9"
FT                   /locus_tag="mCG_11458"
FT                   /product="ATP-binding cassette transporter sub-family A
FT                   member 9"
FT                   /note="gene_id=mCG11458.1 transcript_id=mCT11631.2 created
FT                   on 23-SEP-2002"
FT   CDS             complement(join(8747896..8747994,8748442..8748497,
FT                   8752452..8752531,8753058..8753198,8753393..8753512,
FT                   8754580..8754674,8754749..8754824,8756215..8756375,
FT                   8759120..8759211,8760106..8760223,8761326..8761446,
FT                   8762941..8763032,8763967..8764035,8766550..8766669,
FT                   8773247..8773360,8776652..8776825,8777854..8777961,
FT                   8780267..8780404,8781422..8781555,8782125..8782291,
FT                   8784221..8784416,8785606..8785725,8787619..8787758,
FT                   8790309..8790399,8790853..8790991,8791189..8791308,
FT                   8791601..8791776,8793018..8793128,8793325..8793383,
FT                   8794851..8795019,8798056..8798203,8800488..8800673,
FT                   8801265..8801406,8804291..8804517,8805064..8805167,
FT                   8806517..8806681,8809216..8809423,8811933..8812028))
FT                   /codon_start=1
FT                   /gene="Abca9"
FT                   /locus_tag="mCG_11458"
FT                   /product="ATP-binding cassette transporter sub-family A
FT                   member 9"
FT                   /note="gene_id=mCG11458.1 transcript_id=mCT11631.2
FT                   protein_id=mCP12142.2"
FT                   /db_xref="GOA:Q8K449"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR026082"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:2386796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K449"
FT                   /protein_id="EDL34378.1"
FT                   /translation="MRKRHLRLGQQMWALLCKNWLRKFRMRRETLLEWLFSLLLILFVY
FT                   QLSSNLHQVHDAPEMSVVDLGRVDNFNDSNYMMVFAPESEATHEIMNKVASAPFMKGRT
FT                   IVACPDEKSMNELDLNYSIDAVRVIFKDTFSYHLKFSWGQRIPKTKEHKDHSAPCEPLN
FT                   NKMICENSAFWEKGFVAFQAAINAGIIEMITNHSVMEELMSVIGSNMKMPPFIAQGGVA
FT                   TDFFIFFCVISFSSLIYYLSVNITQERQYMTTLMAMMGLRESAFWLSWSLMYAGFILVV
FT                   AVLMSLIVKSAQVVVLTGFMVVFLLFLFYGLSLITLSFLMSVLIKKPFLTGLAIFILTV
FT                   FWGSLGFTALYKHLPAFVEWTLCFLSPFAFTTGMAQLIHLDYDVNSNVNLNSPNNSYLI
FT                   MATLFMLVLDALLYLVLALYFDKITLSKYGHQRSPLFFLKSSYWFKRRGASHVVLENEI
FT                   DSDPSLNDSLEPVSPEFQGKEAIRIKNLKKEYSGKHGKVEALRGLGFDIYEGQITALLG
FT                   HSGAGKTTLINTLSGLSPPTTGSVTIYNQTVSEMDDSDAVLTITGVCPQSNVQFGFLTV
FT                   RENLRLFAKIKGILPHEVEQEVQQVLQDLEMENIQDILAQNLSGGQKRKLTLGIAILGD
FT                   PQVLLLDEPTAGLDPLSRHRIWNLLKERRAGRVIVFSTQFMDEADILADRKVFISNGRL
FT                   KCAGSSLFLKKKWGIGYHLSLHLNEACDPEGITSLVKKHISDARLTTQSEERLVYILPL
FT                   ERTNKFPDLYRDLDRCSNQGIEDYGVSMTTLNEVFLKLEGKSMADESDVGICGRLQSDG
FT                   ARDMESLVELEQVLSLDSSGSSVSGMALWRQQLCAVAKVRFFKLKNERKSLMTVLLLFG
FT                   ISFVPQLLEHLVYKVYHKSYSWGLSPSMYFLSPGQPPQDPLTHLLVINRTGSSIDNFVH
FT                   ALRQQGIALDLDALGTRNGTEEALYNGAITVLGEEKALRFSVACNAKRLNCFPVLMDII
FT                   SNGLLGIFNSSERIQTDRSTVFEEHMLYEYGFMSNAFFWIPVAASLTPYIAMGSISDHK
FT                   KKVLSQLWTSGLYPSAYWCGQALVDIPIYFLILFLMQIMDSVFSSEEFISVMESLLIQI
FT                   PCSIGYASSLIFMTYVISFIFRNGRKNSGIWSFFFLIVTIFFIIATDINEYGFLELLIC
FT                   TFLVPPFTLIGSLLIFSEVSYDSVDYLGTSESQLVFLALLIPYLHFLLFFFILRCLERY
FT                   LRKKSLRVDPVFRISPRSCPAVPNPEEPGEEDEDVQMERVRTTGAMATLQTDEKPVIIA
FT                   SCLRKEYIGRTKRCFSKMKKKIATRNISFCVKKGEVLGLLGHNGAGKSTTISMITGDTI
FT                   PTAGQVFLKGSGGGAALGFLGYCPQENVLWPNLTVKEHLELYAAVKGLKKKDAVVTITR
FT                   LVNALKLQDHLKALVRTLSEGVKRKLCFVLSILGNPPVVLLDEPSTGMDPEGQQQMWQA
FT                   IRATFTNTERGALLTTHYMAEAEAVCDRVAIMVSGRLRCIGSIQHLKSKFGKDYLLEMK
FT                   VKTPSQVEPLNTEIMRLFPQAARQERYSSLMVYKLPVEDVRPLSEAFFKLERLKENFDL
FT                   EEYSLSQSTLEQVFLELSKEQELDDFGEEANSSVKWKLLPQEEL"
FT   assembly_gap    8751153..8751227
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    8774175..8774194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8786250..8786304
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    8807491..8807718
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   gene            complement(8820114..8981467)
FT                   /locus_tag="mCG_148173"
FT                   /note="gene_id=mCG148173.0"
FT   mRNA            complement(join(8820114..8820148,8980955..8981467))
FT                   /locus_tag="mCG_148173"
FT                   /product="mCG148173"
FT                   /note="gene_id=mCG148173.0 transcript_id=mCT188436.0
FT                   created on 13-JAN-2004"
FT   gene            complement(8822860..8899686)
FT                   /gene="Abca6"
FT                   /locus_tag="mCG_11466"
FT                   /note="gene_id=mCG11466.1"
FT   mRNA            complement(join(8822860..8823107,8823221..8823276,
FT                   8824809..8824888,8826246..8826386,8826548..8826667,
FT                   8828865..8828959,8829044..8829119,8830048..8830223,
FT                   8830652..8830743,8833064..8833181,8833865..8833985,
FT                   8834659..8834750,8836211..8836288,8839705..8839824,
FT                   8844539..8844652,8844852..8845025,8850188..8850295,
FT                   8856405..8856542,8857782..8857915,8859355..8859521,
FT                   8859889..8860072,8861844..8861960,8864246..8864385,
FT                   8865942..8866032,8866594..8866732,8866945..8867064,
FT                   8867271..8867446,8867809..8867919,8878309..8878367,
FT                   8879875..8880043,8881515..8881662,8884431..8884616,
FT                   8889358..8889499,8891990..8892216,8893041..8893144,
FT                   8895089..8895247,8896169..8896373,8898306..8898412,
FT                   8899496..8899686))
FT                   /gene="Abca6"
FT                   /locus_tag="mCG_11466"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   6"
FT                   /note="gene_id=mCG11466.1 transcript_id=mCT11637.2 created
FT                   on 23-SEP-2002"
FT   CDS             complement(join(8823006..8823107,8823221..8823276,
FT                   8824809..8824888,8826246..8826386,8826548..8826667,
FT                   8828865..8828959,8829044..8829119,8830048..8830223,
FT                   8830652..8830743,8833064..8833181,8833865..8833985,
FT                   8834659..8834750,8836211..8836288,8839705..8839824,
FT                   8844539..8844652,8844852..8845025,8850188..8850295,
FT                   8856405..8856542,8857782..8857915,8859355..8859521,
FT                   8859889..8860072,8861844..8861960,8864246..8864385,
FT                   8865942..8866032,8866594..8866732,8866945..8867064,
FT                   8867271..8867446,8867809..8867919,8878309..8878367,
FT                   8879875..8880043,8881515..8881662,8884431..8884616,
FT                   8889358..8889499,8891990..8892216,8893041..8893144,
FT                   8895089..8895247,8896169..8896373,8898306..8898401))
FT                   /codon_start=1
FT                   /gene="Abca6"
FT                   /locus_tag="mCG_11466"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   6"
FT                   /note="gene_id=mCG11466.1 transcript_id=mCT11637.2
FT                   protein_id=mCP12152.2"
FT                   /protein_id="EDL34380.1"
FT                   /translation="MKELSVHVRQQTRALLHKILLKKWRRKRESLLEWSIPIIIGLHMG
FT                   LFSYLARNIQVLEVPPQDLGSLNEFNGSSLVVVYTPISNITQQIMNKTTFAPTMKGTRI
FT                   IGVPSIEDLDEVLLHNIPDALGVIFNDSFSYQLKVLRMYGNPFLKEDLLAHCWDTHSQA
FT                   FCSLSKYWERGFVALQTAINAGIIEVTTNHSVMEELMSIDGINMKTLPFIPRDLSDYEI
FT                   FILFCLLYFSSFIYFASSNVTKERKQCKEVMKVMGLQDSAFWLSWGLIYVGFIFIISIF
FT                   IAIIITSTQIIMMTGFLVIFTLFFLYGLSLIAVTFLMAVLLQKAVLTNLIVLFFTLFWG
FT                   CVGFTVLHKELPPSLEWVLSIFSPFAFTSGMAKVIFQDYNLNGVVFPDPSGESYVMIAV
FT                   FFILAFDSLLYLVLALYFDKILLYGAEHRSAPLFFLNPTSCFRKTANRNKVIERDLDPE
FT                   LPSDEYFEPVDPEYQGKEAIRIRNIKKEYKGKSGKVKALKGLFLDIYESQITAILGHSG
FT                   AGKSSLLNILSGLYVPTAGSVTVYNKNLSDMQDLKEIRKAIGVCPQHNVQFDALTVKEN
FT                   LTLFAKIKGILPQDVEQEVQQILSELDMQNIRDDLAEHLSEGQKRKLTFGIATVGDPQI
FT                   LLLDEPTVGLDPFSRQRIWGFLKERRADHVILFSTQFMDEADILADRKVLIANGALKCT
FT                   GSSVFLKRKWGLGYHLSLFMDETCDSERLTSFINHHIPYAKLKAKTKEKLVYILPLERT
FT                   SEFPEFFSDLDKYSGQGLMSYEVSMSTLNDVFLNLEGEPSTKQDFEKRETATDSESLND
FT                   MEVVYPSLSQVQETVSTMSLWRMQVCAIARLRILKLKRERKAFLIILLLLGIALLPLVI
FT                   EYVANALLEVKNNWEFKTDLYFLSPGQLPQGLRTSLLVINNTESNIEDFLQSLKHQNIV
FT                   LEVDDFENRNATNSLSYNGAIIVSGRQKDYRFSAVCNTKRLHCFPILMNVISNGILHML
FT                   NHTQYIRIKEDIFSPFIVLVWTGIQETCLFILCVICSLSPHIAMSSVSDYKKKADSQLW
FT                   ISGLYPSAYWCGQAVVDISLFSGMLLTSYFTSYTSKLLNIDMTSEIVFSVIVLALGCAA
FT                   SLVFLTYVISFVFGKRKKNSTLWSICFLLVIAITFEKVANGPFNEALVISATMLVPSFA
FT                   LNGLLVVLEMRAYQYYIEFEEIKHGLSAVDLLLCLIPYIHTLLFIFVLRCLELKYGKNV
FT                   VRRDPIFRIAPQSLKAQPNPEEPIDEDENVQAERLRTSDALSTPNLDEKPVIIASCLHK
FT                   EYAGQKKHCCSRRTRNMAVRNVSFCVNKGEILGLLGPDGAGKSSSIRMIAGITKPTAGQ
FT                   VELKRLSSAVGHQGDSRAEFGYCPQENGLWPNLTVKEHLELYAAVKGLRKEDAVVAISR
FT                   LVNALKLHDQLNVQVQNLVAGATRKLCFVLSILGNSPVLILDEPSTGLDVSGKHQVWQA
FT                   IQAVVKDNEKGVLLSTHDLAEAEALCDRAAIMVSGRLRCIGPIQHLKRKFGQDYVLELR
FT                   VKDVSQEPLVHREILKLFPQAARQDRCFSLLTYKLPVTDVHPLSQAFHKLEAVKHGFDL
FT                   EDYSLSQCTLDRVILELSKEQELGTVYEEADMTLGRKLLPPSDEL"
FT   assembly_gap    8839622..8839641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8856207..8856237
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    8861379..8861398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8917221..8917908
FT                   /locus_tag="mCG_1042037"
FT                   /note="gene_id=mCG1042037.1"
FT   mRNA            8917221..8917908
FT                   /locus_tag="mCG_1042037"
FT                   /product="mCG1042037"
FT                   /note="gene_id=mCG1042037.1 transcript_id=mCT159741.1
FT                   created on 23-SEP-2002"
FT   CDS             8917513..8917701
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042037"
FT                   /product="mCG1042037"
FT                   /note="gene_id=mCG1042037.1 transcript_id=mCT159741.1
FT                   protein_id=mCP75331.1"
FT                   /protein_id="EDL34381.1"
FT                   /translation="MLPENVRWHCNKCETHDRNETLSDQQRIGKPTLTLVKLTVLFIFL
FT                   EDILKTSSKALSYHNWL"
FT   gene            complement(8920098..8987140)
FT                   /gene="Abca5"
FT                   /locus_tag="mCG_118045"
FT                   /note="gene_id=mCG118045.0"
FT   mRNA            complement(join(8920098..8920415,8921175..8921230,
FT                   8922169..8922248,8923113..8923262,8924303..8924422,
FT                   8925238..8925332,8925412..8925487,8926019..8926194,
FT                   8926957..8927048,8927140..8927257,8927474..8927600,
FT                   8933562..8933653,8934632..8934706,8935450..8935584,
FT                   8935931..8936044,8937659..8937829,8939954..8940067,
FT                   8941108..8941245,8941655..8941782,8945980..8946149,
FT                   8947550..8947751,8949406..8949525,8950884..8951023,
FT                   8951202..8951292,8952460..8952598,8953560..8953679,
FT                   8954317..8954492,8955712..8955822,8958871..8958929,
FT                   8959618..8959786,8960796..8960943,8962814..8963002,
FT                   8964009..8964150,8967188..8967417,8969278..8969366,
FT                   8976012..8976173,8977184..8977388,8978589..8978708,
FT                   8987018..8987140))
FT                   /gene="Abca5"
FT                   /locus_tag="mCG_118045"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   5, transcript variant mCT119193"
FT                   /note="gene_id=mCG118045.0 transcript_id=mCT119193.1
FT                   created on 02-APR-2003"
FT   mRNA            complement(join(8920099..8920415,8921175..8921230,
FT                   8922169..8922248,8923113..8923262,8924303..8924422,
FT                   8925238..8925332,8925412..8925487,8926019..8926194,
FT                   8926957..8927048,8927140..8927257,8927474..8927600,
FT                   8933562..8933653,8934632..8934706,8935450..8935584,
FT                   8935931..8936044,8937659..8937829,8939954..8940067,
FT                   8941108..8941245,8941655..8941782,8945980..8946149,
FT                   8947550..8947751,8949406..8949525,8950884..8951023,
FT                   8951202..8951292,8952460..8952598,8953560..8953679,
FT                   8954317..8954492,8955712..8955822,8958871..8958929,
FT                   8959618..8959786,8960796..8960943,8962814..8963002,
FT                   8964009..8964150,8967188..8967417,8969278..8969366,
FT                   8976012..8976173,8977184..8977388,8978589..8978708,
FT                   8986909..8987099))
FT                   /gene="Abca5"
FT                   /locus_tag="mCG_118045"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   5, transcript variant mCT181629"
FT                   /note="gene_id=mCG118045.0 transcript_id=mCT181629.0
FT                   created on 02-APR-2003"
FT   CDS             complement(join(8920308..8920415,8921175..8921230,
FT                   8922169..8922248,8923113..8923262,8924303..8924422,
FT                   8925238..8925332,8925412..8925487,8926019..8926194,
FT                   8926957..8927048,8927140..8927257,8927474..8927600,
FT                   8933562..8933653,8934632..8934706,8935450..8935584,
FT                   8935931..8936044,8937659..8937829,8939954..8940067,
FT                   8941108..8941245,8941655..8941782,8945980..8946149,
FT                   8947550..8947751,8949406..8949525,8950884..8951023,
FT                   8951202..8951292,8952460..8952598,8953560..8953679,
FT                   8954317..8954492,8955712..8955822,8958871..8958929,
FT                   8959618..8959786,8960796..8960943,8962814..8963002,
FT                   8964009..8964150,8967188..8967417,8969278..8969366,
FT                   8976012..8976173,8977184..8977388,8978589..8978690))
FT                   /codon_start=1
FT                   /gene="Abca5"
FT                   /locus_tag="mCG_118045"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   5, isoform CRA_a"
FT                   /note="gene_id=mCG118045.0 transcript_id=mCT119193.1
FT                   protein_id=mCP75422.1 isoform=CRA_a"
FT                   /protein_id="EDL34382.1"
FT                   /translation="MATAIRDVGVWRQTRTLLLKNYLIKCRTKKSSVQEILFPLFFLFW
FT                   LILVSMMHPNKKYEEVSDIELSPMDKFSLSNVILGYTPVTNITSSIMQRVSTDHLPKVI
FT                   VTEEYANEKELVAASLSKSSNFVGVVFKDTMSYELRFFPEMIPVSSIYMNSREGCSKTC
FT                   DAAQYWSLGFTVLQASIDAAIIQLKTNVSVWSELESTKAVIMGEAAVVEIDTFPRGVIL
FT                   IYLVIAFSPFGYFLAIHIVAEKEKKLKEFLKIMGLHDTAFWLSWVLLYASLIFLMSLLM
FT                   AVIATASSLFPQSSSIVIFLLFFLYGLSSVFFALMLTPLFKKSKHVGVVEFFVTVVFGF
FT                   VGLLIVLIESFPRSLVWLFSPLCQCAFLIGIAQVMHLEDFNEGALFSNLTEGPYPLIIT
FT                   IIMLALDSVFYVLLAVYLDQVIPGEFGLRRSSLYFLKPSYWSKNKRNYKELSEGNINGN
FT                   ISLNEIVEPVSSEFIGKEAIRISGIQKSYRKKTENVEALRNLSFDIYEGQITALLGHSG
FT                   TGKSTLMNILCGLCPPSDGFASIYGHRVSEIDEMFEARKMIGICPQSDINFDVLTVEEN
FT                   LSILASIKGIPANNIIQEVQKVLLDLDMQAIKDNQAKKLSGGQKRKLSVGIAVLGNPKI
FT                   LLLDEPTAGMDPCSRHIVWNLLKYRKANRVTVFSTHFMDEADILADRKAVISQGMLKCV
FT                   GSSIFLKSKWGIGYRLSMYIDRYCATESLSSLVRQHIPAAALLQQNDQQLVYSLPFKDM
FT                   DKFSGLFSALDIHSNLGVISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPREEETD
FT                   SKSFDEMEQSLLILSETKASSVSTMSLWKQQVSTIAKFHFLSLKRESKSVRAVLLLLLI
FT                   FFAVQIFMFFLHHSFKNAVVPIKLVPDLYFLKPGDKPHKYKTSLLLQNSTDSDINGLIE
FT                   FFAHQNIMVAMFNDSDYVSAAPHSAALNVVRSEKDYVFSAVFNSTMVYCLPVMMNIISN
FT                   YYLYHLNVTEAIQTWSTPFIQEITDIVFKIELYFQAALLGIIVTAMPPYFAMENAENHK
FT                   IKAYTQLKLSGLLPSAYWVGQAVVDIPLFFVVLILMLGSLFAFHHGLYFYPAKFLAVVF
FT                   CLIAYVPSVILFTYIASFTFKKILNTKEFWSFIYSVTALACVAITETTFFLQYAVTAVF
FT                   HYTFCIAIPIYPLLGCLISFIKGSWKNMPKNENTYNPWDRLLVAVIMPYLQCILWIFLL
FT                   QHYEKKHGGRSIRKDPFFRALSQKAKNKKFPEPPINEDEDEDVKAERLKVKELMGCQCC
FT                   EEKPAIMVCNLHKEYDDKKDFLHSRKTTKVATKYISFCVKKGEILGLLGPNGAGKSTVI
FT                   NTLVGDVEPTSGKIFLGDYGSHSSEDDESIKCMGYCPQTNPLWPDLTLQEHFEIYGAVK
FT                   GMSPGDMKEVISRITKALDLKEHLQKTVKKLPAGIKRKLCFALSMLGNPQVTLLDEPST
FT                   GMDPRAKQHMWRAIRTAFKNKKRAALLTTHYMEEAEAVCDRVAIMVSGQLRCIGTVQHL
FT                   KSKFGKGYFLEIKLKDWIENLEIDRLQREIQYIFPNASRQESFSSILAFKIPKEDVQSL
FT                   SQSFAKLEEAKRTFAIEEYSFSQATLEQVFVELTKEQEEEDNSCGTLASTLWWERTQED
FT                   RVVF"
FT   CDS             complement(join(8920308..8920415,8921175..8921230,
FT                   8922169..8922248,8923113..8923262,8924303..8924422,
FT                   8925238..8925332,8925412..8925487,8926019..8926194,
FT                   8926957..8927048,8927140..8927257,8927474..8927600,
FT                   8933562..8933653,8934632..8934706,8935450..8935584,
FT                   8935931..8936044,8937659..8937829,8939954..8940067,
FT                   8941108..8941245,8941655..8941782,8945980..8946149,
FT                   8947550..8947751,8949406..8949525,8950884..8951023,
FT                   8951202..8951292,8952460..8952598,8953560..8953679,
FT                   8954317..8954492,8955712..8955822,8958871..8958929,
FT                   8959618..8959786,8960796..8960943,8962814..8963002,
FT                   8964009..8964150,8967188..8967417,8969278..8969366,
FT                   8976012..8976173,8977184..8977388,8978589..8978690))
FT                   /codon_start=1
FT                   /gene="Abca5"
FT                   /locus_tag="mCG_118045"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   5, isoform CRA_a"
FT                   /note="gene_id=mCG118045.0 transcript_id=mCT181629.0
FT                   protein_id=mCP104551.0 isoform=CRA_a"
FT                   /protein_id="EDL34383.1"
FT                   /translation="MATAIRDVGVWRQTRTLLLKNYLIKCRTKKSSVQEILFPLFFLFW
FT                   LILVSMMHPNKKYEEVSDIELSPMDKFSLSNVILGYTPVTNITSSIMQRVSTDHLPKVI
FT                   VTEEYANEKELVAASLSKSSNFVGVVFKDTMSYELRFFPEMIPVSSIYMNSREGCSKTC
FT                   DAAQYWSLGFTVLQASIDAAIIQLKTNVSVWSELESTKAVIMGEAAVVEIDTFPRGVIL
FT                   IYLVIAFSPFGYFLAIHIVAEKEKKLKEFLKIMGLHDTAFWLSWVLLYASLIFLMSLLM
FT                   AVIATASSLFPQSSSIVIFLLFFLYGLSSVFFALMLTPLFKKSKHVGVVEFFVTVVFGF
FT                   VGLLIVLIESFPRSLVWLFSPLCQCAFLIGIAQVMHLEDFNEGALFSNLTEGPYPLIIT
FT                   IIMLALDSVFYVLLAVYLDQVIPGEFGLRRSSLYFLKPSYWSKNKRNYKELSEGNINGN
FT                   ISLNEIVEPVSSEFIGKEAIRISGIQKSYRKKTENVEALRNLSFDIYEGQITALLGHSG
FT                   TGKSTLMNILCGLCPPSDGFASIYGHRVSEIDEMFEARKMIGICPQSDINFDVLTVEEN
FT                   LSILASIKGIPANNIIQEVQKVLLDLDMQAIKDNQAKKLSGGQKRKLSVGIAVLGNPKI
FT                   LLLDEPTAGMDPCSRHIVWNLLKYRKANRVTVFSTHFMDEADILADRKAVISQGMLKCV
FT                   GSSIFLKSKWGIGYRLSMYIDRYCATESLSSLVRQHIPAAALLQQNDQQLVYSLPFKDM
FT                   DKFSGLFSALDIHSNLGVISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPREEETD
FT                   SKSFDEMEQSLLILSETKASSVSTMSLWKQQVSTIAKFHFLSLKRESKSVRAVLLLLLI
FT                   FFAVQIFMFFLHHSFKNAVVPIKLVPDLYFLKPGDKPHKYKTSLLLQNSTDSDINGLIE
FT                   FFAHQNIMVAMFNDSDYVSAAPHSAALNVVRSEKDYVFSAVFNSTMVYCLPVMMNIISN
FT                   YYLYHLNVTEAIQTWSTPFIQEITDIVFKIELYFQAALLGIIVTAMPPYFAMENAENHK
FT                   IKAYTQLKLSGLLPSAYWVGQAVVDIPLFFVVLILMLGSLFAFHHGLYFYPAKFLAVVF
FT                   CLIAYVPSVILFTYIASFTFKKILNTKEFWSFIYSVTALACVAITETTFFLQYAVTAVF
FT                   HYTFCIAIPIYPLLGCLISFIKGSWKNMPKNENTYNPWDRLLVAVIMPYLQCILWIFLL
FT                   QHYEKKHGGRSIRKDPFFRALSQKAKNKKFPEPPINEDEDEDVKAERLKVKELMGCQCC
FT                   EEKPAIMVCNLHKEYDDKKDFLHSRKTTKVATKYISFCVKKGEILGLLGPNGAGKSTVI
FT                   NTLVGDVEPTSGKIFLGDYGSHSSEDDESIKCMGYCPQTNPLWPDLTLQEHFEIYGAVK
FT                   GMSPGDMKEVISRITKALDLKEHLQKTVKKLPAGIKRKLCFALSMLGNPQVTLLDEPST
FT                   GMDPRAKQHMWRAIRTAFKNKKRAALLTTHYMEEAEAVCDRVAIMVSGQLRCIGTVQHL
FT                   KSKFGKGYFLEIKLKDWIENLEIDRLQREIQYIFPNASRQESFSSILAFKIPKEDVQSL
FT                   SQSFAKLEEAKRTFAIEEYSFSQATLEQVFVELTKEQEEEDNSCGTLASTLWWERTQED
FT                   RVVF"
FT   assembly_gap    8943931..8943950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8950058..8950093
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   CDS             complement(8981281..8981445)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148173"
FT                   /product="mCG148173"
FT                   /note="gene_id=mCG148173.0 transcript_id=mCT188436.0
FT                   protein_id=mCP109349.0"
FT                   /protein_id="EDL34379.1"
FT                   /translation="MLWLHISDKVKVVISLLILEVLVQPLFSAHKKLIFNSEHLLWRRQ
FT                   TASKKFFAF"
FT   assembly_gap    8992031..8992526
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   assembly_gap    8996738..8996757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8999422..8999441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9036938..9036957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9049011..9163032
FT                   /gene="Map2k6"
FT                   /locus_tag="mCG_11467"
FT                   /note="gene_id=mCG11467.1"
FT   mRNA            join(9049011..9049316,9131935..9132001,9139508..9139556,
FT                   9140125..9140238,9141872..9141991,9142256..9142372,
FT                   9143631..9143682,9145668..9145795,9147237..9147314,
FT                   9148723..9148862,9156044..9156089,9162127..9163032)
FT                   /gene="Map2k6"
FT                   /locus_tag="mCG_11467"
FT                   /product="mitogen activated protein kinase kinase 6,
FT                   transcript variant mCT11638"
FT                   /note="gene_id=mCG11467.1 transcript_id=mCT11638.1 created
FT                   on 23-SEP-2002"
FT   mRNA            join(<9049150..9049316,9131935..9132001,9139508..9139556,
FT                   9140125..9140176,9141872..9141991,9142256..9142372,
FT                   9143631..9143682,9145668..9145795,9147237..9147314,
FT                   9148723..9148862,9156044..9156089,9162127..9162981)
FT                   /gene="Map2k6"
FT                   /locus_tag="mCG_11467"
FT                   /product="mitogen activated protein kinase kinase 6,
FT                   transcript variant mCT193209"
FT                   /note="gene_id=mCG11467.1 transcript_id=mCT193209.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(9049301..9049316,9131935..9132001,9139508..9139556,
FT                   9140125..9140238,9141872..9141991,9142256..9142372,
FT                   9143631..9143682,9145668..9145795,9147237..9147314,
FT                   9148723..9148862,9156044..9156089,9162127..9162204)
FT                   /codon_start=1
FT                   /gene="Map2k6"
FT                   /locus_tag="mCG_11467"
FT                   /product="mitogen activated protein kinase kinase 6,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11467.1 transcript_id=mCT11638.1
FT                   protein_id=mCP12155.1 isoform=CRA_a"
FT                   /protein_id="EDL34384.1"
FT                   /translation="MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQN
FT                   FEVKADDLEPIVELGRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDVSM
FT                   RTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIV
FT                   KALEHLHSKLSVIHRDVKPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAP
FT                   ERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD
FT                   KFSADFVDFTSQCLKKNSKERPTYPELMQHPFFTVHESKAADVASFVKLILGD"
FT   assembly_gap    9057676..9057767
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    9075377..9075495
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    9086497..9086538
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   gene            complement(9094973..9099175)
FT                   /locus_tag="mCG_1042118"
FT                   /note="gene_id=mCG1042118.0"
FT   mRNA            complement(join(9094973..9095129,9098853..9099175))
FT                   /locus_tag="mCG_1042118"
FT                   /product="mCG1042118"
FT                   /note="gene_id=mCG1042118.0 transcript_id=mCT159822.0
FT                   created on 23-SEP-2002"
FT   CDS             complement(9098920..9099174)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042118"
FT                   /product="mCG1042118"
FT                   /note="gene_id=mCG1042118.0 transcript_id=mCT159822.0
FT                   protein_id=mCP75264.0"
FT                   /db_xref="GOA:Q3UNW4"
FT                   /db_xref="MGI:MGI:3641831"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UNW4"
FT                   /protein_id="EDL34388.1"
FT                   /translation="MRPRLSAQRHKCGQKQKTNNKQKPSRQELRLDSQVLRSSPEESTF
FT                   ARILQRRGIAKYNCFSPDEHTAFPLSLHRRTVCAGTHRD"
FT   assembly_gap    9115306..9115417
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   mRNA            join(<9126845..9126904,9131935..9132001,9139508..9139556,
FT                   9140125..9140238,9141872..9141991,9142256..9142372,
FT                   9143631..9143682,9145668..9145795,9147237..9147314,
FT                   9148723..9148862,9156044..9156089,9162127..9162981)
FT                   /gene="Map2k6"
FT                   /locus_tag="mCG_11467"
FT                   /product="mitogen activated protein kinase kinase 6,
FT                   transcript variant mCT173733"
FT                   /note="gene_id=mCG11467.1 transcript_id=mCT173733.0 created
FT                   on 23-SEP-2002"
FT   CDS             join(<9126847..9126904,9131935..9132001,9139508..9139556,
FT                   9140125..9140238,9141872..9141991,9142256..9142372,
FT                   9143631..9143682,9145668..9145795,9147237..9147314,
FT                   9148723..9148862,9156044..9156089,9162127..9162204)
FT                   /codon_start=1
FT                   /gene="Map2k6"
FT                   /locus_tag="mCG_11467"
FT                   /product="mitogen activated protein kinase kinase 6,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11467.1 transcript_id=mCT173733.0
FT                   protein_id=mCP96653.0 isoform=CRA_b"
FT                   /protein_id="EDL34385.1"
FT                   /translation="DRIFAAAVELTLLRGRQTDSKKRNPGLKIPKEAFEQPQTSSTPPR
FT                   DLDSKACISIGNQNFEVKADDLEPIVELGRGAYGVVEKMRHVPSEQIMAVKRIRATVNS
FT                   QEQKRLLMDLDVSMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQT
FT                   IPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINTLGQVKMCDFGISGYLVDSV
FT                   AKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQL
FT                   KQVVEEPSPQLPADKFSADFVDFTSQCLKKNSKERPTYPELMQHPFFTVHESKAADVAS
FT                   FVKLILGD"
FT   assembly_gap    9128119..9128180
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   mRNA            join(<9128415..9128811,9131935..9132001,9139508..9139556,
FT                   9140125..9140238,9141872..9141991,9142256..9142372,
FT                   9143631..9143682,9145668..9145795,9147237..9147314,
FT                   9148723..9148862,9156044..9156089,9162127..9162981)
FT                   /gene="Map2k6"
FT                   /locus_tag="mCG_11467"
FT                   /product="mitogen activated protein kinase kinase 6,
FT                   transcript variant mCT173734"
FT                   /note="gene_id=mCG11467.1 transcript_id=mCT173734.0 created
FT                   on 23-SEP-2002"
FT   CDS             join(<9128616..9128811,9131935..9132001,9139508..9139556,
FT                   9140125..9140238,9141872..9141991,9142256..9142372,
FT                   9143631..9143682,9145668..9145795,9147237..9147314,
FT                   9148723..9148862,9156044..9156089,9162127..9162204)
FT                   /codon_start=1
FT                   /gene="Map2k6"
FT                   /locus_tag="mCG_11467"
FT                   /product="mitogen activated protein kinase kinase 6,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG11467.1 transcript_id=mCT173734.0
FT                   protein_id=mCP96652.0 isoform=CRA_c"
FT                   /protein_id="EDL34386.1"
FT                   /translation="TLWSFATAQEQEAEPAFFFFFLPPAEACRLWSLAKDGFCWDSFCQ
FT                   LCSLQLCRPPGSQRSFWRWSSKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQ
FT                   NFEVKADDLEPIVELGRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDVS
FT                   MRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSI
FT                   VKALEHLHSKLSVIHRDVKPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMA
FT                   PERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPA
FT                   DKFSADFVDFTSQCLKKNSKERPTYPELMQHPFFTVHESKAADVASFVKLILGD"
FT   CDS             join(<9140162..9140176,9141872..9141991,9142256..9142372,
FT                   9143631..9143682,9145668..9145795,9147237..9147314,
FT                   9148723..9148862,9156044..9156089,9162127..9162204)
FT                   /codon_start=1
FT                   /gene="Map2k6"
FT                   /locus_tag="mCG_11467"
FT                   /product="mitogen activated protein kinase kinase 6,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG11467.1 transcript_id=mCT193209.0
FT                   protein_id=mCP114136.0 isoform=CRA_d"
FT                   /protein_id="EDL34387.1"
FT                   /translation="WSWDERIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALFRE
FT                   GDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVK
FT                   PSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
FT                   WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSADFVDFTSQCLKKNS
FT                   KERPTYPELMQHPFFTVHESKAADVASFVKLILGD"
FT   assembly_gap    9181577..9181596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9183215..9183234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9187569..9188160
FT                   /estimated_length=592
FT                   /gap_type="unknown"
FT   assembly_gap    9193049..9193068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9204031..9204351
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    9210324..9210343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9211599..9211618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9213030..9213049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9214587..9214606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9216193..9216212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9223262..9223638
FT                   /estimated_length=377
FT                   /gap_type="unknown"
FT   assembly_gap    9224674..9224693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9259523..9262912
FT                   /estimated_length=3390
FT                   /gap_type="unknown"
FT   assembly_gap    9267898..9268094
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    9281311..9281687
FT                   /estimated_length=377
FT                   /gap_type="unknown"
FT   assembly_gap    9290682..9290723
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    9293407..9293426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9315391..9315410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9326929..9326979
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    9333516..9333535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9356318..9356337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9361834..9361853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9362871..9362890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9420860..9421418
FT                   /estimated_length=559
FT                   /gap_type="unknown"
FT   assembly_gap    9452134..9452153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9508368..9508817
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    9517983..9518002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9539769..9539797
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    9541337..9541356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9584215..9584234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9593579..9593598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9625995..9687172
FT                   /gene="Kcnj16"
FT                   /locus_tag="mCG_51514"
FT                   /note="gene_id=mCG51514.1"
FT   mRNA            join(9625995..9626058,9684740..9687172)
FT                   /gene="Kcnj16"
FT                   /locus_tag="mCG_51514"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 16, transcript variant mCT51697"
FT                   /note="gene_id=mCG51514.1 transcript_id=mCT51697.1 created
FT                   on 23-SEP-2002"
FT   mRNA            join(9625996..9626058,9646755..9646835,9684740..9687171)
FT                   /gene="Kcnj16"
FT                   /locus_tag="mCG_51514"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 16, transcript variant mCT173737"
FT                   /note="gene_id=mCG51514.1 transcript_id=mCT173737.0 created
FT                   on 23-SEP-2002"
FT   assembly_gap    9630204..9630223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9643507..9643526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(9679908..9680007,9684740..9687171)
FT                   /gene="Kcnj16"
FT                   /locus_tag="mCG_51514"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 16, transcript variant mCT173735"
FT                   /note="gene_id=mCG51514.1 transcript_id=mCT173735.0 created
FT                   on 23-SEP-2002"
FT   mRNA            join(9684189..9684311,9684740..9687171)
FT                   /gene="Kcnj16"
FT                   /locus_tag="mCG_51514"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 16, transcript variant mCT173736"
FT                   /note="gene_id=mCG51514.1 transcript_id=mCT173736.0 created
FT                   on 23-SEP-2002"
FT   CDS             9684845..9686104
FT                   /codon_start=1
FT                   /gene="Kcnj16"
FT                   /locus_tag="mCG_51514"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 16, isoform CRA_a"
FT                   /note="gene_id=mCG51514.1 transcript_id=mCT173735.0
FT                   protein_id=mCP96656.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9Z307"
FT                   /db_xref="InterPro:IPR008061"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="MGI:MGI:1314842"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z307"
FT                   /protein_id="EDL34389.1"
FT                   /translation="MSYYGSSYRIVNVDSKYPGYPPEHAIAEKRRARRRLLHKDGSCNV
FT                   YFKHIFGEWGSYMVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGSIFWLIAFHHGDLLS
FT                   DPDITPCVDNVHSFTAAFLFSLETQTTIGYGYRCVTEECSVAVLTVILQSILSCIINTF
FT                   IIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLR
FT                   YSEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVT
FT                   FIYTGDSTGTSHQSRSSYIPREILWGHRFHDVLEVKRKYYKVNCLQFEGSVEVYAPFCS
FT                   AKQLDWKDQQLNNLEKTSPARGSCNSDTNTRRRSFSAVAVVSSCENPEETVLSPQDECK
FT                   EMPYQKALLTLNRISMESQM"
FT   CDS             9684845..9686104
FT                   /codon_start=1
FT                   /gene="Kcnj16"
FT                   /locus_tag="mCG_51514"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 16, isoform CRA_a"
FT                   /note="gene_id=mCG51514.1 transcript_id=mCT173736.0
FT                   protein_id=mCP96655.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9Z307"
FT                   /db_xref="InterPro:IPR008061"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="MGI:MGI:1314842"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z307"
FT                   /protein_id="EDL34390.1"
FT                   /translation="MSYYGSSYRIVNVDSKYPGYPPEHAIAEKRRARRRLLHKDGSCNV
FT                   YFKHIFGEWGSYMVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGSIFWLIAFHHGDLLS
FT                   DPDITPCVDNVHSFTAAFLFSLETQTTIGYGYRCVTEECSVAVLTVILQSILSCIINTF
FT                   IIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLR
FT                   YSEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVT
FT                   FIYTGDSTGTSHQSRSSYIPREILWGHRFHDVLEVKRKYYKVNCLQFEGSVEVYAPFCS
FT                   AKQLDWKDQQLNNLEKTSPARGSCNSDTNTRRRSFSAVAVVSSCENPEETVLSPQDECK
FT                   EMPYQKALLTLNRISMESQM"
FT   CDS             9684845..9686104
FT                   /codon_start=1
FT                   /gene="Kcnj16"
FT                   /locus_tag="mCG_51514"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 16, isoform CRA_a"
FT                   /note="gene_id=mCG51514.1 transcript_id=mCT51697.1
FT                   protein_id=mCP33805.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9Z307"
FT                   /db_xref="InterPro:IPR008061"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="MGI:MGI:1314842"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z307"
FT                   /protein_id="EDL34391.1"
FT                   /translation="MSYYGSSYRIVNVDSKYPGYPPEHAIAEKRRARRRLLHKDGSCNV
FT                   YFKHIFGEWGSYMVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGSIFWLIAFHHGDLLS
FT                   DPDITPCVDNVHSFTAAFLFSLETQTTIGYGYRCVTEECSVAVLTVILQSILSCIINTF
FT                   IIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLR
FT                   YSEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVT
FT                   FIYTGDSTGTSHQSRSSYIPREILWGHRFHDVLEVKRKYYKVNCLQFEGSVEVYAPFCS
FT                   AKQLDWKDQQLNNLEKTSPARGSCNSDTNTRRRSFSAVAVVSSCENPEETVLSPQDECK
FT                   EMPYQKALLTLNRISMESQM"
FT   CDS             9684845..9686104
FT                   /codon_start=1
FT                   /gene="Kcnj16"
FT                   /locus_tag="mCG_51514"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 16, isoform CRA_a"
FT                   /note="gene_id=mCG51514.1 transcript_id=mCT173737.0
FT                   protein_id=mCP96654.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9Z307"
FT                   /db_xref="InterPro:IPR008061"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="MGI:MGI:1314842"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z307"
FT                   /protein_id="EDL34392.1"
FT                   /translation="MSYYGSSYRIVNVDSKYPGYPPEHAIAEKRRARRRLLHKDGSCNV
FT                   YFKHIFGEWGSYMVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGSIFWLIAFHHGDLLS
FT                   DPDITPCVDNVHSFTAAFLFSLETQTTIGYGYRCVTEECSVAVLTVILQSILSCIINTF
FT                   IIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLR
FT                   YSEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVT
FT                   FIYTGDSTGTSHQSRSSYIPREILWGHRFHDVLEVKRKYYKVNCLQFEGSVEVYAPFCS
FT                   AKQLDWKDQQLNNLEKTSPARGSCNSDTNTRRRSFSAVAVVSSCENPEETVLSPQDECK
FT                   EMPYQKALLTLNRISMESQM"
FT   gene            9726493..9735982
FT                   /gene="Kcnj2"
FT                   /locus_tag="mCG_21284"
FT                   /note="gene_id=mCG21284.2"
FT   mRNA            join(9726493..9726665,9731880..9735982)
FT                   /gene="Kcnj2"
FT                   /locus_tag="mCG_21284"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 2"
FT                   /note="gene_id=mCG21284.2 transcript_id=mCT20953.1 created
FT                   on 29-NOV-2004"
FT   CDS             9732115..9733401
FT                   /codon_start=1
FT                   /gene="Kcnj2"
FT                   /locus_tag="mCG_21284"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 2"
FT                   /note="gene_id=mCG21284.2 transcript_id=mCT20953.1
FT                   protein_id=mCP12148.2"
FT                   /db_xref="GOA:Q543W5"
FT                   /db_xref="InterPro:IPR003271"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR013673"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="MGI:MGI:104744"
FT                   /db_xref="UniProtKB/TrEMBL:Q543W5"
FT                   /protein_id="EDL34393.1"
FT                   /translation="MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRS
FT                   RFVKKDGHCNVQFINVGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFW
FT                   LIALLHGDLDTSKVSKACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVF
FT                   QSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHL
FT                   VEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYD
FT                   LSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVD
FT                   YSRFHKTYEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEEEDSENGVPEST
FT                   STDSPPGIDLHNQASVPLEPRPLRRESEI"
FT   assembly_gap    9802754..9802844
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    9816039..9816159
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    9824449..9824475
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    9846398..9847704
FT                   /estimated_length=1307
FT                   /gap_type="unknown"
FT   assembly_gap    9858666..9858685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9870320..9872354
FT                   /estimated_length=2035
FT                   /gap_type="unknown"
FT   assembly_gap    9881013..9881745
FT                   /estimated_length=733
FT                   /gap_type="unknown"
FT   assembly_gap    9890699..9891010
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    9929814..9930465
FT                   /estimated_length=652
FT                   /gap_type="unknown"
FT   gene            9936234..9937200
FT                   /pseudo
FT                   /locus_tag="mCG_21282"
FT                   /note="gene_id=mCG21282.1"
FT   mRNA            9936234..9937200
FT                   /pseudo
FT                   /locus_tag="mCG_21282"
FT                   /note="gene_id=mCG21282.1 transcript_id=mCT20951.1 created
FT                   on 23-SEP-2002"
FT   assembly_gap    9937340..9937404
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            <9942206..9955202
FT                   /locus_tag="mCG_59998"
FT                   /note="gene_id=mCG59998.2"
FT   mRNA            join(<9942206..9942252,9954636..9955202)
FT                   /locus_tag="mCG_59998"
FT                   /product="mCG59998"
FT                   /note="gene_id=mCG59998.2 transcript_id=mCT60181.2 created
FT                   on 23-SEP-2002"
FT   assembly_gap    9943467..9943486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9944776..9944817
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   CDS             <9954822..9955121
FT                   /codon_start=1
FT                   /locus_tag="mCG_59998"
FT                   /product="mCG59998"
FT                   /note="gene_id=mCG59998.2 transcript_id=mCT60181.2
FT                   protein_id=mCP33799.2"
FT                   /protein_id="EDL34394.1"
FT                   /translation="IIYPKQNPGHSHCGATGYAQTACSPVNLRAFVFCFLFVCLFCFVF
FT                   RDRVSVYSPGMTLLVVISTYMGQKAIDHVSWTPGSCRCYRPHSPYRRRTVVISQ"
FT   assembly_gap    9960847..9960866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10002868..10003138
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    10010850..10010869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10015766..10016185
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    10017858..10018017
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    10042537..10042986
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    10043657..10043678
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    10077237..10077256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10079949..10079968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10084770..10084789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10092273..10092292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10123342..10123435
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    10138616..10138635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10173999..10174377
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    10192866..10192885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10208353..10208856
FT                   /estimated_length=504
FT                   /gap_type="unknown"
FT   assembly_gap    10213007..10213026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10219691..10220258
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   gene            complement(10389470..10390645)
FT                   /pseudo
FT                   /locus_tag="mCG_17821"
FT                   /note="gene_id=mCG17821.2"
FT   mRNA            complement(10389470..10390645)
FT                   /pseudo
FT                   /locus_tag="mCG_17821"
FT                   /note="gene_id=mCG17821.2 transcript_id=mCT16672.2 created
FT                   on 23-SEP-2002"
FT   assembly_gap    10456826..10457157
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   gene            complement(10461682..10466184)
FT                   /locus_tag="mCG_148157"
FT                   /note="gene_id=mCG148157.0"
FT   mRNA            complement(join(10461682..10464638,10466137..10466184))
FT                   /locus_tag="mCG_148157"
FT                   /product="mCG148157"
FT                   /note="gene_id=mCG148157.0 transcript_id=mCT188420.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10461789..10462109)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148157"
FT                   /product="mCG148157"
FT                   /note="gene_id=mCG148157.0 transcript_id=mCT188420.0
FT                   protein_id=mCP109335.0"
FT                   /protein_id="EDL34395.1"
FT                   /translation="MAPHINSLIVRCKHRHPVCLFAGLYSLLRSLWVILAQRHWLPSQI
FT                   WRLLSIPHVFLDQLFPPMISSRSFLNSYLNITVFFFYIVSAGTFPRSTGYRRFQISSRR
FT                   YE"
FT   assembly_gap    10478750..10478864
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    10506917..10507067
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    10517540..10517726
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    10521153..10522321
FT                   /estimated_length=1169
FT                   /gap_type="unknown"
FT   assembly_gap    10551934..10551953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10573817..10573836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10583985..10584004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10605225..10605308
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    10612298..10612487
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    10640049..10640068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10669152..10669171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10674079..10674098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10675633..10679807
FT                   /estimated_length=4175
FT                   /gap_type="unknown"
FT   assembly_gap    10686613..10686632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10705095..10705424
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    10712057..10712076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10719259..10719278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10722721..10722740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10725354..10725373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10760584..10760651
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    10762979..10762998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10768113..10768236
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    10774349..10774945
FT                   /estimated_length=597
FT                   /gap_type="unknown"
FT   assembly_gap    10848326..10848574
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    10853651..10853688
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    10858415..10858434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10862959..10862978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10865134..10865153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10866229..10866397
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    10882573..10882760
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    10885172..10885368
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    10885736..10886017
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    10902891..10902910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10911910..10911929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10930038..10930057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10954767..10954786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10974360..10974379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10982649..10982845
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    11048069..11048088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11117263..11118507
FT                   /estimated_length=1245
FT                   /gap_type="unknown"
FT   assembly_gap    11138801..11138820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11255358..11255377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11259631..11259650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11304511..11304574
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    11305467..11305984
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   gene            complement(11331484..>11377837)
FT                   /locus_tag="mCG_1042142"
FT                   /note="gene_id=mCG1042142.1"
FT   mRNA            complement(join(11331484..11331601,11335851..11335977,
FT                   11338731..11339051,11339568..11339622,11358404..11358615,
FT                   11377578..>11377831))
FT                   /locus_tag="mCG_1042142"
FT                   /product="mCG1042142, transcript variant mCT174008"
FT                   /note="gene_id=mCG1042142.1 transcript_id=mCT174008.0
FT                   created on 25-SEP-2002"
FT   mRNA            complement(join(11331585..11331601,11338731..11339051,
FT                   11339568..11339622,11358193..11358336,11377578..>11377836))
FT                   /locus_tag="mCG_1042142"
FT                   /product="mCG1042142, transcript variant mCT174009"
FT                   /note="gene_id=mCG1042142.1 transcript_id=mCT174009.0
FT                   created on 25-SEP-2002"
FT   assembly_gap    11347178..11347673
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   mRNA            complement(join(11351457..11351825,11358193..11358336,
FT                   11377578..>11377812))
FT                   /locus_tag="mCG_1042142"
FT                   /product="mCG1042142, transcript variant mCT174010"
FT                   /note="gene_id=mCG1042142.1 transcript_id=mCT174010.0
FT                   created on 25-SEP-2002"
FT   CDS             complement(join(11351493..11351825,11358193..>11358234))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042142"
FT                   /product="mCG1042142, isoform CRA_d"
FT                   /note="gene_id=mCG1042142.1 transcript_id=mCT174010.0
FT                   protein_id=mCP96929.0 isoform=CRA_d"
FT                   /protein_id="EDL34399.1"
FT                   /translation="HLTYMEQLYLPDTKRRMKRRRQDVSMSDGPPYHLGKRDASSEMRR
FT                   GRAKSQVQRTLWRKGFYWRGSTWLIPYKENCVAADGELAQWGKMLAIKPHDLSLIPWDP
FT                   HSGRTDSCKMFSDFLHIDKK"
FT   assembly_gap    11352438..11352457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(11354562..11355351,11358193..11358615,
FT                   11377578..11377684,11377775..>11377837))
FT                   /locus_tag="mCG_1042142"
FT                   /product="mCG1042142, transcript variant mCT159846"
FT                   /note="gene_id=mCG1042142.1 transcript_id=mCT159846.1
FT                   created on 24-SEP-2002"
FT   CDS             complement(11354829..>11355131)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042142"
FT                   /product="mCG1042142, isoform CRA_a"
FT                   /note="gene_id=mCG1042142.1 transcript_id=mCT159846.1
FT                   protein_id=mCP75355.0 isoform=CRA_a"
FT                   /protein_id="EDL34396.1"
FT                   /translation="FKASLVNLPKLSQIFEKEKQSREYQARIECLPSMHQVTESIPRTE
FT                   EKSDLLFKRNYFLTILEMDGSRRVSYSTLRLVGNLRFGVFVANHFRYSVPNWDDR"
FT   CDS             complement(join(11358194..11358336,11377578..>11377722))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042142"
FT                   /product="mCG1042142, isoform CRA_c"
FT                   /note="gene_id=mCG1042142.1 transcript_id=mCT174009.0
FT                   protein_id=mCP96928.0 isoform=CRA_c"
FT                   /protein_id="EDL34398.1"
FT                   /translation="KGINILYQLYHTRWPRDSGKMAGQTPLDLPTWSLDIYLASLSSLG
FT                   PDAGCRRMATGSCSQQVRGAVATEGRGIVLTRLMVMMTSNVHGAALSARH"
FT   CDS             complement(join(11358458..11358615,11377578..>11377722))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042142"
FT                   /product="mCG1042142, isoform CRA_b"
FT                   /note="gene_id=mCG1042142.1 transcript_id=mCT174008.0
FT                   protein_id=mCP96927.0 isoform=CRA_b"
FT                   /protein_id="EDL34397.1"
FT                   /translation="KGINILYQLYHTRWPRDSGKMAGQTPLDLPTWSLDIYLASLSSLG
FT                   PDAGKCGGALGDLLEQLQGATVDQQSPWLQHWCQARSPIMFHTPRLRRHRVTCCR"
FT   assembly_gap    11396718..11396737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11430434..11430453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11449867..11455388
FT                   /gene="Sox9"
FT                   /locus_tag="mCG_19037"
FT                   /note="gene_id=mCG19037.1"
FT   mRNA            join(11449867..11450654,11451447..11451700,
FT                   11452310..11455388)
FT                   /gene="Sox9"
FT                   /locus_tag="mCG_19037"
FT                   /product="SRY-box containing gene 9"
FT                   /note="gene_id=mCG19037.1 transcript_id=mCT17144.1 created
FT                   on 25-SEP-2002"
FT   CDS             join(11450224..11450654,11451447..11451700,
FT                   11452310..11453148)
FT                   /codon_start=1
FT                   /gene="Sox9"
FT                   /locus_tag="mCG_19037"
FT                   /product="SRY-box containing gene 9"
FT                   /note="gene_id=mCG19037.1 transcript_id=mCT17144.1
FT                   protein_id=mCP8290.2"
FT                   /protein_id="EDL34400.1"
FT                   /translation="MNLLDPFMKMTDEQEKGLSGAPSPTMSEDSAGSPCPSGSGSDTEN
FT                   TRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKGYDWTLVPMPVRVNGSSKNKPH
FT                   VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRV
FT                   QHKKDHPDYKYQPRRRKSVKNGQAEAEEATEQTHISPNAIFKALQADSPHSSSGMSEVH
FT                   SPGEHSGQSQGPPTPPTTPKTDVQAGKVDLKREGRPLAEGGRQPPIDFRDVDIGELSSD
FT                   VISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAPTPATAGHVWMSKQQ
FT                   APPPPPQQPPQAPQAPQAPPQQQAPPQQPQAPQQQQAHTLTTLSSEPGQSQRTHIKTEQ
FT                   LSPSHYSEQQQHSPQQISYSPFNLPHYSPSYPPITRSQYDYADHQNSGSYYSHAAGQGS
FT                   GLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP"
FT   assembly_gap    11462121..11462286
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    11470183..11470202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11474598..11476201
FT                   /estimated_length=1604
FT                   /gap_type="unknown"
FT   assembly_gap    11477598..11477617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11478915..11478934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<11495169..>11497331)
FT                   /locus_tag="mCG_114159"
FT                   /note="gene_id=mCG114159.0"
FT   mRNA            complement(join(<11495169..11495359,11497119..>11497331))
FT                   /locus_tag="mCG_114159"
FT                   /product="mCG114159"
FT                   /note="gene_id=mCG114159.0 transcript_id=mCT115250.1
FT                   created on 25-SEP-2002"
FT   CDS             complement(join(<11495169..11495359,11497119..>11497167))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114159"
FT                   /product="mCG114159"
FT                   /note="gene_id=mCG114159.0 transcript_id=mCT115250.1
FT                   protein_id=mCP75148.1"
FT                   /protein_id="EDL34401.1"
FT                   /translation="DPATLRSCHLAFLTVTDTAQHQQLWASISSTPDKRSRELHGTHPR
FT                   HPLLPGQQMSILKHELGNSLQLISSEANKNLALVS"
FT   gene            11497383..11504695
FT                   /gene="4933434M16Rik"
FT                   /locus_tag="mCG_148153"
FT                   /note="gene_id=mCG148153.0"
FT   mRNA            join(11497383..11498340,11503712..11504695)
FT                   /gene="4933434M16Rik"
FT                   /locus_tag="mCG_148153"
FT                   /product="RIKEN cDNA 4933434M16"
FT                   /note="gene_id=mCG148153.0 transcript_id=mCT188416.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    11501786..11502456
FT                   /estimated_length=671
FT                   /gap_type="unknown"
FT   CDS             11503848..11504216
FT                   /codon_start=1
FT                   /gene="4933434M16Rik"
FT                   /locus_tag="mCG_148153"
FT                   /product="RIKEN cDNA 4933434M16"
FT                   /note="gene_id=mCG148153.0 transcript_id=mCT188416.0
FT                   protein_id=mCP109331.0"
FT                   /db_xref="MGI:MGI:1918453"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D3U1"
FT                   /protein_id="EDL34402.1"
FT                   /translation="MVRTHRVTLNKPLKGAVWTEALGPSQGLLSCSNCVLPPGMRANEN
FT                   KKGGEATETTSPHPPCHLVGPETISIFSYYVYTGGRTHIACSGLPQSCWNGLYFPGILR
FT                   TTPNPCTHRAEDLPSPGV"
FT   assembly_gap    11509581..11509689
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    11515769..11516227
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   assembly_gap    11519444..11519463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11524569..11524878
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    11533368..11534346
FT                   /estimated_length=979
FT                   /gap_type="unknown"
FT   assembly_gap    11540126..11541341
FT                   /estimated_length=1216
FT                   /gap_type="unknown"
FT   assembly_gap    11550415..11555000
FT                   /estimated_length=4586
FT                   /gap_type="unknown"
FT   assembly_gap    11568253..11568272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11576942..11577379
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    11585273..11587379
FT                   /estimated_length=2107
FT                   /gap_type="unknown"
FT   assembly_gap    11596868..11596887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11615551..11615683
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    11625528..11625835
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    11629624..11629643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11631359..11631378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11640788..11640807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11642167..11642186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11647796..11647815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11649070..11649089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11656094..11656240
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    11678007..11679202
FT                   /estimated_length=1196
FT                   /gap_type="unknown"
FT   assembly_gap    11681541..11681560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11688582..11688966
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    11691073..11691092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11692984..11693033
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    11697788..11698258
FT                   /estimated_length=471
FT                   /gap_type="unknown"
FT   assembly_gap    11701940..11701984
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   gene            complement(11716010..11746021)
FT                   /locus_tag="mCG_57491"
FT                   /note="gene_id=mCG57491.2"
FT   mRNA            complement(join(11716010..11717275,11740493..11740537,
FT                   11745882..11746021))
FT                   /locus_tag="mCG_57491"
FT                   /product="mCG57491"
FT                   /note="gene_id=mCG57491.2 transcript_id=mCT57674.2 created
FT                   on 25-SEP-2002"
FT   CDS             complement(11716828..11717061)
FT                   /codon_start=1
FT                   /locus_tag="mCG_57491"
FT                   /product="mCG57491"
FT                   /note="gene_id=mCG57491.2 transcript_id=mCT57674.2
FT                   protein_id=mCP32787.2"
FT                   /protein_id="EDL34403.1"
FT                   /translation="MNKDIRLWAWGRLTSSAHLLSGGKHVLGTATTQDTLPHSVPVQLP
FT                   HPSLSDPASCAHSPLDPEILLVCSIILEPDTG"
FT   assembly_gap    11726930..11726949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11729440..11729459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11753812..11753831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11773342..11773361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11777889..11777908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11797196..11797390
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    11814435..11815030
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    11823086..11825154
FT                   /estimated_length=2069
FT                   /gap_type="unknown"
FT   assembly_gap    11829285..11895540
FT                   /estimated_length=66256
FT                   /gap_type="unknown"
FT   assembly_gap    11896793..11904207
FT                   /estimated_length=7415
FT                   /gap_type="unknown"
FT   assembly_gap    11905629..11910250
FT                   /estimated_length=4622
FT                   /gap_type="unknown"
FT   gene            complement(<11911941..12323986)
FT                   /gene="Slc39a11"
FT                   /locus_tag="mCG_141237"
FT                   /note="gene_id=mCG141237.1"
FT   mRNA            complement(join(<11911941..11912039,11967125..11967194,
FT                   12032058..12032228,12126561..12126684,12186295..12186453,
FT                   12223897..12223935,12226392..12226510,12323849..12323986))
FT                   /gene="Slc39a11"
FT                   /locus_tag="mCG_141237"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 11, transcript variant mCT174013"
FT                   /note="gene_id=mCG141237.1 transcript_id=mCT174013.1
FT                   created on 25-JUL-2003"
FT   mRNA            complement(join(<11911941..11912039,11967125..11967194,
FT                   12032058..12032228,12126561..12126684,12186295..12186453,
FT                   12223897..12223935,12226392..12226510,12256945..12257095,
FT                   12323849..12323986))
FT                   /gene="Slc39a11"
FT                   /locus_tag="mCG_141237"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 11, transcript variant mCT174012"
FT                   /note="gene_id=mCG141237.1 transcript_id=mCT174012.1
FT                   created on 25-JUL-2003"
FT   mRNA            complement(join(<11911941..11912039,11967125..11967194,
FT                   12032058..12032228,12126561..12126684,12186295..12186453,
FT                   12223897..12223935,12226392..12226510,12230080..12230202))
FT                   /gene="Slc39a11"
FT                   /locus_tag="mCG_141237"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 11, transcript variant mCT174011"
FT                   /note="gene_id=mCG141237.1 transcript_id=mCT174011.0
FT                   created on 25-JUL-2003"
FT   CDS             complement(join(<11911941..11912039,11967125..11967194,
FT                   12032058..12032228,12126561..12126684,12186295..12186453,
FT                   12223897..12223935,12226392..12226499))
FT                   /codon_start=1
FT                   /gene="Slc39a11"
FT                   /locus_tag="mCG_141237"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 11, isoform CRA_a"
FT                   /note="gene_id=mCG141237.1 transcript_id=mCT174012.1
FT                   protein_id=mCP96932.1 isoform=CRA_a"
FT                   /protein_id="EDL34404.1"
FT                   /translation="MLQGYSSVVQALLGTFFTWAMTAAGAALVFIFSSGQRRILDGSLG
FT                   FAAGVMLAASYWSLLAPAVEMATSSGGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGA
FT                   TEDPQTALALNLDPALMKKSDPRDPTSLLFPESELSIRIDKRENGEVYQRKKVAATDLA
FT                   EGVAPSGSMHGSSGQPGGSSWRRIALLILAITIHNIPEGLAVGVGFGAVEKTASATFES
FT                   ARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWKAF"
FT   CDS             complement(join(<11911941..11912039,11967125..11967194,
FT                   12032058..12032228,12126561..12126684,12186295..12186453,
FT                   12223897..12223935,12226392..12226499))
FT                   /codon_start=1
FT                   /gene="Slc39a11"
FT                   /locus_tag="mCG_141237"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 11, isoform CRA_a"
FT                   /note="gene_id=mCG141237.1 transcript_id=mCT174013.1
FT                   protein_id=mCP96931.0 isoform=CRA_a"
FT                   /protein_id="EDL34405.1"
FT                   /translation="MLQGYSSVVQALLGTFFTWAMTAAGAALVFIFSSGQRRILDGSLG
FT                   FAAGVMLAASYWSLLAPAVEMATSSGGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGA
FT                   TEDPQTALALNLDPALMKKSDPRDPTSLLFPESELSIRIDKRENGEVYQRKKVAATDLA
FT                   EGVAPSGSMHGSSGQPGGSSWRRIALLILAITIHNIPEGLAVGVGFGAVEKTASATFES
FT                   ARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWKAF"
FT   CDS             complement(join(<11911941..11912039,11967125..11967194,
FT                   12032058..12032228,12126561..12126684,12186295..12186453,
FT                   12223897..12223935,12226392..12226499))
FT                   /codon_start=1
FT                   /gene="Slc39a11"
FT                   /locus_tag="mCG_141237"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 11, isoform CRA_a"
FT                   /note="gene_id=mCG141237.1 transcript_id=mCT174011.0
FT                   protein_id=mCP96930.0 isoform=CRA_a"
FT                   /protein_id="EDL34406.1"
FT                   /translation="MLQGYSSVVQALLGTFFTWAMTAAGAALVFIFSSGQRRILDGSLG
FT                   FAAGVMLAASYWSLLAPAVEMATSSGGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGA
FT                   TEDPQTALALNLDPALMKKSDPRDPTSLLFPESELSIRIDKRENGEVYQRKKVAATDLA
FT                   EGVAPSGSMHGSSGQPGGSSWRRIALLILAITIHNIPEGLAVGVGFGAVEKTASATFES
FT                   ARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWKAF"
FT   assembly_gap    11927107..11927684
FT                   /estimated_length=578
FT                   /gap_type="unknown"
FT   assembly_gap    11946309..11946328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11951350..11959030
FT                   /estimated_length=7681
FT                   /gap_type="unknown"
FT   assembly_gap    11960462..11960481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11962216..11966430
FT                   /estimated_length=4215
FT                   /gap_type="unknown"
FT   assembly_gap    11981743..11981762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11998847..11998866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12002689..12002788
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   gene            12003092..12019496
FT                   /locus_tag="mCG_148170"
FT                   /note="gene_id=mCG148170.0"
FT   mRNA            join(12003092..12003785,12016259..12019496)
FT                   /locus_tag="mCG_148170"
FT                   /product="mCG148170"
FT                   /note="gene_id=mCG148170.0 transcript_id=mCT188433.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    12008899..12009032
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   CDS             12016944..12017204
FT                   /codon_start=1
FT                   /locus_tag="mCG_148170"
FT                   /product="mCG148170"
FT                   /note="gene_id=mCG148170.0 transcript_id=mCT188433.0
FT                   protein_id=mCP109347.0"
FT                   /protein_id="EDL34407.1"
FT                   /translation="MTDCTCKLRANVIFLPFAFILIFHPGGEKGTKTEREGVRSQSPSH
FT                   LKTTRHNRLQHRPGTKGIRWVGSPKGSQLPESQTGRRLNEV"
FT   assembly_gap    12032609..12032628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12067970..12068205
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    12090594..12090613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12093805..12093824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12130582..12134620
FT                   /locus_tag="mCG_148165"
FT                   /note="gene_id=mCG148165.0"
FT   mRNA            12130582..12134620
FT                   /locus_tag="mCG_148165"
FT                   /product="mCG148165"
FT                   /note="gene_id=mCG148165.0 transcript_id=mCT188428.0
FT                   created on 13-JAN-2004"
FT   CDS             12130980..12131324
FT                   /codon_start=1
FT                   /locus_tag="mCG_148165"
FT                   /product="mCG148165"
FT                   /note="gene_id=mCG148165.0 transcript_id=mCT188428.0
FT                   protein_id=mCP109342.0"
FT                   /protein_id="EDL34408.1"
FT                   /translation="MRARHVAGACDPALGRWRQMDTWSPLVNQLSEVGSSSFSEESRFE
FT                   KMRQRMMEKGIRHQPLASRLTHAHAFPPTHRYTRVPHKKRVKCINNCTTADGNSHACSW
FT                   LRAGCVQRFA"
FT   assembly_gap    12154519..12154538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12173236..12173255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12176456..12177505
FT                   /estimated_length=1050
FT                   /gap_type="unknown"
FT   assembly_gap    12181118..12181197
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    12193312..12193466
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    12194349..12194536
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    12197926..12197945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12240664..12240683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12243391..12243481
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    12274706..12275052
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    12280206..12280225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12284767..12300746
FT                   /locus_tag="mCG_115293"
FT                   /note="gene_id=mCG115293.1"
FT   mRNA            join(12284767..12284910,12289549..12290631,
FT                   12290971..12291247,12300718..12300746)
FT                   /locus_tag="mCG_115293"
FT                   /product="mCG115293"
FT                   /note="gene_id=mCG115293.1 transcript_id=mCT116397.1
FT                   created on 31-JUL-2002"
FT   assembly_gap    12286128..12286328
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    12287260..12287382
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   CDS             join(12289639..12290631,12290971..12291018)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115293"
FT                   /product="mCG115293"
FT                   /note="gene_id=mCG115293.1 transcript_id=mCT116397.1
FT                   protein_id=mCP75175.1"
FT                   /protein_id="EDL34409.1"
FT                   /translation="MEMSSEQLNGSQVWVSSPFDLNGSLGPSNGSNQTEPYYDMTSNAV
FT                   LTFIYFVVCVVGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVA
FT                   LVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMIN
FT                   VAVWCVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLT
FT                   IICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVS
FT                   VAISPTPALKGMFDFVVILTYANSCANPILYAFLSDNFKKSFQNVLCLVKADNSQSGAE
FT                   DIIAWV"
FT   assembly_gap    12291248..12291267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12292308..12300594
FT                   /estimated_length=8287
FT                   /gap_type="unknown"
FT   assembly_gap    12303011..12309597
FT                   /estimated_length=6587
FT                   /gap_type="unknown"
FT   assembly_gap    12310693..12310712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12315715..12315734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12323453..12340978
FT                   /gene="Cog1"
FT                   /locus_tag="mCG_16119"
FT                   /note="gene_id=mCG16119.2"
FT   mRNA            join(12323453..12323782,12325752..12325993,
FT                   12326132..12326313,12326449..12326619,12327811..12327967,
FT                   12328875..12329085,12329767..12330555,12330910..12331056,
FT                   12331282..12331443,12332386..12332513,12333176..12333284,
FT                   12334868..12334977,12335065..12335143,12340683..12340978)
FT                   /gene="Cog1"
FT                   /locus_tag="mCG_16119"
FT                   /product="component of oligomeric golgi complex 1,
FT                   transcript variant mCT171348"
FT                   /note="gene_id=mCG16119.2 transcript_id=mCT171348.0 created
FT                   on 31-JUL-2002"
FT   mRNA            join(12323453..12323782,12325752..12325993,
FT                   12326132..12326313,12326449..12326619,12327811..12327967,
FT                   12328875..12329085,12329767..12330555,12330910..12331056,
FT                   12331282..12331443,12332386..12332513,12333176..12333284,
FT                   12334868..12334977,12335065..12335143,12336132..12336875)
FT                   /gene="Cog1"
FT                   /locus_tag="mCG_16119"
FT                   /product="component of oligomeric golgi complex 1,
FT                   transcript variant mCT15635"
FT                   /note="gene_id=mCG16119.2 transcript_id=mCT15635.2 created
FT                   on 31-JUL-2002"
FT   CDS             join(12323468..12323782,12325752..12325993,
FT                   12326132..12326313,12326449..12326619,12327811..12327967,
FT                   12328875..12329085,12329767..12330555,12330910..12331056,
FT                   12331282..12331443,12332386..12332513,12333176..12333284,
FT                   12334868..12334977,12335065..12335143,12340683..12340748)
FT                   /codon_start=1
FT                   /gene="Cog1"
FT                   /locus_tag="mCG_16119"
FT                   /product="component of oligomeric golgi complex 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16119.2 transcript_id=mCT171348.0
FT                   protein_id=mCP94267.0 isoform=CRA_a"
FT                   /protein_id="EDL34410.1"
FT                   /translation="MAAATASSALKRLDLRDPNALFETHGAEEIRGLERQVRAEIEHKK
FT                   EELRQMVGERYRDLIEAADTIGQMRRCAEGLVDAVQATDQYCARLRQAGSVAPRVPRAP
FT                   QPQPPSEKFYSMAAQIKLLLEIPEKIWSAMEASQHLQATQLYLLCCHLHSLLQLDSSNS
FT                   RYSPILSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIMLLEESSP
FT                   RQALTDFLLARKATIQTLLNQSHHGAGIKAQICSLVELLATTLNQAHALFYTLPEGVLP
FT                   DPSLPCGLLFSTLETVTRQHPTGKGIGALQGEMKLCSWFRHLPTSIIEFQPTLRTLAHP
FT                   ISQEYLKDTLQKWIDMCNEDIKNGIGNLLMYVKSMKGLAGIRDAIWDLLSNESASHSWE
FT                   VVCQRLLEKPLLFWEDLMQQLFLDRLQTLTREGFESISNSSKELLVSALQELETNNSTS
FT                   NKHVHFEQNMSFFLWSESPNDLPSDAAWVSVANRAQFASSGLSMKAQAISPCVQNFCSA
FT                   LDSKLKVKLDDLLAYLPSSDTPLLKDTTPTHQPKNSAFDRYADAGTVQDMLRTQSVACI
FT                   KSVVGCIQAELCTIEEVTREQKDVLHSTKLHAVLFMARLCQSLGELCPHLKQCVVGQCG
FT                   GSEKPAREARALKKQGKGRAQDVLPAQAQWQGVKEVLLQQSVMAYRVWSTALVKFLICG
FT                   FTRSLLLRDAGSVLATATNWDELEIQEETESGSSVTSKIRLPTQPSWYVQSFLFSLCQE
FT                   VNRVGGHALPKVTLQEMLKTCMAQVIAAYEQLTEENQIKKEGAFPMTQNRALQLLYDLR
FT                   YLTMVLSSKGEEVKSGRSKADSRMEKMTERLEALIDPFDLDVFTPHLNSNLNRLVQRTS
FT                   VLFGLVTGTENQFASRSSTFNSQEPHNILPLASSQIRFGLLPLSMTSTRKARATSRSVE
FT                   TQAQFHKRKWGSVAKPLPKAVCRPG"
FT   CDS             join(12323468..12323782,12325752..12325993,
FT                   12326132..12326313,12326449..12326619,12327811..12327967,
FT                   12328875..12329085,12329767..12330555,12330910..12331056,
FT                   12331282..12331443,12332386..12332513,12333176..12333284,
FT                   12334868..12334977,12335065..12335143,12336132..12336272)
FT                   /codon_start=1
FT                   /gene="Cog1"
FT                   /locus_tag="mCG_16119"
FT                   /product="component of oligomeric golgi complex 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16119.2 transcript_id=mCT15635.2
FT                   protein_id=mCP10863.2 isoform=CRA_b"
FT                   /protein_id="EDL34411.1"
FT                   /translation="MAAATASSALKRLDLRDPNALFETHGAEEIRGLERQVRAEIEHKK
FT                   EELRQMVGERYRDLIEAADTIGQMRRCAEGLVDAVQATDQYCARLRQAGSVAPRVPRAP
FT                   QPQPPSEKFYSMAAQIKLLLEIPEKIWSAMEASQHLQATQLYLLCCHLHSLLQLDSSNS
FT                   RYSPILSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIMLLEESSP
FT                   RQALTDFLLARKATIQTLLNQSHHGAGIKAQICSLVELLATTLNQAHALFYTLPEGVLP
FT                   DPSLPCGLLFSTLETVTRQHPTGKGIGALQGEMKLCSWFRHLPTSIIEFQPTLRTLAHP
FT                   ISQEYLKDTLQKWIDMCNEDIKNGIGNLLMYVKSMKGLAGIRDAIWDLLSNESASHSWE
FT                   VVCQRLLEKPLLFWEDLMQQLFLDRLQTLTREGFESISNSSKELLVSALQELETNNSTS
FT                   NKHVHFEQNMSFFLWSESPNDLPSDAAWVSVANRAQFASSGLSMKAQAISPCVQNFCSA
FT                   LDSKLKVKLDDLLAYLPSSDTPLLKDTTPTHQPKNSAFDRYADAGTVQDMLRTQSVACI
FT                   KSVVGCIQAELCTIEEVTREQKDVLHSTKLHAVLFMARLCQSLGELCPHLKQCVVGQCG
FT                   GSEKPAREARALKKQGKGRAQDVLPAQAQWQGVKEVLLQQSVMAYRVWSTALVKFLICG
FT                   FTRSLLLRDAGSVLATATNWDELEIQEETESGSSVTSKIRLPTQPSWYVQSFLFSLCQE
FT                   VNRVGGHALPKVTLQEMLKTCMAQVIAAYEQLTEENQIKKEGAFPMTQNRALQLLYDLR
FT                   YLTMVLSSKGEEVKSGRSKADSRMEKMTERLEALIDPFDLDVFTPHLNSNLNRLVQRTS
FT                   VLFGLVTGTENQFASRSSTFNSQEPHNILPLASSQIRFGLLPLSMTSTRKARATSRSVE
FT                   TQAQVGPPALSRVGDPTTHPGSLFRQLASEEDDSPAPSLFKLAWLSSMTK"
FT   assembly_gap    12333886..12334006
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   gene            complement(12335181..12358602)
FT                   /gene="D11Wsu99e"
FT                   /locus_tag="mCG_1041997"
FT                   /note="gene_id=mCG1041997.2"
FT   mRNA            complement(join(12335181..12337441,12351251..12351312,
FT                   12357785..12357977))
FT                   /gene="D11Wsu99e"
FT                   /locus_tag="mCG_1041997"
FT                   /product="DNA segment, Chr 11, Wayne State University 99,
FT                   expressed, transcript variant mCT181647"
FT                   /note="gene_id=mCG1041997.2 transcript_id=mCT181647.0
FT                   created on 02-APR-2003"
FT   mRNA            complement(join(12335245..12337467,12351213..12351312,
FT                   12357785..12358164,12358526..12358602))
FT                   /gene="D11Wsu99e"
FT                   /locus_tag="mCG_1041997"
FT                   /product="DNA segment, Chr 11, Wayne State University 99,
FT                   expressed, transcript variant mCT171344"
FT                   /note="gene_id=mCG1041997.2 transcript_id=mCT171344.0
FT                   created on 02-APR-2003"
FT   mRNA            complement(join(12335245..12337467,12351213..12351312,
FT                   12357511..12357766))
FT                   /gene="D11Wsu99e"
FT                   /locus_tag="mCG_1041997"
FT                   /product="DNA segment, Chr 11, Wayne State University 99,
FT                   expressed, transcript variant mCT171345"
FT                   /note="gene_id=mCG1041997.2 transcript_id=mCT171345.0
FT                   created on 02-APR-2003"
FT   mRNA            complement(join(12335245..12337467,12351213..12351312,
FT                   12357046..>12357206))
FT                   /gene="D11Wsu99e"
FT                   /locus_tag="mCG_1041997"
FT                   /product="DNA segment, Chr 11, Wayne State University 99,
FT                   expressed, transcript variant mCT159701"
FT                   /note="gene_id=mCG1041997.2 transcript_id=mCT159701.1
FT                   created on 02-APR-2003"
FT   CDS             complement(join(12337234..12337467,12351213..12351312,
FT                   12357785..12357807))
FT                   /codon_start=1
FT                   /gene="D11Wsu99e"
FT                   /locus_tag="mCG_1041997"
FT                   /product="DNA segment, Chr 11, Wayne State University 99,
FT                   expressed, isoform CRA_b"
FT                   /note="gene_id=mCG1041997.2 transcript_id=mCT171344.0
FT                   protein_id=mCP94264.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9CQP1"
FT                   /db_xref="InterPro:IPR029222"
FT                   /db_xref="MGI:MGI:106351"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CQP1"
FT                   /protein_id="EDL34413.1"
FT                   /translation="MSERLRPRKRRRNGSDDDNHPPPQTKRSSRNPIFQDSWDTESSSS
FT                   DSGGSSSSSSINSPDRASGPESSLSHTIPGSCPSTPQPMPEQSALCQGPYFHINQTLKE
FT                   AHFHSLQHRGRPPT"
FT   CDS             complement(join(12337234..12337467,12351213..12351312,
FT                   12357511..12357737))
FT                   /codon_start=1
FT                   /gene="D11Wsu99e"
FT                   /locus_tag="mCG_1041997"
FT                   /product="DNA segment, Chr 11, Wayne State University 99,
FT                   expressed, isoform CRA_c"
FT                   /note="gene_id=mCG1041997.2 transcript_id=mCT171345.0
FT                   protein_id=mCP94263.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q3TYF6"
FT                   /db_xref="InterPro:IPR029222"
FT                   /db_xref="MGI:MGI:106351"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TYF6"
FT                   /protein_id="EDL34414.1"
FT                   /translation="MCALEPRGGRSRRGGGARLWAALLCGRRRRRGEGGAASDTWTPWA
FT                   AREATLWNPGLPLLRLFLVFFVFCPFRFGMRKRRRNGSDDDNHPPPQTKRSSRNPIFQD
FT                   SWDTESSSSDSGGSSSSSSINSPDRASGPESSLSHTIPGSCPSTPQPMPEQSALCQGPY
FT                   FHINQTLKEAHFHSLQHRGRPPT"
FT   CDS             complement(join(12337234..12337467,12351213..12351312,
FT                   12357046..>12357080))
FT                   /codon_start=1
FT                   /gene="D11Wsu99e"
FT                   /locus_tag="mCG_1041997"
FT                   /product="DNA segment, Chr 11, Wayne State University 99,
FT                   expressed, isoform CRA_a"
FT                   /note="gene_id=mCG1041997.2 transcript_id=mCT159701.1
FT                   protein_id=mCP75142.0 isoform=CRA_a"
FT                   /protein_id="EDL34412.1"
FT                   /translation="SFFSPYFPSGKKKRRRNGSDDDNHPPPQTKRSSRNPIFQDSWDTE
FT                   SSSSDSGGSSSSSSINSPDRASGPESSLSHTIPGSCPSTPQPMPEQSALCQGPYFHINQ
FT                   TLKEAHFHSLQHRGRPPT"
FT   CDS             complement(join(12337383..12337441,12351251..12351312,
FT                   12357785..12357807))
FT                   /codon_start=1
FT                   /gene="D11Wsu99e"
FT                   /locus_tag="mCG_1041997"
FT                   /product="DNA segment, Chr 11, Wayne State University 99,
FT                   expressed, isoform CRA_d"
FT                   /note="gene_id=mCG1041997.2 transcript_id=mCT181647.0
FT                   protein_id=mCP104569.0 isoform=CRA_d"
FT                   /protein_id="EDL34415.1"
FT                   /translation="MSERLRPRKRRRNGSDDDNHPPPQTKRSTAAAAASTAQTGPVGQR
FT                   AA"
FT   assembly_gap    12344869..12344979
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   gene            <12358332..12368844
FT                   /gene="D11Wsu47e"
FT                   /locus_tag="mCG_16122"
FT                   /note="gene_id=mCG16122.2"
FT   mRNA            join(<12358332..12358734,12361696..12363143,
FT                   12365567..12365671,12366235..12366342,12368710..12368844)
FT                   /gene="D11Wsu47e"
FT                   /locus_tag="mCG_16122"
FT                   /product="DNA segment, Chr 11, Wayne State University 47,
FT                   expressed, transcript variant mCT193237"
FT                   /note="gene_id=mCG16122.2 transcript_id=mCT193237.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(12358361..12358635,12361696..12363143,
FT                   12365567..12365671,12366235..12366342,12368710..12368844)
FT                   /gene="D11Wsu47e"
FT                   /locus_tag="mCG_16122"
FT                   /product="DNA segment, Chr 11, Wayne State University 47,
FT                   expressed, transcript variant mCT15638"
FT                   /note="gene_id=mCG16122.2 transcript_id=mCT15638.2 created
FT                   on 26-SEP-2002"
FT   CDS             join(<12358646..12358734,12361696..12363143,
FT                   12365567..12365671,12366235..12366342,12368710..12368732)
FT                   /codon_start=1
FT                   /gene="D11Wsu47e"
FT                   /locus_tag="mCG_16122"
FT                   /product="DNA segment, Chr 11, Wayne State University 47,
FT                   expressed, isoform CRA_a"
FT                   /note="gene_id=mCG16122.2 transcript_id=mCT193237.0
FT                   protein_id=mCP114222.0 isoform=CRA_a"
FT                   /protein_id="EDL34416.1"
FT                   /translation="SVANREVPARRELRTPVIPILGRRSCKTRRKSMGAAEPRMEVCPY
FT                   CKKPFKRLKSHLPHCKMRGPSISADQNVSQSKPAALAQKEKSPTRDLTRAKEKELEVDR
FT                   PKRAVKAETSRASWTAAASPLPEGILGSVRITKAEGENKDQNQFSFQALSQAKPEVTLQ
FT                   RVTTPWSPASDATSPKRELTQDVSESKGSPCPSETEAPSLVSSVEPFLANQDRKYSSTQ
FT                   PHANPATSVGLKLGTVDPQRQKLRVKLLDVPLSDRHSPKSGSHGVQRVTPSVLSREEGS
FT                   QDGDHLLGVSAHPGNTKTQKSESLLLGLHTGLLGKAPVREHQELGLGMELSQSKGNTEN
FT                   RMSVTNVQEGAGLGQGGKDPITATKAKPHAALELRNVFMPESGNQSLTSPAVTSTPEEN
FT                   AQFCGQSHVPAVTLSVESVRDVLEPTSFYQPHTAQAGHCLMSYSAQYPVPKTFVGHVAA
FT                   VTSGAPPRSVGLEWFPELYPAYVGLGVLPRRPPPWSLAAQVPPLPTLQGRSVSKVPWWG
FT                   RSSADSRSLEPLTLTTSSLPLMRLLGAVHKGWVQCNTTIKKSGVGGLTMLFAGYFILCC
FT                   NWSFKHLKLQHWRK"
FT   CDS             join(12361703..12363143,12365567..12365671,
FT                   12366235..12366342,12368710..12368732)
FT                   /codon_start=1
FT                   /gene="D11Wsu47e"
FT                   /locus_tag="mCG_16122"
FT                   /product="DNA segment, Chr 11, Wayne State University 47,
FT                   expressed, isoform CRA_b"
FT                   /note="gene_id=mCG16122.2 transcript_id=mCT15638.2
FT                   protein_id=mCP10852.2 isoform=CRA_b"
FT                   /protein_id="EDL34417.1"
FT                   /translation="MGAAEPRMEVCPYCKKPFKRLKSHLPHCKMRGPSISADQNVSQSK
FT                   PAALAQKEKSPTRDLTRAKEKELEVDRPKRAVKAETSRASWTAAASPLPEGILGSVRIT
FT                   KAEGENKDQNQFSFQALSQAKPEVTLQRVTTPWSPASDATSPKRELTQDVSESKGSPCP
FT                   SETEAPSLVSSVEPFLANQDRKYSSTQPHANPATSVGLKLGTVDPQRQKLRVKLLDVPL
FT                   SDRHSPKSGSHGVQRVTPSVLSREEGSQDGDHLLGVSAHPGNTKTQKSESLLLGLHTGL
FT                   LGKAPVREHQELGLGMELSQSKGNTENRMSVTNVQEGAGLGQGGKDPITATKAKPHAAL
FT                   ELRNVFMPESGNQSLTSPAVTSTPEENAQFCGQSHVPAVTLSVESVRDVLEPTSFYQPH
FT                   TAQAGHCLMSYSAQYPVPKTFVGHVAAVTSGAPPRSVGLEWFPELYPAYVGLGVLPRRP
FT                   PPWSLAAQVPPLPTLQGRSVSKVPWWGRSSADSRSLEPLTLTTSSLPLMRLLGAVHKGW
FT                   VQCNTTIKKSGVGGLTMLFAGYFILCCNWSFKHLKLQHWRK"
FT   assembly_gap    12367604..12367623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12370609..>12371458)
FT                   /locus_tag="mCG_1042149"
FT                   /note="gene_id=mCG1042149.1"
FT   mRNA            complement(join(12370609..12370714,12371110..>12371458))
FT                   /locus_tag="mCG_1042149"
FT                   /product="mCG1042149"
FT                   /note="gene_id=mCG1042149.1 transcript_id=mCT159853.1
FT                   created on 26-SEP-2002"
FT   assembly_gap    12370820..12370839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(12371160..>12371420)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042149"
FT                   /product="mCG1042149"
FT                   /note="gene_id=mCG1042149.1 transcript_id=mCT159853.1
FT                   protein_id=mCP75042.0"
FT                   /protein_id="EDL34418.1"
FT                   /translation="VNCSCLQTHQKRASDLITDGCEPPCDCWNLNSGPWEEQSVLLTAE
FT                   PSLQPPGLPWTGQPHCFAGRIKSAPLKSSVRKLREHTPPAW"
FT   gene            complement(12372768..>12384610)
FT                   /gene="D11Ertd636e"
FT                   /locus_tag="mCG_16121"
FT                   /note="gene_id=mCG16121.4"
FT   mRNA            complement(join(12372768..12373262,12374428..12374574,
FT                   12377006..12377102,12377864..12377959,12380988..12381140,
FT                   12383396..12383446,12384415..>12384610))
FT                   /gene="D11Ertd636e"
FT                   /locus_tag="mCG_16121"
FT                   /product="DNA segment, Chr 11, ERATO Doi 636, expressed,
FT                   transcript variant mCT193233"
FT                   /note="gene_id=mCG16121.4 transcript_id=mCT193233.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(12372768..12373262,12374428..12374574,
FT                   12376649..12376688,12377006..12377099,12377864..12377959,
FT                   12380988..12381140,12383396..12383446,12383979..12384115))
FT                   /gene="D11Ertd636e"
FT                   /locus_tag="mCG_16121"
FT                   /product="DNA segment, Chr 11, ERATO Doi 636, expressed,
FT                   transcript variant mCT15637"
FT                   /note="gene_id=mCG16121.4 transcript_id=mCT15637.2 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(12372768..12373262,12374428..12374574,
FT                   12376649..12376688,12377006..12377102,12377864..12377959,
FT                   12380988..12381140,12383396..12383446,12383979..>12384112))
FT                   /gene="D11Ertd636e"
FT                   /locus_tag="mCG_16121"
FT                   /product="DNA segment, Chr 11, ERATO Doi 636, expressed,
FT                   transcript variant mCT193234"
FT                   /note="gene_id=mCG16121.4 transcript_id=mCT193234.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(12372768..12373262,12374428..12374505,
FT                   12376649..12376688,12377006..12377102,12377864..12377959,
FT                   12380988..12381140,12383396..12383559))
FT                   /gene="D11Ertd636e"
FT                   /locus_tag="mCG_16121"
FT                   /product="DNA segment, Chr 11, ERATO Doi 636, expressed,
FT                   transcript variant mCT174015"
FT                   /note="gene_id=mCG16121.4 transcript_id=mCT174015.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(12373181..12373262,12374428..12374574,
FT                   12377006..12377102,12377864..12377959,12380988..12381140,
FT                   12383396..12383446,12384415..>12384418))
FT                   /codon_start=1
FT                   /gene="D11Ertd636e"
FT                   /locus_tag="mCG_16121"
FT                   /product="DNA segment, Chr 11, ERATO Doi 636, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16121.4 transcript_id=mCT193233.0
FT                   protein_id=mCP114220.0 isoform=CRA_b"
FT                   /protein_id="EDL34420.1"
FT                   /translation="AESSSAVCNFFAKGLCVKGMLCPLRHEQGEKLVVCKHWLRGLCRK
FT                   SDCCDFLHQYDVSKMPVCYFHSKFGNCSNKECLFLHLKPVLKLQDCPWYNQGFCKEVGP
FT                   LCKYRHVHQVLCPNYFTGFCPEGPQCQFGHCSLSTSHGIQQLLLATLWCPLSRQSPWST
FT                   VRGGGVCLRPAAQGHTLHLRPPCQQSKLYPLEPSKPSLKRGSWTFS"
FT   CDS             complement(join(12374428..12374574,12376649..12376688,
FT                   12377006..12377102,12377864..12377959,12380988..12381140,
FT                   12383396..12383446,12383979..>12384111))
FT                   /codon_start=1
FT                   /gene="D11Ertd636e"
FT                   /locus_tag="mCG_16121"
FT                   /product="DNA segment, Chr 11, ERATO Doi 636, expressed,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG16121.4 transcript_id=mCT193234.0
FT                   protein_id=mCP114221.0 isoform=CRA_c"
FT                   /protein_id="EDL34421.1"
FT                   /translation="SFCFSGGRRKMEEVIAGLQGFTFAFELDVESQKGTGLLPFQGMDK
FT                   SSSAVCNFFAKGLCVKGMLCPLRHEQGEKLVVCKHWLRGLCRKSDCCDFLHQYDVSKMP
FT                   VCYFHSKFGNCSNKECLFLHLKPVLKLQDCPWYNQGFCKEVGPLCKYRHVHQVLCPNYF
FT                   TGFCPEGPQCQFGHPKMSPPFHPSNVKLQPVNQPWDSTTSTGNTLVSPFQAKPMVHGQR
FT                   RWSLPQACSSRAHPAP"
FT   CDS             complement(join(12374428..12374574,12376649..12376688,
FT                   12377006..12377099,12377864..12377959,12380988..12381140,
FT                   12383396..12383446,12383979..12384081))
FT                   /codon_start=1
FT                   /gene="D11Ertd636e"
FT                   /locus_tag="mCG_16121"
FT                   /product="DNA segment, Chr 11, ERATO Doi 636, expressed,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG16121.4 transcript_id=mCT15637.2
FT                   protein_id=mCP10868.2 isoform=CRA_d"
FT                   /protein_id="EDL34422.1"
FT                   /translation="MEEVIAGLQGFTFAFELDVESQKGTGLLPFQGMDKSSSAVCNFFA
FT                   KGLCVKGMLCPLRHEQGEKLVVCKHWLRGLCRKSDCCDFLHQYDVSKMPVCYFHSKFGN
FT                   CSNKECLFLHLKPVLKLQDCPWYNQGFCKEGPLCKYRHVHQVLCPNYFTGFCPEGPQCQ
FT                   FGHPKMSPPFHPSNVKLQPVNQPWDSTTSTGNTLVSPFQAKPMVHGQRRWSLPQACSSR
FT                   AHPAP"
FT   CDS             complement(join(12374428..12374505,12376649..12376688,
FT                   12377006..12377102,12377864..12377959,12380988..12381138))
FT                   /codon_start=1
FT                   /gene="D11Ertd636e"
FT                   /locus_tag="mCG_16121"
FT                   /product="DNA segment, Chr 11, ERATO Doi 636, expressed,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG16121.4 transcript_id=mCT174015.0
FT                   protein_id=mCP96933.0 isoform=CRA_e"
FT                   /db_xref="GOA:A2A6P9"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="MGI:MGI:1277182"
FT                   /db_xref="UniProtKB/TrEMBL:A2A6P9"
FT                   /protein_id="EDL34423.1"
FT                   /translation="MLCPLRHEQGEKLVVCKHWLRGLCRKSDCCDFLHQYDVSKMPVCY
FT                   FHSKFGNCSNKECLFLHLKPVLKLQDCPWYNQGFCKEVGPLCKYRHVHQVLCPNYFTGF
FT                   CPEGPQCQFGHPKMSPPFHPSNVKAKPMVHGQRRWSLPQACSSRAHPAP"
FT   mRNA            complement(join(12377382..12377959,12380988..12381140,
FT                   12383396..12383446,12383979..12384116))
FT                   /gene="D11Ertd636e"
FT                   /locus_tag="mCG_16121"
FT                   /product="DNA segment, Chr 11, ERATO Doi 636, expressed,
FT                   transcript variant mCT174016"
FT                   /note="gene_id=mCG16121.4 transcript_id=mCT174016.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(12377784..12377959,12380988..12381140,
FT                   12383396..12383446,12383979..12384081))
FT                   /codon_start=1
FT                   /gene="D11Ertd636e"
FT                   /locus_tag="mCG_16121"
FT                   /product="DNA segment, Chr 11, ERATO Doi 636, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16121.4 transcript_id=mCT174016.0
FT                   protein_id=mCP96934.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TTY7"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="MGI:MGI:1277182"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TTY7"
FT                   /protein_id="EDL34419.1"
FT                   /translation="MEEVIAGLQGFTFAFELDVESQKGTGLLPFQGMDKSSSAVCNFFA
FT                   KGLCVKGMLCPLRHEQGEKLVVCKHWLRGLCRKSDCCDFLHQYDVSKMPVCYFHSKFGN
FT                   CSNKECLFLHLKPVLKLQDCPWYNQGFCKEGKSLRDRDRMPEGCGCSRWRCSASKE"
FT   assembly_gap    12394598..12395086
FT                   /estimated_length=489
FT                   /gap_type="unknown"
FT   gene            complement(12401577..12429222)
FT                   /gene="Cdc42ep4"
FT                   /locus_tag="mCG_16120"
FT                   /note="gene_id=mCG16120.2"
FT   mRNA            complement(join(12401577..12404392,12427651..12428239))
FT                   /gene="Cdc42ep4"
FT                   /locus_tag="mCG_16120"
FT                   /product="CDC42 effector protein (Rho GTPase binding) 4,
FT                   transcript variant mCT15636"
FT                   /note="gene_id=mCG16120.2 transcript_id=mCT15636.1 created
FT                   on 31-JUL-2002"
FT   mRNA            complement(join(12401583..12404392,12429106..12429222))
FT                   /gene="Cdc42ep4"
FT                   /locus_tag="mCG_16120"
FT                   /product="CDC42 effector protein (Rho GTPase binding) 4,
FT                   transcript variant mCT171350"
FT                   /note="gene_id=mCG16120.2 transcript_id=mCT171350.0 created
FT                   on 31-JUL-2002"
FT   mRNA            complement(join(12401583..12404392,12428609..12428729))
FT                   /gene="Cdc42ep4"
FT                   /locus_tag="mCG_16120"
FT                   /product="CDC42 effector protein (Rho GTPase binding) 4,
FT                   transcript variant mCT171349"
FT                   /note="gene_id=mCG16120.2 transcript_id=mCT171349.0 created
FT                   on 31-JUL-2002"
FT   CDS             complement(12403241..12404290)
FT                   /codon_start=1
FT                   /gene="Cdc42ep4"
FT                   /locus_tag="mCG_16120"
FT                   /product="CDC42 effector protein (Rho GTPase binding) 4,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16120.2 transcript_id=mCT15636.1
FT                   protein_id=mCP10867.2 isoform=CRA_a"
FT                   /protein_id="EDL34424.1"
FT                   /translation="MPILKQLVSSSVNSKRRSRADLTAEMISAPLGDFRHTMHVGRAGD
FT                   AFGDTSFLTSKAREADDESLDEQASASKLSLLSRKFRGSKRSQSVTRGDREQRDMLGSL
FT                   RDSALFVKNAMSLPQLNEKEAAEKDSSKLPKSLSSSPVKKADARDGGPKSPHRNGATGP
FT                   HSPDPLLDEQAFGDLMDLPIMPKVSYGLKHAESILSFHIDLGPSMLGDVLSIMDKDQWG
FT                   SEEEEEAGGYRDKEGPSSIVQAPPVLEVVPPLGRQESKASWDQASMLPPHAVEDDGWAV
FT                   VAPSPSSARSVGSHTTRDSSSLSSYTSGVLEERSPAFRGPDRVAAAPPRQPDKEFCFMD
FT                   EEEEDEIRV"
FT   CDS             complement(12403241..12404290)
FT                   /codon_start=1
FT                   /gene="Cdc42ep4"
FT                   /locus_tag="mCG_16120"
FT                   /product="CDC42 effector protein (Rho GTPase binding) 4,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16120.2 transcript_id=mCT171349.0
FT                   protein_id=mCP94268.0 isoform=CRA_a"
FT                   /protein_id="EDL34425.1"
FT                   /translation="MPILKQLVSSSVNSKRRSRADLTAEMISAPLGDFRHTMHVGRAGD
FT                   AFGDTSFLTSKAREADDESLDEQASASKLSLLSRKFRGSKRSQSVTRGDREQRDMLGSL
FT                   RDSALFVKNAMSLPQLNEKEAAEKDSSKLPKSLSSSPVKKADARDGGPKSPHRNGATGP
FT                   HSPDPLLDEQAFGDLMDLPIMPKVSYGLKHAESILSFHIDLGPSMLGDVLSIMDKDQWG
FT                   SEEEEEAGGYRDKEGPSSIVQAPPVLEVVPPLGRQESKASWDQASMLPPHAVEDDGWAV
FT                   VAPSPSSARSVGSHTTRDSSSLSSYTSGVLEERSPAFRGPDRVAAAPPRQPDKEFCFMD
FT                   EEEEDEIRV"
FT   CDS             complement(12403241..12404290)
FT                   /codon_start=1
FT                   /gene="Cdc42ep4"
FT                   /locus_tag="mCG_16120"
FT                   /product="CDC42 effector protein (Rho GTPase binding) 4,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16120.2 transcript_id=mCT171350.0
FT                   protein_id=mCP94269.0 isoform=CRA_a"
FT                   /protein_id="EDL34426.1"
FT                   /translation="MPILKQLVSSSVNSKRRSRADLTAEMISAPLGDFRHTMHVGRAGD
FT                   AFGDTSFLTSKAREADDESLDEQASASKLSLLSRKFRGSKRSQSVTRGDREQRDMLGSL
FT                   RDSALFVKNAMSLPQLNEKEAAEKDSSKLPKSLSSSPVKKADARDGGPKSPHRNGATGP
FT                   HSPDPLLDEQAFGDLMDLPIMPKVSYGLKHAESILSFHIDLGPSMLGDVLSIMDKDQWG
FT                   SEEEEEAGGYRDKEGPSSIVQAPPVLEVVPPLGRQESKASWDQASMLPPHAVEDDGWAV
FT                   VAPSPSSARSVGSHTTRDSSSLSSYTSGVLEERSPAFRGPDRVAAAPPRQPDKEFCFMD
FT                   EEEEDEIRV"
FT   assembly_gap    12417545..12417564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12419957..12419976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12430760..12430910
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    12437773..12437792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12449440..12449459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12456675..12550983)
FT                   /locus_tag="mCG_16114"
FT                   /note="gene_id=mCG16114.2"
FT   mRNA            complement(join(12456675..12457643,12468087..12468201,
FT                   12470011..12470149,12470434..12470574,12471634..12471798,
FT                   12476854..12476979,12479836..12479997,12482980..12483117,
FT                   12487042..12487228,12499546..12499661,12499774..12499875,
FT                   12503217..12503352,12504644..12504714,12505229..12505332,
FT                   12506560..12506761,12508100..12508294,12508982..12509080,
FT                   12510456..12510645,12511325..12511440,12512957..12513194,
FT                   12516712..12516862,12516945..12517054,12517631..12517752,
FT                   12520359..12520550,12520993..12521091,12521249..12521444,
FT                   12528667..12528782,12529473..12529654,12532042..12532182,
FT                   12534399..12534546,12535469..12535605,12537587..12537763,
FT                   12545052..12545154,12545965..12546132,12546910..12547026,
FT                   12547811..12548005,12550900..12550983))
FT                   /locus_tag="mCG_16114"
FT                   /product="mCG16114"
FT                   /note="gene_id=mCG16114.2 transcript_id=mCT15630.2 created
FT                   on 26-SEP-2002"
FT   CDS             complement(join(12457290..12457643,12468087..12468201,
FT                   12470011..12470149,12470434..12470574,12471634..12471798,
FT                   12476854..12476979,12479836..12479997,12482980..12483117,
FT                   12487042..12487228,12499546..12499661,12499774..12499875,
FT                   12503217..12503352,12504644..12504714,12505229..12505332,
FT                   12506560..12506761,12508100..12508294,12508982..12509080,
FT                   12510456..12510645,12511325..12511440,12512957..12513194,
FT                   12516712..12516862,12516945..12517054,12517631..12517752,
FT                   12520359..12520550,12520993..12521091,12521249..12521444,
FT                   12528667..12528782,12529473..12529654,12532042..12532182,
FT                   12534399..12534546,12535469..12535605,12537587..12537763,
FT                   12545052..12545154,12545965..12546132,12546910..12547026,
FT                   12547811..12548005,12550900..12550936))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16114"
FT                   /product="mCG16114"
FT                   /note="gene_id=mCG16114.2 transcript_id=mCT15630.2
FT                   protein_id=mCP10853.2"
FT                   /protein_id="EDL34427.1"
FT                   /translation="MEKVVDIPCRAKGIPPPSITWYKDAALVEVGKLTRFKQRSDGGLQ
FT                   ISGLLPDDTGMLQCFAHNAAGEAQTSTYLAVTSIAPNITRGPLDSTVIDGMSVVLACET
FT                   SGAPRPAITWQKGERILASGSVQLPRFTLLESGSLLISPTHISDAGTYTCLATNSRGVD
FT                   EASADLVVWARTRITKPPQDQSVIKGTQASMVCGVTHDPRVTVRYVWEKDGATLAVETN
FT                   PRIRLDRNGSLHISQTWSGDIGTYTCRVLSAGGNDSRNAHLRVRQLPHAPEHPVATLST
FT                   VERRAINLTWAKPFDGNSPLMRYVLEMSENNAPWTILLASVDPEATSVMVKGLVPARSY
FT                   QFRLCAVNDVGKGQFSKDTERVSLPEEPPTAPPQNVIASGRTNQSIMIQWQPPPESHQN
FT                   GILKGYIIRYCLAGLPVGYQFKNITDADVNNLLLEDLIIWTNYEIEVAAYNSAGLGVYS
FT                   SKVTEWTLQGVPTVPPGNVHAEATNSTTIRFTWNAPSPQFINGINQGYKLIAWEPAQEE
FT                   EVTMVTARPNFQDSIHVGFVSGLKKFTEYFTSVLCFTTPGDGPRSSPQLVRTHEDVPGP
FT                   VGHLSFNDILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVT
FT                   GLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPELPGAPTNLGISNIGPRSVTLQFRP
FT                   GYDGKTSISRWVVEAQVGVIGEGEEWLLIYQLGNEPDARSMEVPDLNPFTYYSFRMRQV
FT                   NIVGTSPPSQPSRKIQTLQAPPDIAPANVTLRTASETSLWLRWMPLPEMEYNGNPESVG
FT                   YKIKYGRSDGHGKTLSHTVQDRVEREYTIEDLEEWTEYRVQVQAFNAIGSGPWSQAVVG
FT                   RTRESVPSSGPTNVSALATTSSSMLVRWSEIPEADRNGLVLGYKVRYKEKDSDSQPRFW
FT                   LVEGNSSRSAQLTGLGKYVLYEVQVLAFTRIGDGSPSHPPILERTLDDVPGPPMGILFP
FT                   EVRTTSVRLIWQPPAAPNGIILAYQITHRLNATTANTATVEVLAPSARQYMATGLKPES
FT                   VYLFRITAQTRKGWGEAAEALVVTTEKRDRPQPPSKPVVQQEDVKARSVLLSWEPGSDG
FT                   LSPVRYYTIQTRELPSGRWALHSASVSHNASAFTVDRLKPFTSYKFRVKATNDIGDSEF
FT                   SEESESLTTLQAAPDEAPTILSVTPHTTTSVLIRWQPPSEDKINGILLGFRIRYRELLY
FT                   DGLRGFTLRGINNPGAKWAELTYLSKHRRYEIRMSIYNAVGEGPLSPPQEVFVGEAVPT
FT                   AAPQNVAIHSATATQLDVTWEPPPLDNQNGDIQGYKIYFWEVQRRNLTERVKTLFLAEN
FT                   SVKLKNLTGYTAYMVSVAAFNAAGDGPRSTPTRGQTQQAAPSAPGSVKFSELTTTSVNV
FT                   SWDAPQFPNGPLEGYRLVYEPCTPVDGVSKIVTVDVKGNSPLWLKVKDLAEGMTYRFRI
FT                   KAKTFTYGPEIEANITTGPGEGAPGPPGVPIIVRYSSAIAIHWSSGDPGKGPITRYVIE
FT                   ARPSDEGLWDILIKDIPKEVTSYTFSMDILKPGVSYDFRVIAVNDYGFGTPSSPSQSVP
FT                   AQKASPFYEEWWFLVVIALVGLIFILLLVFVLIIRGQSKKYSKKTDSGGNTKSGALGHG
FT                   EMLSLDESSFPALELNNRRLSVKNSFCRKNGLYTRPSPGSLHYSDEDVTKYNDLIPAES
FT                   SSLTEKPSEISDSQGSDSEYEVDTNTQKAHSFVNHYISDPTYYNSWRRQQKGISRAQAY
FT                   SYTESDSGEPDHVTVPNSNSTQQGSLFRPKASRTPTPQNPPNPQSQQSTLYRPPSSLAP
FT                   GSRAPIAGFSSFV"
FT   assembly_gap    12457843..12457901
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    12459165..12459512
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    12491017..12491036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12492286..12492305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12514291..12514533
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    12523504..12523523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12525184..12525814
FT                   /estimated_length=631
FT                   /gap_type="unknown"
FT   assembly_gap    12526297..12526316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12543314..12543333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12547685..12547729
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    12554784..12554858
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    12562795..12562814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12565239..12565258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12573304..12573323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12579899..12580239
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    12582268..12582287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12589649..12592490
FT                   /estimated_length=2842
FT                   /gap_type="unknown"
FT   assembly_gap    12593727..12593746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12613643..12743317)
FT                   /locus_tag="mCG_148162"
FT                   /note="gene_id=mCG148162.0"
FT   mRNA            complement(join(12613643..12615486,12742090..12743317))
FT                   /locus_tag="mCG_148162"
FT                   /product="mCG148162"
FT                   /note="gene_id=mCG148162.0 transcript_id=mCT188425.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(12615224..12615486,12742090..12742165))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148162"
FT                   /product="mCG148162"
FT                   /note="gene_id=mCG148162.0 transcript_id=mCT188425.0
FT                   protein_id=mCP109339.0"
FT                   /protein_id="EDL34428.1"
FT                   /translation="MFSSMWRLPLWTLLALHRIHSAGAQDDVPPYFKTEPVRTQVHLEG
FT                   NRLVLTCMAEGSWPLEFKWLHNNRELTRFSLEYRQVAPSHLPGASHLPIQRKEGRRPGY
FT                   IHAPQAPM"
FT   assembly_gap    12618642..12618661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12629167..12629186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12630693..12630712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12632371..12632390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12642722..12643699
FT                   /estimated_length=978
FT                   /gap_type="unknown"
FT   assembly_gap    12644607..12644626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12652794..12652947
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    12657036..12657148
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    12683128..12683168
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    12691938..12691957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12717877..12717896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12735891..12735970
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    12743532..12746070
FT                   /estimated_length=2539
FT                   /gap_type="unknown"
FT   assembly_gap    12757162..12757295
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    12765277..12765571
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   gene            12767517..12771361
FT                   /locus_tag="mCG_148167"
FT                   /note="gene_id=mCG148167.0"
FT   mRNA            join(12767517..12767910,12770991..12771361)
FT                   /locus_tag="mCG_148167"
FT                   /product="mCG148167"
FT                   /note="gene_id=mCG148167.0 transcript_id=mCT188430.0
FT                   created on 13-JAN-2004"
FT   CDS             12767594..12767689
FT                   /codon_start=1
FT                   /locus_tag="mCG_148167"
FT                   /product="mCG148167"
FT                   /note="gene_id=mCG148167.0 transcript_id=mCT188430.0
FT                   protein_id=mCP109344.0"
FT                   /protein_id="EDL34429.1"
FT                   /translation="MVPPTGDWAFQYQLAMHFLTDMSMEQSNLGS"
FT   assembly_gap    12786692..12786788
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    12798301..12798956
FT                   /estimated_length=656
FT                   /gap_type="unknown"
FT   assembly_gap    12819718..12820017
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    12821328..12821381
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    12829965..12829984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12862473..>12863796)
FT                   /locus_tag="mCG_1042153"
FT                   /note="gene_id=mCG1042153.0"
FT   mRNA            complement(join(12862473..12862775,12863149..12863364,
FT                   12863571..>12863796))
FT                   /locus_tag="mCG_1042153"
FT                   /product="mCG1042153"
FT                   /note="gene_id=mCG1042153.0 transcript_id=mCT159857.0
FT                   created on 04-APR-2003"
FT   CDS             complement(join(12862745..12862775,12863149..12863364,
FT                   12863571..>12863707))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042153"
FT                   /product="mCG1042153"
FT                   /note="gene_id=mCG1042153.0 transcript_id=mCT159857.0
FT                   protein_id=mCP75081.0"
FT                   /protein_id="EDL34430.1"
FT                   /translation="SDYILSPFWAKPFCWQIPCGKRVSRGGSIPHPEVVGGRRSQDSSF
FT                   SDGWASWKWGRQLKNREARFPPHPTVHMLWTLESKFRGHLRPASLRTDSVKRHSGGPCA
FT                   GCSYRAKETSTHASNDARELGSG"
FT   assembly_gap    12862884..12862903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12864507..12864926
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    12871365..12871384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12873841..12873998
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   gene            <12875671..12876613
FT                   /locus_tag="mCG_146064"
FT                   /note="gene_id=mCG146064.0"
FT   mRNA            join(<12875671..12875737,12876140..12876291,
FT                   12876437..12876613)
FT                   /locus_tag="mCG_146064"
FT                   /product="mCG146064"
FT                   /note="gene_id=mCG146064.0 transcript_id=mCT186167.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<12875672..12875737,12876140..12876291,
FT                   12876437..12876596)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146064"
FT                   /product="mCG146064"
FT                   /note="gene_id=mCG146064.0 transcript_id=mCT186167.0
FT                   protein_id=mCP107578.0"
FT                   /protein_id="EDL34431.1"
FT                   /translation="TVSWSRWWKACIQYLEWWEQEEIGLAELREDSMCVCLRVHRGHVC
FT                   AQDCSMGLPVHRDTHSAPFHTGTLSGPDPRSRGTYRSFSKTRQNFLSIHLSKLPAAPLR
FT                   SRYNKNKILSTTSNRETGGGQ"
FT   assembly_gap    12882302..12882431
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   gene            complement(12896699..12916108)
FT                   /locus_tag="mCG_148154"
FT                   /note="gene_id=mCG148154.0"
FT   mRNA            complement(join(12896699..12896974,12914528..12916108))
FT                   /locus_tag="mCG_148154"
FT                   /product="mCG148154"
FT                   /note="gene_id=mCG148154.0 transcript_id=mCT188417.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(12896715..12896974,12914528..12914582))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148154"
FT                   /product="mCG148154"
FT                   /note="gene_id=mCG148154.0 transcript_id=mCT188417.0
FT                   protein_id=mCP109332.0"
FT                   /protein_id="EDL34432.1"
FT                   /translation="MCTSQSDFGSHSIETLFLGTEDSGLRSSCCAARVYPLSHHLSPPL
FT                   ERTSKVSIPLYPIPTKAHSLGSRAWLRHLQSETFPRQSTAGAAAGTHPTLVITHSTTTI
FT                   "
FT   assembly_gap    12901364..12901477
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    12907443..12907611
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    12913244..12913514
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    12943362..12943381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12946583..12946864
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    12960716..12960772
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    12963537..12963946
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    12973947..12974151
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    12980601..12980760
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    12982391..12982840
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    12992227..12992629
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    13003691..13003801
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    13012980..13012999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13021115..13021432
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    13026957..13026976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13047275..13047608
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    13051048..13051683
FT                   /estimated_length=636
FT                   /gap_type="unknown"
FT   assembly_gap    13059763..13060722
FT                   /estimated_length=960
FT                   /gap_type="unknown"
FT   assembly_gap    13063128..13063147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13065345..13065563
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    13067459..13067566
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   gene            complement(13090640..13126457)
FT                   /gene="4932435O22Rik"
FT                   /locus_tag="mCG_145527"
FT                   /note="gene_id=mCG145527.0"
FT   mRNA            complement(join(13090640..13093529,13100769..13101035,
FT                   13126267..13126457))
FT                   /gene="4932435O22Rik"
FT                   /locus_tag="mCG_145527"
FT                   /product="RIKEN cDNA 4932435O22"
FT                   /note="gene_id=mCG145527.0 transcript_id=mCT184951.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(13091698..13092069)
FT                   /codon_start=1
FT                   /gene="4932435O22Rik"
FT                   /locus_tag="mCG_145527"
FT                   /product="RIKEN cDNA 4932435O22"
FT                   /note="gene_id=mCG145527.0 transcript_id=mCT184951.0
FT                   protein_id=mCP105797.0"
FT                   /db_xref="MGI:MGI:2442791"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BGG8"
FT                   /protein_id="EDL34433.1"
FT                   /translation="MEKRGIDIERSTCGSITIKEAKVQKIERNFISIQSSHLGRRGLED
FT                   IETKFHEVLKRKVSVCHPEFYTQLNYSSKNKWRGWRDALARKSVCCSCRVHLDPSSHTG
FT                   SLTAAYNSSSVFWTLRNCT"
FT   assembly_gap    13094821..13094840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13105192..13105211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13107558..13107628
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            <13108386..13111483
FT                   /locus_tag="mCG_1042156"
FT                   /note="gene_id=mCG1042156.1"
FT   mRNA            join(<13108386..13108517,13111182..13111483)
FT                   /locus_tag="mCG_1042156"
FT                   /product="mCG1042156"
FT                   /note="gene_id=mCG1042156.1 transcript_id=mCT159860.1
FT                   created on 28-MAY-2003"
FT   CDS             join(<13108386..13108517,13111182..13111277)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042156"
FT                   /product="mCG1042156"
FT                   /note="gene_id=mCG1042156.1 transcript_id=mCT159860.1
FT                   protein_id=mCP75096.1"
FT                   /protein_id="EDL34434.1"
FT                   /translation="QEAAKPLRPAQSHVAQDTSGMWLFLTEPSAQLSSTPGGWLIPSQR
FT                   LQRMAKSLWLGWRRAEAKRPEKRKGPGSGL"
FT   assembly_gap    13111583..13111657
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    13117928..13118178
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    13120614..13120788
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    13133959..13133978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13141305..13141324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13148975..13148994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13150615..13150843
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    13160695..13160787
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    13166227..13166359
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    13173474..13173763
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    13185277..13185423
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    13188715..13188734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13189074..>13199370)
FT                   /locus_tag="mCG_1042157"
FT                   /note="gene_id=mCG1042157.0"
FT   mRNA            complement(join(13189074..13189289,13189405..13189461,
FT                   13197606..13197789,13199123..>13199370))
FT                   /locus_tag="mCG_1042157"
FT                   /product="mCG1042157"
FT                   /note="gene_id=mCG1042157.0 transcript_id=mCT159861.0
FT                   created on 10-APR-2003"
FT   CDS             complement(join(13189163..13189289,13189405..13189461,
FT                   13197606..>13197775))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042157"
FT                   /product="mCG1042157"
FT                   /note="gene_id=mCG1042157.0 transcript_id=mCT159861.0
FT                   protein_id=mCP75105.0"
FT                   /protein_id="EDL34435.1"
FT                   /translation="ILPTTMFSWMWISSEPSEKTLSPDLRPVRDPESAPGGTVPRLQRP
FT                   SEKNGAFRCQVWTELLRKKIELAPKERLLNSACSGICDYDIPMRTMADSHVRKQLESFP
FT                   VQIKHRLHLKLSQ"
FT   assembly_gap    13214650..13214669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13215113..13215412
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    13218024..13218180
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    13219747..13220034
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    13233704..13233723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <13233854..13241870
FT                   /locus_tag="mCG_1042158"
FT                   /note="gene_id=mCG1042158.1"
FT   mRNA            join(<13233854..13233870,13241220..13241423,
FT                   13241653..13241870)
FT                   /locus_tag="mCG_1042158"
FT                   /product="mCG1042158"
FT                   /note="gene_id=mCG1042158.1 transcript_id=mCT159862.1
FT                   created on 10-APR-2003"
FT   CDS             join(<13233854..13233870,13241220..13241400)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042158"
FT                   /product="mCG1042158"
FT                   /note="gene_id=mCG1042158.1 transcript_id=mCT159862.1
FT                   protein_id=mCP75114.0"
FT                   /protein_id="EDL34436.1"
FT                   /translation="IYRASSERVVNSMLQGMLIIKQIATFLPPPTCFLGSKSVHSKKVT
FT                   LTHPDHCWNPLCKGAIARGS"
FT   assembly_gap    13234800..13234819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13274686..13275056
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    13275850..13276109
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    13295480..13296043
FT                   /estimated_length=564
FT                   /gap_type="unknown"
FT   assembly_gap    13302400..13302419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13305020..13309671
FT                   /estimated_length=4652
FT                   /gap_type="unknown"
FT   assembly_gap    13310781..13311457
FT                   /estimated_length=677
FT                   /gap_type="unknown"
FT   assembly_gap    13313523..13314113
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    13315856..13316735
FT                   /estimated_length=880
FT                   /gap_type="unknown"
FT   assembly_gap    13318590..13318609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13322098..13322496
FT                   /estimated_length=399
FT                   /gap_type="unknown"
FT   assembly_gap    13325764..13327408
FT                   /estimated_length=1645
FT                   /gap_type="unknown"
FT   assembly_gap    13329992..13330011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13334013..13334398
FT                   /estimated_length=386
FT                   /gap_type="unknown"
FT   assembly_gap    13335152..13335377
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   gene            13336115..13341635
FT                   /locus_tag="mCG_13615"
FT                   /note="gene_id=mCG13615.2"
FT   mRNA            join(13336115..13336559,13336731..13336764,
FT                   13336856..13336916,13340859..13340981,13341390..13341635)
FT                   /locus_tag="mCG_13615"
FT                   /product="mCG13615, transcript variant mCT15559"
FT                   /note="gene_id=mCG13615.2 transcript_id=mCT15559.1 created
FT                   on 31-JUL-2002"
FT   mRNA            join(13336556..13336576,13336731..13336764,
FT                   13336856..13336916,13340859..13340981,13341390..13341635)
FT                   /locus_tag="mCG_13615"
FT                   /product="mCG13615, transcript variant mCT171346"
FT                   /note="gene_id=mCG13615.2 transcript_id=mCT171346.0 created
FT                   on 31-JUL-2002"
FT   mRNA            join(13336586..13336635,13336731..13336764,
FT                   13336856..13336916,13340859..13340981,13341390..13341635)
FT                   /locus_tag="mCG_13615"
FT                   /product="mCG13615, transcript variant mCT171347"
FT                   /note="gene_id=mCG13615.2 transcript_id=mCT171347.0 created
FT                   on 31-JUL-2002"
FT   CDS             join(13336762..13336764,13336856..13336916,
FT                   13340859..13340981,13341390..13341415)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13615"
FT                   /product="mCG13615, isoform CRA_a"
FT                   /note="gene_id=mCG13615.2 transcript_id=mCT15559.1
FT                   protein_id=mCP10858.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q52KP0"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="MGI:MGI:1914921"
FT                   /db_xref="UniProtKB/TrEMBL:Q52KP0"
FT                   /protein_id="EDL34437.1"
FT                   /translation="MPRKIEEIKDFLLTARRKDAKSVKIKKNKDNVKFKVRCSRYLYTL
FT                   VITDKEKAEKLKQSLPPGLAVKDLK"
FT   CDS             join(13336762..13336764,13336856..13336916,
FT                   13340859..13340981,13341390..13341415)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13615"
FT                   /product="mCG13615, isoform CRA_a"
FT                   /note="gene_id=mCG13615.2 transcript_id=mCT171346.0
FT                   protein_id=mCP94266.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q52KP0"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="MGI:MGI:1914921"
FT                   /db_xref="UniProtKB/TrEMBL:Q52KP0"
FT                   /protein_id="EDL34438.1"
FT                   /translation="MPRKIEEIKDFLLTARRKDAKSVKIKKNKDNVKFKVRCSRYLYTL
FT                   VITDKEKAEKLKQSLPPGLAVKDLK"
FT   CDS             join(13336762..13336764,13336856..13336916,
FT                   13340859..13340981,13341390..13341415)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13615"
FT                   /product="mCG13615, isoform CRA_a"
FT                   /note="gene_id=mCG13615.2 transcript_id=mCT171347.0
FT                   protein_id=mCP94265.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q52KP0"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="MGI:MGI:1914921"
FT                   /db_xref="UniProtKB/TrEMBL:Q52KP0"
FT                   /protein_id="EDL34439.1"
FT                   /translation="MPRKIEEIKDFLLTARRKDAKSVKIKKNKDNVKFKVRCSRYLYTL
FT                   VITDKEKAEKLKQSLPPGLAVKDLK"
FT   gene            <13344683..>13389330
FT                   /gene="Ttyh2"
FT                   /locus_tag="mCG_145528"
FT                   /note="gene_id=mCG145528.0"
FT   mRNA            join(<13344683..13344830,13355565..13355737,
FT                   13359651..13359762,13366003..13366223,13371201..13371296,
FT                   13371656..13371728,13376743..13376812,13377086..13377141,
FT                   13377824..13377916,13378178..13378270,13379502..13379644,
FT                   13380270..13380455,13381219..13381297,13389256..>13389330)
FT                   /gene="Ttyh2"
FT                   /locus_tag="mCG_145528"
FT                   /product="tweety homolog 2 (Drosophila)"
FT                   /note="gene_id=mCG145528.0 transcript_id=mCT184952.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<13344684..13344830,13355565..13355737,
FT                   13359651..13359762,13366003..13366223,13371201..13371296,
FT                   13371656..13371728,13376743..13376812,13377086..13377141,
FT                   13377824..13377916,13378178..13378270,13379502..13379644,
FT                   13380270..13380455,13381219..13381297,13389256..13389330)
FT                   /codon_start=1
FT                   /gene="Ttyh2"
FT                   /locus_tag="mCG_145528"
FT                   /product="tweety homolog 2 (Drosophila)"
FT                   /note="gene_id=mCG145528.0 transcript_id=mCT184952.0
FT                   protein_id=mCP105796.0"
FT                   /protein_id="EDL34440.1"
FT                   /translation="LQLVQAMPAARVEYIAPWWVVWLHSVPHLGLRLQRVDSTFSPGDE
FT                   TYQESLLFLGVLAAIGLGLNLIFLTVYLVCTCCCRRDHTVQTKQQESCCVTWTAVVAGL
FT                   LCCAAVGVGFYGNSETNDGMHQLIYSLDNANHTFSGMDELVSANTQRMKVDLEQHLARL
FT                   SEIIAARGDYIQTLKFMQQMAGNVVSQLSGLPVWREVTTQLTKLSHQTAYVEYYRWLSY
FT                   LLLFILDLVICLVTCLGLARRSKCLLASMLCCGILTLILSWASLAADAAAAVGTSDFCM
FT                   APDIYILNNTGSQINSEVTRYYLHCSQSLISPFQQSLTTFQRSLTTMQIQVGGLLQFAV
FT                   PLFPTAEKDLLGIQLLLNNSEISLHQLTAMLDCRGLHKDYLDALTGICYDGIEGLLFLG
FT                   LFSLLAALAFSTLTCAGPRAWKYFINRDRDYDDIDDDDPFNPQARRIAAHNPTRGQLHS
FT                   FCSYSSGLGSQCSLQPPSQTISNAPVSEYMNQAILFGGNPRYENVPLIGRGSPPPTYSP
FT                   SMRPTYMSVADEHLRHYEFPS"
FT   assembly_gap    13353783..13353838
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    13358033..13358198
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    13382697..13383864
FT                   /estimated_length=1168
FT                   /gap_type="unknown"
FT   assembly_gap    13384956..13385097
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   gene            13399306..13428178
FT                   /locus_tag="mCG_13617"
FT                   /note="gene_id=mCG13617.2"
FT   mRNA            join(13399306..13399595,13403130..13403332,
FT                   13404916..13405077,13406253..13406374,13409019..13409161,
FT                   13410828..13410941,13414700..13414839,13415491..13415613,
FT                   13420763..13420986,13422209..13422344,13423270..13423416,
FT                   13424648..13424875,13428012..13428178)
FT                   /locus_tag="mCG_13617"
FT                   /product="mCG13617"
FT                   /note="gene_id=mCG13617.2 transcript_id=mCT15561.2 created
FT                   on 04-APR-2003"
FT   assembly_gap    13399762..13399955
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    13401399..13402084
FT                   /estimated_length=686
FT                   /gap_type="unknown"
FT   CDS             join(13403150..13403332,13404916..13405077,
FT                   13406253..13406374,13409019..13409161,13410828..13410941,
FT                   13414700..13414839,13415491..13415613,13420763..13420986,
FT                   13422209..13422344,13423270..13423416,13424648..13424875,
FT                   13428012..13428161)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13617"
FT                   /product="mCG13617"
FT                   /note="gene_id=mCG13617.2 transcript_id=mCT15561.2
FT                   protein_id=mCP10862.2"
FT                   /db_xref="GOA:A2AC93"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:2685574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2AC93"
FT                   /protein_id="EDL34441.1"
FT                   /translation="MEIVYVYLKKRSEFGKQCNFSDRQAELNIDILPNPELAALYVERN
FT                   PVDTGIQCSASMSEHEANTERFEMESCGVNHVEGGWPKDVNPQELEQTIRFRKKVEKDE
FT                   NYINAVMQLGSIMEHCIKQNNAIDIYEEYFDDEEAVEVTEEAPSAKTINVFRDPQEIKR
FT                   TATHLSWHPDGNRKLAVAYSCLKFQRAPMSMNYDSYIWDLENPNRPEIALKPLSPLVTL
FT                   EYNPKDSHVLLGGCYNGQIACWDTRKGSLVAELSTIEFSHRDPVYGTIWLQSKTGTECF
FT                   SASTDGQVMWWDIRKISEPIEVVIMDISRKEQLENALGAISLEFESTLPTKFMVGTEQG
FT                   IVISCNRKAKTQAEKIVCTFYGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESS
FT                   IMWTKYHMAYLSDGAWSPVRPAVFFTTKMDGTLDIWDLVFKQCDPALSLKVCDDPLFCL
FT                   RVQDNGCLIACGSELGTTTLLEVSSSLSTLQRNEKNIASSIFERETRREKILEARHREM
FT                   RLKEKGKVEGKEDDQKEEEAALDLDELVGKAEEEFFEVIFSELKRKEAEALKKKPKPRK
FT                   KSSVKVEAEEEVEENVGEEEEAGGIIGIDAVEDMSEEAGEEQEDVPT"
FT   assembly_gap    13406858..13407429
FT                   /estimated_length=572
FT                   /gap_type="unknown"
FT   assembly_gap    13414885..13414904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13426929..13426948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13436287..>13457345
FT                   /locus_tag="mCG_13616"
FT                   /note="gene_id=mCG13616.2"
FT   mRNA            join(13436287..13436458,13438060..13438140,
FT                   13449090..13449290,13450040..13450127,13450413..13450536,
FT                   13451866..13452193,13452632..13452778,13453807..13453929,
FT                   13456289..13456437,13457204..>13457345)
FT                   /locus_tag="mCG_13616"
FT                   /product="mCG13616"
FT                   /note="gene_id=mCG13616.2 transcript_id=mCT15560.2 created
FT                   on 10-APR-2003"
FT   CDS             join(13436420..13436458,13438060..13438140,
FT                   13449090..13449290,13450040..13450127,13450413..13450536,
FT                   13451866..13452193,13452632..13452778,13453807..13453929,
FT                   13456289..13456437,13457204..>13457345)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13616"
FT                   /product="mCG13616"
FT                   /note="gene_id=mCG13616.2 transcript_id=mCT15560.2
FT                   protein_id=mCP10861.2"
FT                   /protein_id="EDL34442.1"
FT                   /translation="MKDSGDSKDQQLMVALRVRPISVAELEEGATLIAHKMDEQHPDLK
FT                   LREQIGLQAVGIPGDSGLPSREHLQMVVLMDPMEDPDDILRAHRSREKSYLFDVAFDFT
FT                   ATQEMVYQATTKSLIEGVISGYNATVFAYGPTGCGKTYTMLGTDHEPGIYVRTLNDLFR
FT                   AIEETSNDMEYEVSIDLLAEKCPGLLAHPGKLIGWISPTTKPWLLSAGSSPVISLSPSQ
FT                   IMQLLMKGNRQRTQEPTAANQTSSRSHAVLQVAVRQRSRVKNILQEVRQGRLFMIDLAG
FT                   SERASQTQNRGQRMKEGAHINRSLLALGNCINALSDKGSNKYINYRDSKLTRLLKDSLG
FT                   GNSRTVMIAHISPASTAFEESRNTLTYAGRAKNIRTREGPAEMGQLREQLISAFHEQMD
FT                   VRRRLLELENQAMEVQIDTSRHLLTIAGWRWSSAAESCVRVAGAWKRRCRAASARRSSA
FT                   RCSACCAACTSWRWKT"
FT   assembly_gap    13442537..13442733
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    13445294..13445424
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   gene            <13458898..13461561
FT                   /locus_tag="mCG_13610"
FT                   /note="gene_id=mCG13610.2"
FT   mRNA            join(<13458898..13458985,13459969..13460366,
FT                   13460584..13460743,13460956..13461561)
FT                   /locus_tag="mCG_13610"
FT                   /product="mCG13610"
FT                   /note="gene_id=mCG13610.2 transcript_id=mCT15554.2 created
FT                   on 10-APR-2003"
FT   CDS             join(<13458898..13458985,13459969..13460366,
FT                   13460584..13460743,13460956..13461086)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13610"
FT                   /product="mCG13610"
FT                   /note="gene_id=mCG13610.2 transcript_id=mCT15554.2
FT                   protein_id=mCP10864.1"
FT                   /protein_id="EDL34443.1"
FT                   /translation="APPQDSLGSQINSSPESSENLSEILLSHKERKEILTRTKCISVKA
FT                   AQRRSRALGTEGRHLLAPATERSSLSLHSLSEADDARPPGQLACKRPPSPTLQHAISED
FT                   NLSSSTGEGPSRAVGPRGDGTGSWVRGQKKCLSKKREESLEAKRRKRRSRSFEVTGQGL
FT                   SRPKTHLLGPRPSEGLSDRRMPACGRPSPGVRHLGKVSLPLAKVKFPPNQNTGSGNPSP
FT                   LLVAPNQAGVSRRATRGPSLPHGSSTFGKDGRLQHN"
FT   gene            complement(13461158..>13466770)
FT                   /gene="1500005I02Rik"
FT                   /locus_tag="mCG_50541"
FT                   /note="gene_id=mCG50541.2"
FT   mRNA            complement(join(13461158..13463347,13464675..13464951,
FT                   13466546..13466723))
FT                   /gene="1500005I02Rik"
FT                   /locus_tag="mCG_50541"
FT                   /product="RIKEN cDNA 1500005I02, transcript variant
FT                   mCT50724"
FT                   /note="gene_id=mCG50541.2 transcript_id=mCT50724.2 created
FT                   on 04-APR-2003"
FT   mRNA            complement(join(13461248..13463347,13464675..13465046,
FT                   13466589..13466698))
FT                   /gene="1500005I02Rik"
FT                   /locus_tag="mCG_50541"
FT                   /product="RIKEN cDNA 1500005I02, transcript variant
FT                   mCT181700"
FT                   /note="gene_id=mCG50541.2 transcript_id=mCT181700.0 created
FT                   on 04-APR-2003"
FT   mRNA            complement(join(13461373..13463347,13466589..>13466770))
FT                   /gene="1500005I02Rik"
FT                   /locus_tag="mCG_50541"
FT                   /product="RIKEN cDNA 1500005I02, transcript variant
FT                   mCT181701"
FT                   /note="gene_id=mCG50541.2 transcript_id=mCT181701.0 created
FT                   on 04-APR-2003"
FT   mRNA            complement(join(13462044..13464883,13466589..13466735))
FT                   /gene="1500005I02Rik"
FT                   /locus_tag="mCG_50541"
FT                   /product="RIKEN cDNA 1500005I02, transcript variant
FT                   mCT193178"
FT                   /note="gene_id=mCG50541.2 transcript_id=mCT193178.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(13462044..13463347,13464675..13464951,
FT                   13466589..>13466724))
FT                   /gene="1500005I02Rik"
FT                   /locus_tag="mCG_50541"
FT                   /product="RIKEN cDNA 1500005I02, transcript variant
FT                   mCT193177"
FT                   /note="gene_id=mCG50541.2 transcript_id=mCT193177.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(13462048..13464951,13466589..13466698))
FT                   /gene="1500005I02Rik"
FT                   /locus_tag="mCG_50541"
FT                   /product="RIKEN cDNA 1500005I02, transcript variant
FT                   mCT193179"
FT                   /note="gene_id=mCG50541.2 transcript_id=mCT193179.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(13462273..13463347,13464675..13464951,
FT                   13466589..>13466688))
FT                   /codon_start=1
FT                   /gene="1500005I02Rik"
FT                   /locus_tag="mCG_50541"
FT                   /product="RIKEN cDNA 1500005I02, isoform CRA_b"
FT                   /note="gene_id=mCG50541.2 transcript_id=mCT193177.0
FT                   protein_id=mCP114176.0 isoform=CRA_b"
FT                   /protein_id="EDL34445.1"
FT                   /translation="GQSTKMLRKGSCKPGSWGSFWAILALVGLVTRAAQRADVGGEAAG
FT                   TAINHSHMLLQRLQDLLRQGNASDVILRVQAVGTDEVRAFHTHRLLLGLHSELFRELLS
FT                   NQSEVMLRESRDCAAVFDKFIRYLYCGELTVLLAQAIPLHRLATKYRVASLQRGVADYM
FT                   RAHLAGGVGPAVGWYHYAVSTGDEALRESCLQFLAWNLSAVAGSAEWGAVSPELLAQLL
FT                   QRSDLVLQDELELFHALEAWLGRARPPPTVAERALRAIRYPMIPPAQLFQLQARSAALA
FT                   RHGPAVADLLLQAYQFHAASPLHYAKFFHVNGSAFLPRNYLAPAWGAPWVINNPARDDR
FT                   STSFQTQLGPSGHDAGRRITWNVLFSPRWLPVSLRPVYADAAGTALPAARPEDGRPRLV
FT                   VTPASSGGDAAGVSFQKTVLVGARHQGRLLVRHAYSFHQSSEEAGDFLAHADLQRRNSE
FT                   YLVENALHLHLIVKPVYHTLIRTPS"
FT   CDS             complement(join(13462273..13463347,13466589..>13466665))
FT                   /codon_start=1
FT                   /gene="1500005I02Rik"
FT                   /locus_tag="mCG_50541"
FT                   /product="RIKEN cDNA 1500005I02, isoform CRA_d"
FT                   /note="gene_id=mCG50541.2 transcript_id=mCT181701.0
FT                   protein_id=mCP104622.0 isoform=CRA_d"
FT                   /protein_id="EDL34448.1"
FT                   /translation="KRFLQAWVLGQLLGYSGLGGTGHSCRYLYCGELTVLLAQAIPLHR
FT                   LATKYRVASLQRGVADYMRAHLAGGVGPAVGWYHYAVSTGDEALRESCLQFLAWNLSAV
FT                   AGSAEWGAVSPELLAQLLQRSDLVLQDELELFHALEAWLGRARPPPTVAERALRAIRYP
FT                   MIPPAQLFQLQARSAALARHGPAVADLLLQAYQFHAASPLHYAKFFHVNGSAFLPRNYL
FT                   APAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRITWNVLFSPRWLPVSLRPVYADA
FT                   AGTALPAARPEDGRPRLVVTPASSGGDAAGVSFQKTVLVGARHQGRLLVRHAYSFHQSS
FT                   EEAGDFLAHADLQRRNSEYLVENALHLHLIVKPVYHTLIRTPS"
FT   CDS             complement(join(13462273..13463347,13464675..13464970))
FT                   /codon_start=1
FT                   /gene="1500005I02Rik"
FT                   /locus_tag="mCG_50541"
FT                   /product="RIKEN cDNA 1500005I02, isoform CRA_a"
FT                   /note="gene_id=mCG50541.2 transcript_id=mCT181700.0
FT                   protein_id=mCP104623.0 isoform=CRA_a"
FT                   /protein_id="EDL34444.1"
FT                   /translation="MSLPAAAQRADVGGEAAGTAINHSHMLLQRLQDLLRQGNASDVIL
FT                   RVQAVGTDEVRAFHTHRLLLGLHSELFRELLSNQSEVMLRESRDCAAVFDKFIRYLYCG
FT                   ELTVLLAQAIPLHRLATKYRVASLQRGVADYMRAHLAGGVGPAVGWYHYAVSTGDEALR
FT                   ESCLQFLAWNLSAVAGSAEWGAVSPELLAQLLQRSDLVLQDELELFHALEAWLGRARPP
FT                   PTVAERALRAIRYPMIPPAQLFQLQARSAALARHGPAVADLLLQAYQFHAASPLHYAKF
FT                   FHVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRITWNVLFSP
FT                   RWLPVSLRPVYADAAGTALPAARPEDGRPRLVVTPASSGGDAAGVSFQKTVLVGARHQG
FT                   RLLVRHAYSFHQSSEEAGDFLAHADLQRRNSEYLVENALHLHLIVKPVYHTLIRTPS"
FT   CDS             complement(join(13462273..13463347,13464675..13464895))
FT                   /codon_start=1
FT                   /gene="1500005I02Rik"
FT                   /locus_tag="mCG_50541"
FT                   /product="RIKEN cDNA 1500005I02, isoform CRA_e"
FT                   /note="gene_id=mCG50541.2 transcript_id=mCT50724.2
FT                   protein_id=mCP32739.2 isoform=CRA_e"
FT                   /protein_id="EDL34449.1"
FT                   /translation="MLLQRLQDLLRQGNASDVILRVQAVGTDEVRAFHTHRLLLGLHSE
FT                   LFRELLSNQSEVMLRESRDCAAVFDKFIRYLYCGELTVLLAQAIPLHRLATKYRVASLQ
FT                   RGVADYMRAHLAGGVGPAVGWYHYAVSTGDEALRESCLQFLAWNLSAVAGSAEWGAVSP
FT                   ELLAQLLQRSDLVLQDELELFHALEAWLGRARPPPTVAERALRAIRYPMIPPAQLFQLQ
FT                   ARSAALARHGPAVADLLLQAYQFHAASPLHYAKFFHVNGSAFLPRNYLAPAWGAPWVIN
FT                   NPARDDRSTSFQTQLGPSGHDAGRRITWNVLFSPRWLPVSLRPVYADAAGTALPAARPE
FT                   DGRPRLVVTPASSGGDAAGVSFQKTVLVGARHQGRLLVRHAYSFHQSSEEAGDFLAHAD
FT                   LQRRNSEYLVENALHLHLIVKPVYHTLIRTPS"
FT   CDS             complement(13462273..13463499)
FT                   /codon_start=1
FT                   /gene="1500005I02Rik"
FT                   /locus_tag="mCG_50541"
FT                   /product="RIKEN cDNA 1500005I02, isoform CRA_c"
FT                   /note="gene_id=mCG50541.2 transcript_id=mCT193178.0
FT                   protein_id=mCP114177.0 isoform=CRA_c"
FT                   /protein_id="EDL34446.1"
FT                   /translation="MGTLLQPEEGWSYRWFPRHPMWTLEPELWCSGQVLLTAVPSQRAP
FT                   LQFPSRYLYCGELTVLLAQAIPLHRLATKYRVASLQRGVADYMRAHLAGGVGPAVGWYH
FT                   YAVSTGDEALRESCLQFLAWNLSAVAGSAEWGAVSPELLAQLLQRSDLVLQDELELFHA
FT                   LEAWLGRARPPPTVAERALRAIRYPMIPPAQLFQLQARSAALARHGPAVADLLLQAYQF
FT                   HAASPLHYAKFFHVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAG
FT                   RRITWNVLFSPRWLPVSLRPVYADAAGTALPAARPEDGRPRLVVTPASSGGDAAGVSFQ
FT                   KTVLVGARHQGRLLVRHAYSFHQSSEEAGDFLAHADLQRRNSEYLVENALHLHLIVKPV
FT                   YHTLIRTPS"
FT   CDS             complement(13462273..13463499)
FT                   /codon_start=1
FT                   /gene="1500005I02Rik"
FT                   /locus_tag="mCG_50541"
FT                   /product="RIKEN cDNA 1500005I02, isoform CRA_c"
FT                   /note="gene_id=mCG50541.2 transcript_id=mCT193179.0
FT                   protein_id=mCP114178.0 isoform=CRA_c"
FT                   /protein_id="EDL34447.1"
FT                   /translation="MGTLLQPEEGWSYRWFPRHPMWTLEPELWCSGQVLLTAVPSQRAP
FT                   LQFPSRYLYCGELTVLLAQAIPLHRLATKYRVASLQRGVADYMRAHLAGGVGPAVGWYH
FT                   YAVSTGDEALRESCLQFLAWNLSAVAGSAEWGAVSPELLAQLLQRSDLVLQDELELFHA
FT                   LEAWLGRARPPPTVAERALRAIRYPMIPPAQLFQLQARSAALARHGPAVADLLLQAYQF
FT                   HAASPLHYAKFFHVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAG
FT                   RRITWNVLFSPRWLPVSLRPVYADAAGTALPAARPEDGRPRLVVTPASSGGDAAGVSFQ
FT                   KTVLVGARHQGRLLVRHAYSFHQSSEEAGDFLAHADLQRRNSEYLVENALHLHLIVKPV
FT                   YHTLIRTPS"
FT   gene            <13469749..>13477573
FT                   /gene="Gpr142"
FT                   /locus_tag="mCG_148178"
FT                   /note="gene_id=mCG148178.0"
FT   mRNA            join(<13469749..13469842,13475133..13475294,
FT                   13476732..>13477573)
FT                   /gene="Gpr142"
FT                   /locus_tag="mCG_148178"
FT                   /product="G protein-coupled receptor 142"
FT                   /note="gene_id=mCG148178.0 transcript_id=mCT188441.0
FT                   created on 13-JAN-2004"
FT   CDS             join(13469749..13469842,13475133..13475294,
FT                   13476732..13477573)
FT                   /codon_start=1
FT                   /gene="Gpr142"
FT                   /locus_tag="mCG_148178"
FT                   /product="G protein-coupled receptor 142"
FT                   /note="gene_id=mCG148178.0 transcript_id=mCT188441.0
FT                   protein_id=mCP109355.0"
FT                   /protein_id="EDL34450.1"
FT                   /translation="MHLNSNPNSYICDAYQHADLLWSLSPHVLTKAVQPQVTLLPTVNG
FT                   SNPRYDGVDGHWPESPERSPCVAGIIPVIYYSVLLSLGLPVALARLAARTRKPSYHYLL
FT                   ALTASDIVTQVIIVFVGFLLQGAVLARQVPQAVVRTANILEFAANHASVWIAVLFTVDR
FT                   YNALCRPLRHRATSSPGRTHRAIAAVIGVTLLTGIPFYWWLDVWRDADPPSTMDKLLKW
FT                   AHCLIVYFIPCNVFLVTNSAIILRLRKRGQRGLRPLVSKSTAILLGVTSLFALLWAPRI
FT                   IVMLYHLYVAPVHRDWRVHLALDIANMLAMLNTEVNFGLYCFISKTFRATVRQVICDVH
FT                   MACALKSQPKQTVVELMLKSVGTEL"
FT   assembly_gap    13484272..13484343
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    13507562..13507581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13519565..13519605
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    13528991..13529010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13530288..13545316
FT                   /estimated_length=15029
FT                   /gap_type="unknown"
FT   assembly_gap    13547805..13547824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13556001..13570586
FT                   /gene="Cd300a"
FT                   /locus_tag="mCG_13614"
FT                   /note="gene_id=mCG13614.2"
FT   mRNA            join(13556001..13556394,13559195..13559551,
FT                   13560616..13560736,13563680..13563777,13565303..13565340,
FT                   13565711..13565821,13567087..13570586)
FT                   /gene="Cd300a"
FT                   /locus_tag="mCG_13614"
FT                   /product="CD300A antigen, transcript variant mCT116946"
FT                   /note="gene_id=mCG13614.2 transcript_id=mCT116946.1 created
FT                   on 17-APR-2003"
FT   mRNA            join(13556001..13556394,13559195..13559551,
FT                   13560628..13560736,13563680..13563777,13565303..13565340,
FT                   13565711..13565821,13567087..13570586)
FT                   /gene="Cd300a"
FT                   /locus_tag="mCG_13614"
FT                   /product="CD300A antigen, transcript variant mCT15558"
FT                   /note="gene_id=mCG13614.2 transcript_id=mCT15558.2 created
FT                   on 17-APR-2003"
FT   CDS             join(13556325..13556394,13559195..13559551,
FT                   13560616..13560736,13563680..13563777,13565303..13565340,
FT                   13565711..13565821,13567087..13567248)
FT                   /codon_start=1
FT                   /gene="Cd300a"
FT                   /locus_tag="mCG_13614"
FT                   /product="CD300A antigen, isoform CRA_a"
FT                   /note="gene_id=mCG13614.2 transcript_id=mCT116946.1
FT                   protein_id=mCP74911.1 isoform=CRA_a"
FT                   /protein_id="EDL34451.1"
FT                   /translation="MTQLASAVWLPTLLLLLLLFWLPGCVPLHGPSTMTGSVGQSLSVS
FT                   CQYEEKFKTKDKYWCRVSLKILCKDIVKTSSSEEARSGRVTIRDHPDNLTFTVTYESLT
FT                   LEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPVSSPGPTLETPVVSTSLPTKG
FT                   PALGSNTEGHREHDYSQGLRLPALLSVLALLLFLLVGTSLLAWRMFQKRLVKADRHPEL
FT                   SQNLRQASEQNECQYVNLQLHTWSLREEPVLPSQVEVVEYSTLALPQEELHYSSVAFNS
FT                   QRQDSHANGDSLHQPQDQKAEYSEIQKPRKGLSDLYL"
FT   CDS             join(13556325..13556394,13559195..13559551,
FT                   13560628..13560736,13563680..13563777,13565303..13565340,
FT                   13565711..13565821,13567087..13567248)
FT                   /codon_start=1
FT                   /gene="Cd300a"
FT                   /locus_tag="mCG_13614"
FT                   /product="CD300A antigen, isoform CRA_b"
FT                   /note="gene_id=mCG13614.2 transcript_id=mCT15558.2
FT                   protein_id=mCP10856.2 isoform=CRA_b"
FT                   /protein_id="EDL34452.1"
FT                   /translation="MTQLASAVWLPTLLLLLLLFWLPGCVPLHGPSTMTGSVGQSLSVS
FT                   CQYEEKFKTKDKYWCRVSLKILCKDIVKTSSSEEARSGRVTIRDHPDNLTFTVTYESLT
FT                   LEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPGPTLETPVVSTSLPTKGPALG
FT                   SNTEGHREHDYSQGLRLPALLSVLALLLFLLVGTSLLAWRMFQKRLVKADRHPELSQNL
FT                   RQASEQNECQYVNLQLHTWSLREEPVLPSQVEVVEYSTLALPQEELHYSSVAFNSQRQD
FT                   SHANGDSLHQPQDQKAEYSEIQKPRKGLSDLYL"
FT   assembly_gap    13572541..13572630
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   gene            13574698..13575178
FT                   /pseudo
FT                   /locus_tag="mCG_50815"
FT                   /note="gene_id=mCG50815.2"
FT   mRNA            13574698..13575178
FT                   /pseudo
FT                   /locus_tag="mCG_50815"
FT                   /note="gene_id=mCG50815.2 transcript_id=mCT50998.2 created
FT                   on 10-APR-2003"
FT   assembly_gap    13575918..13575937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13578451..13578470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<13590863..>13600130)
FT                   /locus_tag="mCG_148161"
FT                   /note="gene_id=mCG148161.0"
FT   mRNA            complement(join(<13590863..13591015,13591978..13592068,
FT                   13594180..13594509,13600091..>13600130))
FT                   /locus_tag="mCG_148161"
FT                   /product="mCG148161"
FT                   /note="gene_id=mCG148161.0 transcript_id=mCT188424.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(<13590863..13591015,13591978..13592068,
FT                   13594180..13594509,13600091..13600130))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148161"
FT                   /product="mCG148161"
FT                   /note="gene_id=mCG148161.0 transcript_id=mCT188424.0
FT                   protein_id=mCP109338.0"
FT                   /protein_id="EDL34453.1"
FT                   /translation="MWLSPALLLLSFPGCLSIQGPALVRGPEQGSVTVQCRYSSRWQTN
FT                   KKWWCRGASWSTCRVLIRSTGSEKETKSGRLSIRDNQKNHSFQVTMEMLRQNDTDTYWC
FT                   GIEKFGTDRGTRVKVNVYSVGKDTMSTSNQLPWPTVDGSTDMVSSDLQKRTYYMLLVFV
FT                   KVPALLILVGAVLWLKRSTQKVPEEQWRHTLCSDLDSELLA"
FT   assembly_gap    13593840..13594039
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    13605144..13605709
FT                   /estimated_length=566
FT                   /gap_type="unknown"
FT   assembly_gap    13620956..13621143
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    13627540..13627583
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   gene            complement(13633841..13679996)
FT                   /gene="4732429D16Rik"
FT                   /locus_tag="mCG_13612"
FT                   /note="gene_id=mCG13612.2"
FT   mRNA            complement(join(13633841..13633867,13645014..13646737,
FT                   13648535..13648661,13649737..13650078,13679868..13679996))
FT                   /gene="4732429D16Rik"
FT                   /locus_tag="mCG_13612"
FT                   /product="RIKEN cDNA 4732429D16"
FT                   /note="gene_id=mCG13612.2 transcript_id=mCT15556.2 created
FT                   on 27-NOV-2002"
FT   assembly_gap    13638983..13639002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(13646581..13646737,13648535..13648661,
FT                   13649737..13650078,13679868..13679907))
FT                   /codon_start=1
FT                   /gene="4732429D16Rik"
FT                   /locus_tag="mCG_13612"
FT                   /product="RIKEN cDNA 4732429D16"
FT                   /note="gene_id=mCG13612.2 transcript_id=mCT15556.2
FT                   protein_id=mCP10854.2"
FT                   /protein_id="EDL34454.1"
FT                   /translation="MWQFPALLILFLPGCCTAQDSVTGPEEVSGQEQGSLTVQCRYSSY
FT                   WKGYKKYWCRGVPQRSCDILVETDKSEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAG
FT                   IYWCGITKAGPDPMFKVNVNINPAPKSSMMTTTATVLKSIQPSAENTGKEQVTQSKEVT
FT                   QSRPHTRSLLSSIYFLLMVFVELPLLLSMLSAVLWVTRPQRCFGRGENDLVKTHSPVA"
FT   assembly_gap    13651690..13655164
FT                   /estimated_length=3475
FT                   /gap_type="unknown"
FT   gene            complement(13659749..>13665492)
FT                   /locus_tag="mCG_146304"
FT                   /note="gene_id=mCG146304.1"
FT   mRNA            complement(join(13659749..13660062,13661264..13661384,
FT                   13663766..13664122,13665099..>13665221))
FT                   /locus_tag="mCG_146304"
FT                   /product="mCG146304, transcript variant mCT193282"
FT                   /note="gene_id=mCG146304.1 transcript_id=mCT193282.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(13659796..13660062,13661264..13661384,
FT                   13663766..13664210,13665099..>13665492))
FT                   /locus_tag="mCG_146304"
FT                   /product="mCG146304, transcript variant mCT186407"
FT                   /note="gene_id=mCG146304.1 transcript_id=mCT186407.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(13659915..13660062,13661264..13661384,
FT                   13663766..13664122,13665099..>13665219))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146304"
FT                   /product="mCG146304, isoform CRA_b"
FT                   /note="gene_id=mCG146304.1 transcript_id=mCT193282.0
FT                   protein_id=mCP114255.0 isoform=CRA_b"
FT                   /protein_id="EDL34456.1"
FT                   /translation="DRSFSTLGPDVGTGDSGAEEMIPRVIRLWLPSALFLSQVPGCVPL
FT                   HGPSTITGAVGESLSVSCQYEEKFKTKDKFWCRGSLKVLCKDIVKTSSSEEVRNGRVTI
FT                   RDHPDNLTFTVTYESLTLEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPVTGS
FT                   SLESGRDILESPTSSVGHTHPSVTTDDTIPAPCPQPRSLRSSLYFWVLVSLKLFLFLSM
FT                   LGAVLWVNRPQRCSGGSSTQPCYENQ"
FT   CDS             complement(join(13659915..13660062,13661264..13661384,
FT                   13663766..>13664138))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146304"
FT                   /product="mCG146304, isoform CRA_a"
FT                   /note="gene_id=mCG146304.1 transcript_id=mCT186407.0
FT                   protein_id=mCP107584.0 isoform=CRA_a"
FT                   /protein_id="EDL34455.1"
FT                   /translation="SYSFPGCVPLHGPSTITGAVGESLSVSCQYEEKFKTKDKFWCRGS
FT                   LKVLCKDIVKTSSSEEVRNGRVTIRDHPDNLTFTVTYESLTLEDADTYMCAVDISLFDG
FT                   SLGFDKYFKIELSVVPSEDPVTGSSLESGRDILESPTSSVGHTHPSVTTDDTIPAPCPQ
FT                   PRSLRSSLYFWVLVSLKLFLFLSMLGAVLWVNRPQRCSGGSSTQPCYENQ"
FT   assembly_gap    13662132..13662192
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    13664538..13664557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13673874..13674101
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    13677978..13677997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13680245..13684659
FT                   /estimated_length=4415
FT                   /gap_type="unknown"
FT   assembly_gap    13686116..13708869
FT                   /estimated_length=22754
FT                   /gap_type="unknown"
FT   assembly_gap    13710325..13714886
FT                   /estimated_length=4562
FT                   /gap_type="unknown"
FT   gene            complement(13721897..13742780)
FT                   /gene="Cd300e"
FT                   /locus_tag="mCG_142622"
FT                   /note="gene_id=mCG142622.0"
FT   mRNA            complement(join(13721897..13723339,13724456..13724558,
FT                   13725232..13725579,13742726..13742780))
FT                   /gene="Cd300e"
FT                   /locus_tag="mCG_142622"
FT                   /product="CD300e antigen"
FT                   /note="gene_id=mCG142622.0 transcript_id=mCT181221.0
FT                   created on 19-MAR-2003"
FT   CDS             complement(join(13723240..13723339,13724456..13724558,
FT                   13725232..13725579,13742726..13742765))
FT                   /codon_start=1
FT                   /gene="Cd300e"
FT                   /locus_tag="mCG_142622"
FT                   /product="CD300e antigen"
FT                   /note="gene_id=mCG142622.0 transcript_id=mCT181221.0
FT                   protein_id=mCP104143.0"
FT                   /protein_id="EDL34457.1"
FT                   /translation="MRLCAGLLLLCFQGCLSLTGPGSVSGYVGGSLRVQCQYSPSYKGY
FT                   MKYWCRGPHDTTCKTIVETDGSEKEKRSGPVSIRDHAANSTITVIMEDLSEDDAGSYWC
FT                   KIQTSFIWDSWSRDPSVSVRVNVFPATTPTLPATTAILPLVNSGQNLRISTNVMFIFQL
FT                   WSLLSSIQFQVLVFLKLPLFLSMLCAIFWVNRL"
FT   assembly_gap    13729284..13734964
FT                   /estimated_length=5681
FT                   /gap_type="unknown"
FT   assembly_gap    13739082..13739101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13741323..13741342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13746504..13746523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13747517..13747536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13766221..13835967
FT                   /gene="Rab37"
FT                   /locus_tag="mCG_6631"
FT                   /note="gene_id=mCG6631.2"
FT   mRNA            join(13766221..13766724,13821617..13821727,
FT                   13833013..13833054,13833567..13833633,13833721..13833773,
FT                   13834736..13834801,13835359..13835415,13835498..13835574,
FT                   13835695..13835967)
FT                   /gene="Rab37"
FT                   /locus_tag="mCG_6631"
FT                   /product="RAB37, member of RAS oncogene family, transcript
FT                   variant mCT171361"
FT                   /note="gene_id=mCG6631.2 transcript_id=mCT171361.0 created
FT                   on 31-JUL-2002"
FT   CDS             join(13766653..13766724,13821617..13821727,
FT                   13833013..13833054,13833567..13833633,13833721..13833773,
FT                   13834736..13834801,13835359..13835415,13835498..13835574,
FT                   13835695..13835800)
FT                   /codon_start=1
FT                   /gene="Rab37"
FT                   /locus_tag="mCG_6631"
FT                   /product="RAB37, member of RAS oncogene family, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG6631.2 transcript_id=mCT171361.0
FT                   protein_id=mCP94280.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BQX0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1929945"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BQX0"
FT                   /protein_id="EDL34458.1"
FT                   /translation="MDLQRPDSYQGGAGPHFSEHVLHKTILVGDSGVGKTSLLVQFDQG
FT                   KFIPGSFSATVGIGFTNKVVTVDGARVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYD
FT                   ITNQSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADVSSERVIRSEDGETLAREYGVPFM
FT                   ETSAKTGMNVELAFLAIAKELKYRAGRQPDEPSFQIRDYVESQKKRSSCCSFV"
FT   assembly_gap    13778251..13778890
FT                   /estimated_length=640
FT                   /gap_type="unknown"
FT   assembly_gap    13785197..13785216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13791609..>13808355)
FT                   /gene="Cd300lf"
FT                   /locus_tag="mCG_142623"
FT                   /note="gene_id=mCG142623.0"
FT   mRNA            complement(join(13791609..13792039,13792432..13792575,
FT                   13798307..13798437,13800175..13800516,13808202..>13808355))
FT                   /gene="Cd300lf"
FT                   /locus_tag="mCG_142623"
FT                   /product="CD300 antigen like family member F, transcript
FT                   variant mCT181222"
FT                   /note="gene_id=mCG142623.0 transcript_id=mCT181222.0
FT                   created on 19-MAR-2003"
FT   CDS             complement(join(13791863..13792039,13792432..13792575,
FT                   13798307..13798437,13800175..13800516,13808202..>13808355))
FT                   /codon_start=1
FT                   /gene="Cd300lf"
FT                   /locus_tag="mCG_142623"
FT                   /product="CD300 antigen like family member F, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG142623.0 transcript_id=mCT181222.0
FT                   protein_id=mCP104144.0 isoform=CRA_b"
FT                   /protein_id="EDL34461.1"
FT                   /translation="EEVPSESEGNHRTRRRRSGACSLFSLAGSTKVTRCEKMHLSLLVP
FT                   FLFWITGCCTAEDPVTGPEEVSGQEQGSLTVQCRYTSGWKDYKKYWCQGVPQRSCKTLV
FT                   ETDASEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGLDPMFKVTVNI
FT                   GPAIQVPITVPTMPPITSTTTIFTVTTTVKETSMFPTLTSYYSDNGAQSLEGDLCYADL
FT                   SLKQPRTSPGSSWKKGSSMSSSGKDHQEEVEYVTMAPFPREEVSYAALTLAGLGQEPTY
FT                   GNTGCPITHVPRTGLEEETTEYSSIRRPLPAAMP"
FT   mRNA            complement(join(13793766..13794773,13798307..13800516,
FT                   13808202..13808355))
FT                   /gene="Cd300lf"
FT                   /locus_tag="mCG_142623"
FT                   /product="CD300 antigen like family member F, transcript
FT                   variant mCT181223"
FT                   /note="gene_id=mCG142623.0 transcript_id=mCT181223.0
FT                   created on 19-MAR-2003"
FT   assembly_gap    13794774..13797859
FT                   /estimated_length=3086
FT                   /gap_type="unknown"
FT   CDS             complement(13799198..13799866)
FT                   /codon_start=1
FT                   /gene="Cd300lf"
FT                   /locus_tag="mCG_142623"
FT                   /product="CD300 antigen like family member F, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG142623.0 transcript_id=mCT181223.0
FT                   protein_id=mCP104145.0 isoform=CRA_a"
FT                   /protein_id="EDL34460.1"
FT                   /translation="MWMLGIEPRTSGEAARALNCQAIPPSPLSNMSRLLETSCTFPYSS
FT                   LHSSIWSLLQERTGRLFPPPVHRPKITTSNGSQSPAPANAFLEFCGKFALLSEELQVLP
FT                   SPDAVLCPSLSIPREMVPALVLVLWPNLQGLEKPSHTVAFLESSMSRGCHLCSLMMFSL
FT                   RVLLECRAHAGGDGDGRGVALVVVVLAQRSWCIGLEEFLSWVLLGSIRQAVPGQRALGG
FT                   "
FT   assembly_gap    13804862..13805348
FT                   /estimated_length=487
FT                   /gap_type="unknown"
FT   assembly_gap    13811498..13811517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13817330..13817538
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   mRNA            join(13829246..13829353,13831988..13832098,
FT                   13833013..13833054,13833567..13833633,13833721..13833773,
FT                   13834736..13834801,13835359..13835415,13835498..13835574,
FT                   13835695..13835967)
FT                   /gene="Rab37"
FT                   /locus_tag="mCG_6631"
FT                   /product="RAB37, member of RAS oncogene family, transcript
FT                   variant mCT4941"
FT                   /note="gene_id=mCG6631.2 transcript_id=mCT4941.2 created on
FT                   31-JUL-2002"
FT   CDS             join(13829261..13829353,13831988..13832098,
FT                   13833013..13833054,13833567..13833633,13833721..13833773,
FT                   13834736..13834801,13835359..13835415,13835498..13835574,
FT                   13835695..13835800)
FT                   /codon_start=1
FT                   /gene="Rab37"
FT                   /locus_tag="mCG_6631"
FT                   /product="RAB37, member of RAS oncogene family, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG6631.2 transcript_id=mCT4941.2
FT                   protein_id=mCP18882.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q544E8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1929945"
FT                   /db_xref="UniProtKB/TrEMBL:Q544E8"
FT                   /protein_id="EDL34459.1"
FT                   /translat