Dbfetch

ID   CH466558; SV 1; linear; genomic DNA; CON; MUS; 20632797 BP.
XX
AC   CH466558;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009822206 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-20632797
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-20632797
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; b5e487322062602b973037a00fc0ea94.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000219.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000125; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000142; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001027; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001313; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001493; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001494; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001901; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005043; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006574; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010358; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010841; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015869; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017119; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017132; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017311; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017316; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017466; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017716; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018012; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018362; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018363; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018372; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018411; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018412; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018486; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018634; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018677; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018727; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018858; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020599; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020617; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020681; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020687; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020689; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020708; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020712; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020713; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020717; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020719; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020720; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020722; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020732; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020734; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020752; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020766; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020777; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020780; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020792; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020793; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020804; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020812; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020823; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020923; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020926; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020929; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020941; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020945; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020946; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025127; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025134; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025137; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025140; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025144; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025145; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025150; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025156; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025161; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025162; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025163; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025165; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025170; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025371; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025372; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025375; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025377; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025380; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025386; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025572; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025576; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025577; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025580; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025582; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025583; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033880; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034227; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034255; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034341; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034677; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034706; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034936; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034993; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039253; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039337; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039364; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039450; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039670; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039691; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039850; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040373; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041695; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041797; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041920; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044034; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044787; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045532; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045775; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046215; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048217; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048277; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050965; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051497; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055805; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056962; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057322; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059923; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059995; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061111; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062825; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063316; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066878; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075410; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075420; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078607; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078627; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000085793; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097487; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019200; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019203; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019204; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019207; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019210; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019213; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019214; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019216; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019220; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019221; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019230; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019231; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019232; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019234; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019239; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019243; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019246; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019251; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019258; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019260; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019261; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019262; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019265; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019266; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019267; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019268; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019269; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019272; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019275; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019276; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019278; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019285; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019288; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019290; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019297; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019300; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019302; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019303; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019308; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019310; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019313; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019314; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019315; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019316; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019320; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019322; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019324; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019325; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019328; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019330; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019334; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019339; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019342; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019346; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019347; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019353; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019356; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019361; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019376; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019384; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019388; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019398; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019406; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019409; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019413; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019422; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019424; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019436; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019449; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019453; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019456; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019460; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019462; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019464; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019466; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019470; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019472; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019478; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019480; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019483; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019484; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019486; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019487; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019490; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019496; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019499; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019501; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019507; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019512; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019514; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019515; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019518; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019523; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019524; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019525; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019526; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019529; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019533; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019534; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019535; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019536; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019537; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019538; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019547; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019548; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0019168; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019171; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019172; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019175; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019178; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019181; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019182; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019184; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019188; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019189; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019199; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019200; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019202; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019207; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019211; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019214; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019219; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019226; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019228; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019229; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019230; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019233; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019234; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019235; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019236; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019237; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019240; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019243; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019244; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019246; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019253; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019256; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019258; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019265; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019268; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019270; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019271; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019276; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019278; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019281; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019282; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019283; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019288; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019290; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019292; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019293; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019296; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019298; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019302; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019307; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019310; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019314; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019315; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019322; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019325; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019330; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019345; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019353; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019357; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019367; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019375; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019378; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019382; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019391; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019393; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019404; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019417; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019421; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019424; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019428; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019430; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019432; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019434; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019438; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019440; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019446; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019448; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019451; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019452; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019454; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019455; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019458; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019464; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019467; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019469; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019475; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019480; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019482; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019483; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019486; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019491; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019492; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019494; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019500; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019501; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019502; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019503; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019504; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019505; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019514; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019515; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019896; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0019137; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019140; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019141; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019144; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019147; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019150; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019151; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019153; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019157; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019158; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019168; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019169; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019171; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019176; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019180; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019183; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019188; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019195; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019197; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019198; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019202; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019203; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019204; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019205; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019206; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019209; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019212; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019213; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019215; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019222; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019225; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019227; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019234; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019237; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019239; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019245; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019247; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019250; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019251; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019252; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019257; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019259; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019261; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019262; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019265; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019267; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019271; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019276; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019279; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019283; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019284; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019290; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019293; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019298; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019315; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019323; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019327; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019337; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019345; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019348; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019352; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019361; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019363; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019375; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019387; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019391; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019394; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019398; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019400; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019402; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019404; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019408; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019410; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019416; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019418; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019421; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019422; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019424; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019425; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019428; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019434; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019437; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019439; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019445; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019450; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019452; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019453; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019456; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019461; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019462; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019463; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019464; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019470; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019471; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019472; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019473; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019474; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019475; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019484; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019485; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019872; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019142; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019145; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019146; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019149; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019152; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019155; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019156; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019158; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019162; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019163; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019173; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019174; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019176; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019181; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019185; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019188; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019193; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019200; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019202; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019203; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019204; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019207; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019208; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019209; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019210; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019211; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019214; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019217; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019218; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019220; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019227; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019230; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019232; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019239; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019242; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019244; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019245; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019250; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019252; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019255; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019256; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019257; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019258; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019262; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019264; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019266; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019267; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019270; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019272; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019276; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019281; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019284; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019288; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019289; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019295; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019298; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019303; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019319; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019327; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019331; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019341; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019349; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019352; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019356; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019365; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019367; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019379; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019392; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019396; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019399; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019403; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019405; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019407; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019409; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019413; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019415; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019421; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019423; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019426; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019427; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019429; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019430; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019433; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019439; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019442; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019444; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019450; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019455; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019457; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019458; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019461; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019466; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019467; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019468; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019469; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019475; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019476; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019477; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019478; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019479; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019480; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019489; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019490; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019876; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018951; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018953; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018954; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018955; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018958; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018961; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018964; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018965; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018967; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018971; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018972; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018982; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018983; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018985; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018990; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018994; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018997; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019002; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019009; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019011; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019012; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019013; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019016; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019017; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019018; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019019; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019020; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019026; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019027; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019029; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019036; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019039; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019041; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019048; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019051; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019053; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019054; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019059; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019061; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019064; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019065; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019066; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019067; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019071; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019073; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019075; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019076; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019079; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019081; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019085; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019090; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019093; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019097; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019098; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019104; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019107; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019112; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019125; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019133; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019137; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019147; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019155; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019158; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019162; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019171; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019173; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019185; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019198; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019202; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019205; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019209; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019211; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019213; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019215; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019219; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019221; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019227; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019229; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019232; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019233; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019235; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019236; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019239; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019245; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019248; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019250; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019256; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019261; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019263; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019264; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019267; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019272; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019273; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019274; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019275; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019281; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019282; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019283; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019284; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019285; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019286; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019295; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019296; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019682; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019591; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019594; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019595; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019598; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019601; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019604; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019605; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019607; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019611; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019612; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019622; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019623; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019625; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019630; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019634; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019637; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019642; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019649; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019651; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019652; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019653; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019657; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019658; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019659; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019660; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019661; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019664; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019667; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019668; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019670; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019677; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019680; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019682; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019689; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019692; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019694; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019695; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019700; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019702; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019705; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019706; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019707; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019712; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019714; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019716; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019717; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019720; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019722; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019726; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019731; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019734; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019738; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019739; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019746; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019749; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019754; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019769; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019777; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019781; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019791; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019799; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019802; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019806; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019815; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019817; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019828; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019841; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019845; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019848; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019852; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019854; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019856; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019858; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019862; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019864; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019870; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019872; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019875; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019876; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019878; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019879; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019882; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019887; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019890; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019892; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019898; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019903; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019905; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019906; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019909; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019914; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019915; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019916; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019917; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019924; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019925; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019926; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019927; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019928; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019929; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019938; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019939; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020327; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018508; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018509; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018512; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018515; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018518; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018519; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018521; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018525; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018526; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018535; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018536; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018537; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018539; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018544; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018548; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018551; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018556; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018563; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018565; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018566; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018567; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018570; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018571; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018572; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018573; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018574; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018577; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018580; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018581; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018583; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018589; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018592; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018594; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018601; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018604; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018606; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018607; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018612; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018614; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018618; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018619; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018620; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018624; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018626; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018628; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018629; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018633; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018635; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018638; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018643; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018646; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018650; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018651; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018658; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018661; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018666; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018680; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018688; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018692; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018702; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018710; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018713; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018717; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018726; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018728; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018740; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018752; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018755; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018759; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018763; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018765; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018767; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018773; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018775; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018781; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018783; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018786; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018787; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018789; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018790; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018793; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018799; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018802; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018804; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018810; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018815; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018817; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018818; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018821; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018826; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018827; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018828; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018829; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018835; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018836; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018837; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018838; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018839; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018840; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018849; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018850; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019231; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018920; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018923; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018924; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018927; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018930; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018933; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018934; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018936; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018940; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018941; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018950; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018951; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018952; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018954; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018959; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018963; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018966; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018971; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018978; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018980; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018981; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018982; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018985; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018986; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018987; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018988; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018989; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018992; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018995; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018998; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019005; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019008; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019010; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019017; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019020; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019022; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019023; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019028; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019030; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019033; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019034; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019035; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019040; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019042; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019044; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019045; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019048; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019050; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019054; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019059; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019062; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019066; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019067; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019074; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019077; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019079; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019082; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019097; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019105; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019109; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019119; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019127; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019130; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019134; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019143; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019145; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019156; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019169; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019173; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019176; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019180; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019182; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019184; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019186; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019190; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019192; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019198; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019200; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019203; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019204; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019206; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019207; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019210; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019216; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019219; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019221; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019227; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019232; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019234; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019235; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019238; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019243; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019244; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019245; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019246; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019252; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019253; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019254; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019255; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019256; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019257; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019266; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019267; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019653; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0019032; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019035; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019036; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019039; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019042; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019045; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019046; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019048; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019052; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019053; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019063; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019064; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019066; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019071; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019075; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019078; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019083; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019090; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019092; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019093; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019094; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019097; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019098; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019099; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019100; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019101; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019104; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019107; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019108; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019110; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019117; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019120; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019122; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019129; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019132; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019134; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019135; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019140; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019142; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019145; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019146; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019147; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019152; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019154; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019156; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019157; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019160; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019162; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019166; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019171; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019174; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019178; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019179; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019186; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019189; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019194; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019208; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019216; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019220; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019230; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019238; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019241; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019245; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019254; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019256; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019268; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019281; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019285; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019288; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019292; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019294; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019296; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019298; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019302; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019304; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019310; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019312; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019315; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019316; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019318; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019319; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019322; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019328; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019331; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019333; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019339; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019344; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019346; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019347; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019350; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019355; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019356; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019357; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019358; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019365; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019366; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019367; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019368; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019369; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019370; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019379; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019380; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019768; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0019022; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019025; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019026; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019029; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019032; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019035; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019036; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019038; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019042; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019043; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019052; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019053; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019054; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019056; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019061; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019065; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019068; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019073; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019080; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019082; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019084; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019088; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019089; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019090; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019091; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019092; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019095; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019098; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019099; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019101; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019108; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019111; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019113; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019120; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019123; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019125; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019126; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019131; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019133; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019136; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019137; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019138; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019143; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019145; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019147; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019148; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019151; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019153; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019157; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019162; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019165; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019169; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019170; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019177; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019180; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019185; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019200; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019208; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019212; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019222; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019230; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019233; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019237; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019246; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019248; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019260; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019273; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019277; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019280; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019284; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019286; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019288; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019290; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019294; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019296; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019302; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019304; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019307; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019308; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019310; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019311; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019314; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019320; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019323; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019325; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019331; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019336; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019338; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019339; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019342; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019347; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019348; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019349; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019350; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019356; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019357; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019358; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019359; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019360; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019361; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019370; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019371; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019754; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0019101; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019103; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019104; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019105; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019108; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019111; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019114; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019115; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019117; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019121; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019122; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019131; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019132; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019133; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019135; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019140; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019144; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019147; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019152; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019159; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019161; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019162; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019163; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019166; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019167; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019168; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019169; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019170; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019173; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019176; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019177; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019180; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019187; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019190; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019192; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019199; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019202; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019204; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019205; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019210; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019212; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019215; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019216; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019217; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019222; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019224; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019226; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019227; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019230; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019232; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019236; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019241; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019248; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019249; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019256; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019259; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019264; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019278; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019286; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019290; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019300; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019308; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019311; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019315; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019324; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019326; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019338; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019351; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019355; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019358; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019362; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019364; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019366; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019368; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019372; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019374; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019380; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019384; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019387; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019388; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019390; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019391; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019394; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019400; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019403; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019405; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019411; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019416; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019418; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019419; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019422; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019427; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019428; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019429; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019430; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019436; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019437; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019438; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019439; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019440; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019441; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019450; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019451; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019053; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019056; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019057; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019060; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019063; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019066; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019067; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019069; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019073; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019074; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019083; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019084; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019085; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019087; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019092; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019096; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019099; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019104; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019111; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019113; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019114; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019115; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019118; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019119; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019120; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019121; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019122; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019125; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019128; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019129; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019131; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019138; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019141; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019143; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019150; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019153; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019155; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019156; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019161; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019163; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019166; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019167; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019168; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019169; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019173; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019175; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019177; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019178; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019182; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019184; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019188; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019193; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019196; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019200; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019201; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019208; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019211; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019216; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019233; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019241; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019245; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019255; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019263; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019266; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019270; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019279; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019281; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019293; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019306; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019310; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019313; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019317; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019319; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019321; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019323; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019327; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019329; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019335; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019337; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019340; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019341; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019343; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019344; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019347; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019353; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019356; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019358; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019364; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019369; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019371; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019372; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019375; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019380; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019381; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019382; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019383; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019389; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019390; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019391; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019392; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019393; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019394; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019403; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019404; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019629; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019632; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019633; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019636; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019639; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019642; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019643; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019645; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019649; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019650; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019660; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019661; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019663; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019668; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019672; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019675; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019680; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019687; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019689; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019690; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019691; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019694; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019695; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019696; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019697; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019698; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019701; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019704; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019705; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019707; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019714; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019717; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019719; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019726; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019729; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019731; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019732; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019737; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019739; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019742; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019743; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019744; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019745; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019749; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019751; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019753; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019754; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019757; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019759; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019763; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019768; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019771; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019775; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019776; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019783; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019786; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019791; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019807; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019815; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019819; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019829; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019837; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019840; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019844; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019853; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019855; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019867; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019880; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019884; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019887; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019891; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019893; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019895; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019897; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019901; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019903; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019909; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019911; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019914; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019915; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019917; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019918; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019921; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019927; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019930; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019932; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019938; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019943; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019945; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019946; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019949; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019954; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019955; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019956; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019957; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019963; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019964; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019965; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019966; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019967; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019968; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019977; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019978; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020361; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018268; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018271; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018272; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018275; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018278; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018281; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018282; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018284; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018288; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018289; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018299; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018300; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018302; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018307; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018311; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018314; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018319; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018326; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018328; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018329; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018330; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018334; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018335; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018336; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018337; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018338; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018341; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018344; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018348; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018354; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018357; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018359; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018366; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018369; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018371; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018372; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018377; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018379; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018382; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018383; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018384; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018389; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018391; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018393; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018394; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018398; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018400; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018403; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018408; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018411; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018415; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018416; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018423; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018426; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018431; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018444; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018452; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018456; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018466; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018474; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018477; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018490; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018492; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018504; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018518; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018522; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018525; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018529; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018531; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018533; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018535; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018539; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018541; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018547; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018549; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018552; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018553; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018555; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018556; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018559; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018565; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018568; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018570; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018576; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018581; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018583; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018584; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018587; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018592; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018593; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018594; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018595; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018601; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018602; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018603; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018604; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018605; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018607; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018616; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018617; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018995; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018554; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018557; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018558; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018561; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018564; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018567; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018568; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018570; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018574; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018575; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018584; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018585; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018586; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018588; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018593; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018597; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018600; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018605; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018612; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018614; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018615; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018616; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018619; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018620; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018621; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018622; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018623; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018626; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018629; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018630; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018633; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018640; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018643; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018645; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018652; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018655; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018657; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018658; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018663; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018665; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018669; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018670; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018671; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018675; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018677; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018679; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018680; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018684; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018686; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018690; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018695; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018698; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018702; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018703; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018710; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018713; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018715; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018718; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018732; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018740; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018744; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018754; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018762; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018765; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018769; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018778; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018780; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018792; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018804; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018808; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018811; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018815; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018817; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018819; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018821; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018825; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018827; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018833; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018835; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018838; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018839; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018841; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018842; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018845; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018851; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018854; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018856; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018862; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018867; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018869; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018870; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018873; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018878; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018879; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018880; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018881; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018888; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018889; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018890; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018891; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018892; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018893; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018902; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018903; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001347; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001534; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003351; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006749; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010985; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017276; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017576; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017610; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018506; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018516; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018630; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020920; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020941; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021028; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021056; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021062; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021065; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021097; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021133; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021147; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021306; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021324; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026125; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026133; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026139; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026162; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026434; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026445; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026659; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026662; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026667; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026670; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034913; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036215; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039071; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039146; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039388; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040430; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042970; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043722; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044007; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044105; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044850; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045319; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055872; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057054; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057870; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059595; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066587; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068021; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068150; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069325; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069343; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070152; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070575; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070653; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070872; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071555; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074628; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077856; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079589; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080853; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081387; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081499; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082092; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086423; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090433; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092445; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092469; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092517; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092557; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093901; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093923; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093933; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097682; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100130; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100332; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103019; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103020; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103023; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103026; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103067; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103069; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103071; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103098; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103099; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103102; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106107; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106120; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106188; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106195; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106215; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106244; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106245; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106278; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106378; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106381; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106391; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106444; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106497; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106539; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106599; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106602; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106635; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106636; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106674; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106706; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106742; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106796; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106801; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106962; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106971; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106972; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106992; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107013; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107014; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107081; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107115; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107117; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107132; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107218; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107249; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107252; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117731; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120061; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120928; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127381; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129327; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131024; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132676; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132961; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133131; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133426; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000136523; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000137170; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000139934; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142229; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142495; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153476; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153983; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167787; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168459; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168579; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170381; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170556; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172809; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173870; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174302; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177131; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177304; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178798; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178839; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180023; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183610; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032561; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032572; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032575; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032586; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032614; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032632; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032633; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032641; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032663; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032665; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032718; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032724; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032737; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032752; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032796; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032808; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032825; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032846; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032882; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032894; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032895; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032899; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032913; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032916; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032917; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032920; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032921; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032936; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032951; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032957; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032970; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033002; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033019; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033024; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033044; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033057; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033068; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033070; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033084; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033093; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033113; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033122; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033129; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033135; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033156; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033167; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033170; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033172; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033198; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033206; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033222; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033244; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033257; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033274; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033280; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033303; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033319; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033348; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033399; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033423; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033447; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033516; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033569; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033587; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033607; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033656; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033668; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033729; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033805; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033822; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033840; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033850; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033859; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033870; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033873; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033897; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033909; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033934; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033944; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033957; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033966; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033979; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033983; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034005; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034038; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034054; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034059; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034094; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034106; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034113; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034116; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034145; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034183; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034188; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034191; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034195; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034202; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034226; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034234; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034242; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034244; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034251; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034256; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034287; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034291; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0032502; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032514; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032517; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032528; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032556; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032574; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032575; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032583; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032605; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032607; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032666; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032679; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032694; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032738; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032750; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032767; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032788; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032824; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032836; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032837; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032842; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032856; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032859; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032860; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032863; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032864; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032879; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032894; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032900; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032913; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032946; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032963; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032968; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032988; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033001; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033012; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033014; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033030; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033039; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033059; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033067; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033074; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033104; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033115; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033118; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033120; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033146; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033154; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033170; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033193; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033206; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033222; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033228; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033254; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033269; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033297; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033345; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033369; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033393; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033462; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033515; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033533; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033550; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033599; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033611; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033670; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033739; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033756; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033772; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033781; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033790; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033801; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033804; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033828; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033840; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033867; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033877; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033890; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033899; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033912; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033916; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033938; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033971; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033987; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0033992; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034027; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034039; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034046; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034049; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034077; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034115; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034120; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034127; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034158; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034166; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034174; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034176; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034183; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034188; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034218; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034222; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035342; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0032484; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032495; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032498; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032509; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032540; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032558; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032559; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032567; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032589; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032591; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032650; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032663; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032678; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032722; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032734; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032751; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032773; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032809; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032821; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032822; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032840; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032843; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032844; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032847; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032848; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032863; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032878; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032884; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032897; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032929; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032946; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032951; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032971; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032984; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032995; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032997; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033013; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033023; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033051; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033058; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033089; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033100; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033103; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033105; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033131; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033139; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033156; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033179; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033192; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033206; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033212; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033237; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033252; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033279; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033331; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033355; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033379; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033448; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033501; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033519; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033540; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033589; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033601; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033661; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033729; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033746; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033764; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033773; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033782; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033793; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033796; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033820; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033832; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033859; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033869; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033882; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033891; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033904; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033908; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033930; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033961; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033977; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0033982; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034017; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034029; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034036; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034039; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034067; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034105; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034110; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034113; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034117; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034145; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034153; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034161; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034163; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034170; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034175; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034204; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034208; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035323; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032495; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032506; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032509; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032520; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032548; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032566; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032567; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032575; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032596; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032598; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032657; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032670; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032685; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032729; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032741; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032758; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032779; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032815; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032827; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032828; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032832; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032846; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032849; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032850; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032853; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032854; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032869; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032884; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032890; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032903; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032935; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032952; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032957; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032977; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032990; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033001; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033003; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033019; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033028; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033048; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033055; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033062; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033068; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033093; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033104; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033107; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033109; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033135; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033143; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033159; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033181; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033194; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033209; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033215; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033240; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033255; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033282; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033333; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033357; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033381; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033450; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033503; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033520; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033541; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033590; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033602; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033663; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033733; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033750; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033768; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033777; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033786; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033797; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033800; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033824; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033836; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033863; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033873; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033886; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033896; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033909; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033913; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033935; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033968; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033984; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033989; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034024; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034036; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034043; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034046; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034074; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034112; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034117; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034120; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034124; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034153; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034161; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034169; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034171; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034178; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034183; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034213; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034217; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035339; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032284; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032290; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032294; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032297; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032308; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032336; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032353; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032354; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032362; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032384; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032386; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032445; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032457; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032472; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032516; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032528; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032544; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032565; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032601; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032613; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032614; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032618; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032632; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032635; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032636; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032639; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032640; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032655; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032670; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032676; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032689; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032720; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032737; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032742; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032762; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032775; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032786; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032788; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032804; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032814; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032834; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032842; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032849; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032855; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032879; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032890; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032893; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032895; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032921; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032929; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032946; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032968; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032981; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032995; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033001; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033026; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033041; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033068; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033114; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033140; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033164; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033233; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033286; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033304; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033321; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033370; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033382; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033443; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033513; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033530; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033548; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033557; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033566; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033577; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033580; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033604; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033616; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033643; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033653; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033666; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033676; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033689; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033693; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033715; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033745; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033761; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033766; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033801; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033813; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033820; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033823; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033851; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033889; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033894; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033897; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033901; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033933; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033941; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033949; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033951; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033958; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033963; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033993; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033997; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035117; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033005; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033013; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033016; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033027; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033055; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033073; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033074; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033082; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033104; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033106; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033163; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033175; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033190; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033234; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033246; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033263; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033284; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033320; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033332; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033333; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033337; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033352; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033355; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033356; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033359; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033360; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033375; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033390; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033396; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033407; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033438; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033455; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033460; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033480; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033493; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033504; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033506; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033520; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033530; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033550; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033559; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033566; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033592; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033603; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033606; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033608; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033634; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033642; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033658; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033679; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033692; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033707; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033713; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033739; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033755; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033781; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033831; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033855; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033881; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033950; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034002; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034019; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034037; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034086; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034098; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034158; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034233; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034250; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034268; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034277; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034286; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034297; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034300; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034324; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034336; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034363; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034373; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034386; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034395; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034408; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034412; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034434; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034464; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034480; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034485; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034520; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034533; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034540; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034543; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034609; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034614; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034617; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034621; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034653; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034661; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034669; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034671; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034678; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034683; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034713; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034717; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035835; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032102; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032105; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032119; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032150; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032168; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032169; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032177; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032201; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032203; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032258; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032263; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032276; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032292; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032338; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032351; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032367; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032391; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032428; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032444; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032445; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032449; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032466; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032469; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032470; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032473; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032474; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032490; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032506; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032512; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032525; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032556; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032575; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032580; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032601; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032615; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032626; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032629; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032644; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032653; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032681; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032688; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032694; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032719; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032731; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032734; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032736; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032763; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032772; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032789; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032813; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032827; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032844; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032850; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032876; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032891; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032922; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032970; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032995; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033017; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033085; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033143; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033160; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033179; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033231; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033243; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033304; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033380; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033397; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033416; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033428; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033437; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033449; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033479; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033494; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033523; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033534; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033548; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033558; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033571; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033575; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033598; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033632; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033649; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033657; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033693; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033706; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033714; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033717; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033746; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033784; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033789; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033792; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033796; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033828; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033837; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033846; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033848; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033855; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033860; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033893; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033897; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035048; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0032196; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032208; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032211; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032222; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032250; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032267; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032268; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032276; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032298; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032300; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032351; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032356; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032369; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032384; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032428; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032440; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032457; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032478; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032514; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032526; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032527; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032531; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032545; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032548; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032549; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032552; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032553; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032568; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032583; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032589; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032602; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032633; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032650; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032655; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032675; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032688; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032699; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032701; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032717; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032727; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032747; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032754; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032761; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032787; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032798; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032801; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032803; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032829; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032837; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032854; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032878; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032891; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032907; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032913; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032939; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032954; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032960; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0032982; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033030; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033054; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033078; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033147; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033200; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033218; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033237; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033286; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033298; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033358; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033427; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033444; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033462; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033471; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033480; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033491; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033494; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033518; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033530; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033557; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033568; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033581; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033591; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033604; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033608; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033630; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033660; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033676; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033681; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033716; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033728; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033735; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033738; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033766; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033804; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033809; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033812; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033816; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033846; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033854; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033862; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033864; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033871; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033876; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033906; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033910; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035035; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0032340; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032351; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032354; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032365; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032393; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032411; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032412; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032420; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032442; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032444; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032503; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032516; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032531; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032575; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032587; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032604; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032625; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032661; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032674; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032675; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032679; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032693; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032696; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032697; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032700; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032701; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032716; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032731; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032737; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032750; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032782; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032799; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032804; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032824; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032837; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032848; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032850; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032866; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032876; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032896; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032905; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032912; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032939; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032950; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032953; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032955; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032981; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032989; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033006; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033029; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033042; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033057; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033063; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033084; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033099; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033123; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033172; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033196; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033220; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033289; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033342; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033360; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033378; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033427; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033439; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033500; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033570; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033587; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033603; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033612; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033621; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033632; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033635; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033659; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033671; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033698; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033708; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033721; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033731; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033744; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033748; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033770; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033800; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033816; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033821; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033856; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033868; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033875; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033878; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033906; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033944; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033949; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033952; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033956; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033987; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0033995; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034003; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034005; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034012; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034017; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034047; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034051; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035173; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0032334; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032345; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032348; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032359; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032387; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032405; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032406; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032414; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032436; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032438; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032489; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032495; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032508; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032523; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032567; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032579; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032596; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032617; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032653; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032665; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032670; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032685; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032688; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032689; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032692; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032693; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032708; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032724; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032730; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032743; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032773; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032790; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032795; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032813; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032826; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032837; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032839; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032853; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032862; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032882; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032889; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032896; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032922; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032933; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032936; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032938; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032964; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032972; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032988; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033010; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033023; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033039; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033045; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033071; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033086; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033113; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033163; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033186; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033210; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033279; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033333; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033350; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033368; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033417; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033429; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033490; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033565; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033583; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033600; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033609; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033618; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033629; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033632; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033656; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033668; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033695; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033705; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033718; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033727; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033740; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033744; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033766; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033798; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033815; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033820; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033855; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033867; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033874; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033877; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033905; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033943; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033948; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033951; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033955; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033982; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033990; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0033998; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034000; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034007; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034012; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034043; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034047; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035157; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0032458; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032464; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032470; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032473; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032484; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032512; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032530; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032531; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032539; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032561; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032563; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032616; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032622; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032635; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032650; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032694; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032706; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032723; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032744; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032780; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032792; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032793; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032797; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032811; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032814; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032815; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032818; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032819; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032834; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032849; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032855; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032869; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032902; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032919; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032924; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032944; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032957; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032969; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032971; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032985; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032994; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033014; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033023; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033030; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033058; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033069; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033072; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033074; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033100; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033108; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033124; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033146; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033159; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033175; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033181; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033207; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033222; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033249; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033298; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033322; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033346; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033415; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033468; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033486; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033507; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033556; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033568; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033629; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033703; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033720; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033738; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033747; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033756; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033768; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033771; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033795; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033807; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033834; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033846; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033859; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033869; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033882; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033886; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033908; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033939; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033955; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033960; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0033995; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034007; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034014; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034017; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034045; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034083; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034088; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034091; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034095; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034126; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034134; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034142; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034144; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034151; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034156; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034186; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034190; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032328; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032340; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032343; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032354; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032382; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032400; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032401; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032409; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032431; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032433; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032486; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032492; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032505; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032520; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032564; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032576; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032593; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032614; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032650; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032662; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032663; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032667; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032681; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032684; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032685; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032688; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032689; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032704; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032719; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032725; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032738; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032769; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032786; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032791; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032811; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032824; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032835; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032837; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032851; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032860; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032880; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032888; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032895; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032901; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032922; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032933; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032936; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032938; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032966; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032974; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032990; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033013; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033027; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033043; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033049; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033075; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033090; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033117; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033169; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033193; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033217; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033286; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033339; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033357; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033378; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033427; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033439; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033500; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033574; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033591; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033608; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033617; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033626; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033637; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033640; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033664; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033676; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033704; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033714; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033727; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033736; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033749; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033753; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033775; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033806; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033821; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033826; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033861; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033873; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033880; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033883; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033912; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033950; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033955; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033958; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033963; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033992; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034000; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034008; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034010; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034017; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034022; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034052; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034056; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033031; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033042; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033045; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033056; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033084; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033102; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033103; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033111; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033133; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033135; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033194; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033207; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033222; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033266; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033278; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033295; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033316; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033352; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033364; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033365; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033369; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033383; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033386; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033387; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033390; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033391; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033406; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033421; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033427; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033440; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033471; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033488; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033493; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033513; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033526; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033537; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033539; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033554; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033564; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033584; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033593; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033600; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033606; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033629; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033640; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033643; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033645; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033671; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033679; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033695; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033717; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033730; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033746; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033752; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033778; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033793; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033820; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033871; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033895; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033919; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033990; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034044; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034061; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034081; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034131; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034143; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034203; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034280; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034297; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034315; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034325; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034334; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034345; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034348; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034372; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034384; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034411; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034421; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034434; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034443; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034456; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034460; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034482; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034514; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034530; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034535; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034570; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034582; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034589; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034592; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034620; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034658; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034663; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034666; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034670; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034701; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034709; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034717; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034719; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034726; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034731; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034761; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034765; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035870; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031800; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031812; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031815; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031828; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031856; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031874; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031875; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031881; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031904; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031906; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031964; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031977; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031994; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032040; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032051; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032067; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032091; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032127; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032143; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032144; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032148; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032165; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032168; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032169; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032172; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032173; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032188; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032199; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032221; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032253; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032271; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032276; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032295; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032309; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032320; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032323; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032347; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032367; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032375; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032383; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032413; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032424; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032427; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032429; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032456; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032465; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032483; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032513; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032526; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032543; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032550; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032576; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032591; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032620; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032667; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032692; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032714; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032777; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032838; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032858; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032926; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032939; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033000; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033076; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033094; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033114; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033125; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033134; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033145; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033148; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033173; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033187; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033215; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033227; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033240; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033251; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033264; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033270; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033292; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033324; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033341; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033347; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033383; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033397; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033404; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033407; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033435; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033473; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033478; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033481; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033485; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033516; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033525; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033534; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033536; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033543; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033549; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033584; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033588; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034725; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031753; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031763; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031766; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031777; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031805; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031823; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031824; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031832; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031854; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031856; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031906; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031912; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031925; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031940; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031984; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031996; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032013; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032034; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032070; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032082; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032083; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032087; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032101; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032104; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032105; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032108; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032109; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032124; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032139; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032145; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032159; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032191; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032208; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032213; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032233; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032246; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032257; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032259; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032274; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032283; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032312; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032319; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032325; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032343; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032354; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032357; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032358; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032385; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032393; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032410; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032432; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032445; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032459; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032465; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032491; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032506; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032512; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032532; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032580; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032604; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032628; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032697; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032751; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032769; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032789; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032838; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032850; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032911; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032985; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033002; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033019; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033028; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033037; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033048; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033051; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033075; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033087; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033114; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033124; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033137; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033146; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033159; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033163; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033185; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033219; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033235; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033240; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033275; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033287; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033294; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033297; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033325; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033363; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033368; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033372; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033376; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033407; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033415; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033423; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033425; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033432; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033437; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033467; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033471; mus_musculus_wsbeij.
DR   EuropePMC; PMC3226399; 21828285.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..20632797
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(3963..14668)
FT                   /gene="Aarsd1"
FT                   /locus_tag="mCG_141027"
FT                   /note="gene_id=mCG141027.0"
FT   mRNA            complement(join(3963..4311,5418..5512,6916..6970,
FT                   7377..7468,7617..7683,8024..8154,8346..8462,8557..8713,
FT                   9203..9260,11200..11359,14366..14497,14613..14668))
FT                   /gene="Aarsd1"
FT                   /locus_tag="mCG_141027"
FT                   /product="alanyl-tRNA synthetase domain containing 1"
FT                   /note="gene_id=mCG141027.0 transcript_id=mCT172767.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(4176..4311,5418..5512,6916..6970,
FT                   7377..7468,7617..7683,8024..8154,8346..8462,8557..8713,
FT                   9203..9260,11200..11359,14366..14497,14613..14651))
FT                   /codon_start=1
FT                   /gene="Aarsd1"
FT                   /locus_tag="mCG_141027"
FT                   /product="alanyl-tRNA synthetase domain containing 1"
FT                   /note="gene_id=mCG141027.0 transcript_id=mCT172767.0
FT                   protein_id=mCP95686.0"
FT                   /protein_id="EDL34038.1"
FT                   /translation="MAFLCQRDSYAREFTTTVVSCSPAELQTDASGGKKEVLSGFHVVL
FT                   EDTLLFPEGGGQPDDRGTINDISVLRVTRRGAQADHFTESPLSPGSQVQVRVDWERRFD
FT                   HMQQHSGQHLITAVADLLFGLKTTSWELGRLRSVIELDSPSVTAEQVAAIEQSVNQKIR
FT                   DRLPVSVRELSLDDPEVEQVRGRGLPDDHAGPIRVVTIEGVDSNMCCGTHVSNLSDLQV
FT                   IKILGTEKGKKNKSNLIFLAGNRVLKWMERSHGSEKALTSLLKCGVEDHVEAVKKLQNA
FT                   TKLLQKNNLNLLRDLAVHTAHSLRSSPAWGGVVTLHRKEGDSEFMNIIANEIGSEETLL
FT                   FLTVGDEKGAGLFLLAGPAEAVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRAEAQA
FT                   LLQDYVSTQSAEE"
FT   gene            complement(15746..22601)
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /note="gene_id=mCG141026.0"
FT   mRNA            complement(join(15746..16452,19133..19222,21048..21146,
FT                   21245..21311,21423..21536,21884..22601))
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /product="RIKEN cDNA 1700113I22, transcript variant
FT                   mCT172769"
FT                   /note="gene_id=mCG141026.0 transcript_id=mCT172769.0
FT                   created on 04-SEP-2002"
FT   mRNA            complement(join(15746..16452,16941..16994,19133..19222,
FT                   21048..21146,21245..21311,21423..21536,21884..22601))
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /product="RIKEN cDNA 1700113I22, transcript variant
FT                   mCT172768"
FT                   /note="gene_id=mCG141026.0 transcript_id=mCT172768.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(16435..16452,19133..19222,21048..21146,
FT                   21245..21311,21423..21536,21884..21891))
FT                   /codon_start=1
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /product="RIKEN cDNA 1700113I22, isoform CRA_b"
FT                   /note="gene_id=mCG141026.0 transcript_id=mCT172769.0
FT                   protein_id=mCP95688.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D9A7"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="MGI:MGI:1916146"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D9A7"
FT                   /protein_id="EDL34040.1"
FT                   /translation="MERQPARTLWYDRPKYVFMEFCVEDSTDVSVLIEDHRVVFSCRNG
FT                   DGVELYNEIEFYAKVNSKDSQDKRSGRSITCFVRKWKEKVAWPRLTKEDIKPVWLSVDF
FT                   DNWRDWEGDDEVELAQVEHYAEDDSDS"
FT   CDS             complement(join(16435..16452,16941..16994,19133..19222,
FT                   21048..21146,21245..21311,21423..21536,21884..21891))
FT                   /codon_start=1
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /product="RIKEN cDNA 1700113I22, isoform CRA_a"
FT                   /note="gene_id=mCG141026.0 transcript_id=mCT172768.0
FT                   protein_id=mCP95689.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="MGI:MGI:1916146"
FT                   /db_xref="UniProtKB/TrEMBL:A2A4P5"
FT                   /protein_id="EDL34039.1"
FT                   /translation="MERQPARTLWYDRPKYVFMEFCVEDSTDVSVLIEDHRVVFSCRNG
FT                   DGVELYNEIEFYAKVNSKDSQDKRSGRSITCFVRKWKEKVAWPRLTKEDIKPVWLSVDF
FT                   DNWRDWEGDDEVELAQVEHYAELLNKVSTKRPPPAMDDLDDDSDS"
FT   mRNA            complement(join(17512..18460,19133..19222,21048..21146,
FT                   21245..21311,21423..21536,21884..22601))
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /product="RIKEN cDNA 1700113I22, transcript variant
FT                   mCT172770"
FT                   /note="gene_id=mCG141026.0 transcript_id=mCT172770.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(18416..18460,19133..19222,21048..21146,
FT                   21245..21311,21423..21536,21884..21891))
FT                   /codon_start=1
FT                   /gene="1700113I22Rik"
FT                   /locus_tag="mCG_141026"
FT                   /product="RIKEN cDNA 1700113I22, isoform CRA_c"
FT                   /note="gene_id=mCG141026.0 transcript_id=mCT172770.0
FT                   protein_id=mCP95687.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9D9A7"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="MGI:MGI:1916146"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D9A7"
FT                   /protein_id="EDL34041.1"
FT                   /translation="MERQPARTLWYDRPKYVFMEFCVEDSTDVSVLIEDHRVVFSCRNG
FT                   DGVELYNEIEFYAKVNSKDSQDKRSGRSITCFVRKWKEKVAWPRLTKEDIKPVWLSVDF
FT                   DNWRDWEGDDEVELAQVEHYAEMHTSHSTHEEIRRL"
FT   gene            22351..32941
FT                   /gene="Rundc1"
FT                   /locus_tag="mCG_1040536"
FT                   /note="gene_id=mCG1040536.3"
FT   mRNA            join(22351..22878,26720..26878,28624..28822,29358..29474,
FT                   30728..32941)
FT                   /gene="Rundc1"
FT                   /locus_tag="mCG_1040536"
FT                   /product="RUN domain containing 1"
FT                   /note="gene_id=mCG1040536.3 transcript_id=mCT124202.2
FT                   created on 16-JUN-2003"
FT   CDS             join(22372..22878,26720..26878,28624..28822,29358..29474,
FT                   30728..31593)
FT                   /codon_start=1
FT                   /gene="Rundc1"
FT                   /locus_tag="mCG_1040536"
FT                   /product="RUN domain containing 1"
FT                   /note="gene_id=mCG1040536.3 transcript_id=mCT124202.2
FT                   protein_id=mCP75000.1"
FT                   /protein_id="EDL34042.1"
FT                   /translation="MATVEVATELGTVVTAVGPKAKDEEEEEEEEESLPPCETVRWAPV
FT                   GAVAEAGPGAATFSEAAAAEEPGAAPGSPSDATVRTLRRLEAERRQLDSALLALSSHFA
FT                   QVQFRLRQVVRGAPAEQQRLLRELEDFAFRGCPHVLGYEGLADPCGGDESDVLPGDRPR
FT                   VRGEDQSEQEERERLETQREKQKELILQLKTQLDDLETFAYQEGSYDSLPQSVVLERQR
FT                   VIIDELIKKLDMNLNEDISSLSTEELRQRVDAAVAQIVNPVRVKEQLVEQLKTQIRDLE
FT                   MFISFIQDEVGSPLQTGGHCECQASGKVGIGSTRVGGSTLPPGPGKAKAEDAKRARETG
FT                   LHLMRRALAVLQIFTVSQLGCATGQIPQTLWQRSQADRDYSHLLKRLEVSVDRVKQLAL
FT                   RHQPHDHVITSANLQDLSLGGKDELTTVVRKELTVAVRDLLAHGLYASSSGMSLVMAPL
FT                   ACLLPVFSSAPETMHPWELFVKYYHAKNGRAYVESPARKLSQSFALPIMGDTAVTPKQS
FT                   LLTAIHLVLTEHDPFKRSADSELKALVCMALNEQRLVSWVNLICKSGSLIEPHYQPWSY
FT                   MAHTGFESALNLLSRLSSLKFSLPVDLAVRQLKNIKDAF"
FT   assembly_gap    27431..27450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            39675..42790
FT                   /locus_tag="mCG_20222"
FT                   /note="gene_id=mCG20222.2"
FT   mRNA            join(39675..39730,39997..40079,40775..40944,42494..42604,
FT                   42713..42790)
FT                   /locus_tag="mCG_20222"
FT                   /product="mCG20222, transcript variant mCT19912"
FT                   /note="gene_id=mCG20222.2 transcript_id=mCT19912.2 created
FT                   on 15-JUL-2002"
FT   mRNA            join(39684..40079,40775..40944,42494..42604,42713..42783)
FT                   /locus_tag="mCG_20222"
FT                   /product="mCG20222, transcript variant mCT170713"
FT                   /note="gene_id=mCG20222.2 transcript_id=mCT170713.0 created
FT                   on 15-JUL-2002"
FT   mRNA            join(39997..40079,40775..40944,41229..41273,42494..42604,
FT                   42713..42790)
FT                   /locus_tag="mCG_20222"
FT                   /product="mCG20222, transcript variant mCT170714"
FT                   /note="gene_id=mCG20222.2 transcript_id=mCT170714.0 created
FT                   on 15-JUL-2002"
FT   CDS             join(39999..40079,40775..40944,41229..41273,42494..42604,
FT                   42713..42761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20222"
FT                   /product="mCG20222, isoform CRA_b"
FT                   /note="gene_id=mCG20222.2 transcript_id=mCT170714.0
FT                   protein_id=mCP93632.0 isoform=CRA_b"
FT                   /protein_id="EDL34045.1"
FT                   /translation="MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAG
FT                   IDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTSTRLSSHSESCVLGFRYSVDI
FT                   PLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKNKWFFQKLRF"
FT   CDS             join(39999..40079,40775..40944,42494..42604,42713..42761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20222"
FT                   /product="mCG20222, isoform CRA_a"
FT                   /note="gene_id=mCG20222.2 transcript_id=mCT170713.0
FT                   protein_id=mCP93631.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5BLJ9"
FT                   /db_xref="InterPro:IPR001141"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018262"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BLJ9"
FT                   /protein_id="EDL34043.1"
FT                   /translation="MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAG
FT                   IDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDP
FT                   ALKRKARREAKVKFEERYKTGKNKWFFQKLRF"
FT   CDS             join(39999..40079,40775..40944,42494..42604,42713..42761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20222"
FT                   /product="mCG20222, isoform CRA_a"
FT                   /note="gene_id=mCG20222.2 transcript_id=mCT19912.2
FT                   protein_id=mCP23612.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q5BLJ9"
FT                   /db_xref="InterPro:IPR001141"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018262"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BLJ9"
FT                   /protein_id="EDL34044.1"
FT                   /translation="MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAG
FT                   IDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDP
FT                   ALKRKARREAKVKFEERYKTGKNKWFFQKLRF"
FT   gene            45680..56762
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /note="gene_id=mCG141023.0"
FT   mRNA            join(45680..45895,53839..53937,54463..54610,54689..54795,
FT                   54893..55079,55164..55270,55474..56762)
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /product="interferon-induced protein 35, transcript variant
FT                   mCT161037"
FT                   /note="gene_id=mCG141023.0 transcript_id=mCT161037.2
FT                   created on 02-APR-2003"
FT   mRNA            join(45756..45895,53839..53942,54689..54795,54893..55079,
FT                   55164..55285)
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /product="interferon-induced protein 35, transcript variant
FT                   mCT181649"
FT                   /note="gene_id=mCG141023.0 transcript_id=mCT181649.0
FT                   created on 02-APR-2003"
FT   mRNA            join(45774..45895,53839..53937,54689..54795,54893..55079,
FT                   55164..55270,55474..55598)
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /product="interferon-induced protein 35, transcript variant
FT                   mCT181650"
FT                   /note="gene_id=mCG141023.0 transcript_id=mCT181650.0
FT                   created on 02-APR-2003"
FT   CDS             join(45875..45895,53839..53937,54463..54610,54689..54795,
FT                   54893..55079,55164..55270,55474..55665)
FT                   /codon_start=1
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /product="interferon-induced protein 35, isoform CRA_a"
FT                   /note="gene_id=mCG141023.0 transcript_id=mCT161037.2
FT                   protein_id=mCP90057.2 isoform=CRA_a"
FT                   /protein_id="EDL34046.1"
FT                   /translation="MSVTLQTVLYSLQEEQARLKMRLQELQQLKRERTGSPGAKIPFSV
FT                   PEVPLVFQGQTKQGRQVPKFVVSNLKVCCPLPEGSALVTFEDPKVVDRLLQQKEHRVNL
FT                   EDCRLRVQVQPLELPVVTNIQVSSQPDNHRVLVSGFPAGLRLSEEELLDKLEIFFGKAK
FT                   NGGGDVETREMLQGTVMLGFADEEVAQHLCQIGQFRVPLDRQQVLLRVSPYVSGEIQKA
FT                   EIKFQQAPHSVLVTNIPDVMDAQELHDILEIHFQKPTRGGGEVEALTVVPSGQQGLAIF
FT                   TSESS"
FT   CDS             join(45875..45895,53839..53937,54689..54733)
FT                   /codon_start=1
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /product="interferon-induced protein 35, isoform CRA_c"
FT                   /note="gene_id=mCG141023.0 transcript_id=mCT181650.0
FT                   protein_id=mCP104572.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR009938"
FT                   /db_xref="MGI:MGI:1917360"
FT                   /db_xref="UniProtKB/TrEMBL:D6RFB1"
FT                   /protein_id="EDL34048.1"
FT                   /translation="MSVTLQTVLYSLQEEQARLKMRLQELQQLKRERTGSPGAKWLIGC
FT                   YNKRNTELT"
FT   CDS             join(45875..45895,53839..53942,54689..54695)
FT                   /codon_start=1
FT                   /gene="Ifi35"
FT                   /locus_tag="mCG_141023"
FT                   /product="interferon-induced protein 35, isoform CRA_b"
FT                   /note="gene_id=mCG141023.0 transcript_id=mCT181649.0
FT                   protein_id=mCP104571.0 isoform=CRA_b"
FT                   /protein_id="EDL34047.1"
FT                   /translation="MSVTLQTVLYSLQEEQARLKMRLQELQQLKRERTGSPGAKVSG"
FT   gene            complement(55743..63508)
FT                   /gene="Vat1"
FT                   /locus_tag="mCG_20223"
FT                   /note="gene_id=mCG20223.1"
FT   mRNA            complement(join(55743..57549,57650..57891,59489..59578,
FT                   59681..59851,60200..60407,62999..63508))
FT                   /gene="Vat1"
FT                   /locus_tag="mCG_20223"
FT                   /product="vesicle amine transport protein 1 homolog (T
FT                   californica)"
FT                   /note="gene_id=mCG20223.1 transcript_id=mCT19913.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(57466..57549,57650..57891,59489..59578,
FT                   59681..59851,60200..60407,62999..63424))
FT                   /codon_start=1
FT                   /gene="Vat1"
FT                   /locus_tag="mCG_20223"
FT                   /product="vesicle amine transport protein 1 homolog (T
FT                   californica)"
FT                   /note="gene_id=mCG20223.1 transcript_id=mCT19913.2
FT                   protein_id=mCP23560.2"
FT                   /db_xref="GOA:Q499X4"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="MGI:MGI:1349450"
FT                   /db_xref="UniProtKB/TrEMBL:Q499X4"
FT                   /protein_id="EDL34049.1"
FT                   /translation="MSAEREAAEAATVAAATEAGAETGTGAGEGAPSQPPTVEVASDPQ
FT                   PPPAPEASASASAPPLRCLVLTGFGGYDKVKLQSRPAVPPAPGPGQLTLRVRACGLNFA
FT                   DLMGRQGLYDRLPPLPVTPGMEGAGVVVAVGEGVGDRKAGDRVMVLNRSGMWQEEVTVP
FT                   SAQTFLMPEAMTFEEAAALLVNYITAYMVLFDFGNLRPGHSVLVHMAAGGVGMAALQLC
FT                   RTVENVTVFGTASASKHEVLKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSD
FT                   TAKGYHLLKPMGKVVTYGMANLLTGPKRNLMAMARTWWNQFSVTALQLLQANRAVCGFH
FT                   LGYLDGEVELVNSVVTRLVALYNQGHIKPRIDSVWPFEKVADAMKQMQEKKNIGKVLLV
FT                   PGPEKET"
FT   gene            <62330..68920
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /note="gene_id=mCG20232.2"
FT   mRNA            join(<62330..62435,62922..63224,66224..66311,67081..67190,
FT                   67786..67920,68126..68915)
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /product="Rho family GTPase 2, transcript variant
FT                   mCT170716"
FT                   /note="gene_id=mCG20232.2 transcript_id=mCT170716.0 created
FT                   on 15-JUL-2002"
FT   mRNA            join(<62775..63224,66224..66311,67081..67190,67786..67920,
FT                   68126..68915)
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /product="Rho family GTPase 2, transcript variant
FT                   mCT170715"
FT                   /note="gene_id=mCG20232.2 transcript_id=mCT170715.0 created
FT                   on 15-JUL-2002"
FT   CDS             join(<63213..63224,66224..66311,67081..67190,67786..67920,
FT                   68126..68374)
FT                   /codon_start=1
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /product="Rho family GTPase 2, isoform CRA_a"
FT                   /note="gene_id=mCG20232.2 transcript_id=mCT170715.0
FT                   protein_id=mCP93633.0 isoform=CRA_a"
FT                   /protein_id="EDL34050.1"
FT                   /translation="PPKPSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDNVRPLA
FT                   YPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELS
FT                   KQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTD
FT                   SRRGLQRSTQLSGRPDRGNEGEMHKDRAKSCNLM"
FT   CDS             join(<63213..63224,66224..66311,67081..67190,67786..67920,
FT                   68126..68374)
FT                   /codon_start=1
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /product="Rho family GTPase 2, isoform CRA_a"
FT                   /note="gene_id=mCG20232.2 transcript_id=mCT170716.0
FT                   protein_id=mCP93634.0 isoform=CRA_a"
FT                   /protein_id="EDL34051.1"
FT                   /translation="PPKPSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDNVRPLA
FT                   YPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELS
FT                   KQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTD
FT                   SRRGLQRSTQLSGRPDRGNEGEMHKDRAKSCNLM"
FT   mRNA            join(65508..65730,66224..66311,67081..67190,67786..67920,
FT                   68126..68920)
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /product="Rho family GTPase 2, transcript variant mCT19974"
FT                   /note="gene_id=mCG20232.2 transcript_id=mCT19974.2 created
FT                   on 15-JUL-2002"
FT   CDS             join(65629..65730,66224..66311,67081..67190,67786..67920,
FT                   68126..68374)
FT                   /codon_start=1
FT                   /gene="Rnd2"
FT                   /locus_tag="mCG_20232"
FT                   /product="Rho family GTPase 2, isoform CRA_b"
FT                   /note="gene_id=mCG20232.2 transcript_id=mCT19974.2
FT                   protein_id=mCP23511.2 isoform=CRA_b"
FT                   /db_xref="GOA:A2A4Q3"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1338755"
FT                   /db_xref="UniProtKB/TrEMBL:A2A4Q3"
FT                   /protein_id="EDL34052.1"
FT                   /translation="MEGQSGRCKIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYT
FT                   ASFEIDKRRIELNMWDTSGSSYYDNVRPLAYPDSDAVLICFDISRPETLDSVLKKWQGE
FT                   TQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSS
FT                   RSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGLQRSTQLSGRPDRGNEGEMHKDRAK
FT                   SCNLM"
FT   gene            complement(85828..149012)
FT                   /gene="Brca1"
FT                   /locus_tag="mCG_20241"
FT                   /note="gene_id=mCG20241.2"
FT   mRNA            complement(join(85828..86976,88923..88983,89245..89318,
FT                   90616..90670,94998..95078,99056..99096,99545..99622,
FT                   102381..102468,105014..105294,106985..107163,
FT                   109772..109901,114323..114494,119485..119555,
FT                   120378..123692,125054..125130,126844..126889,
FT                   128045..128147,129073..129212,130992..131080,
FT                   132581..132658,137034..137087,146070..146168,
FT                   148824..149012))
FT                   /gene="Brca1"
FT                   /locus_tag="mCG_20241"
FT                   /product="breast cancer 1"
FT                   /note="gene_id=mCG20241.2 transcript_id=mCT19983.3 created
FT                   on 02-JUL-2003"
FT   CDS             complement(join(86831..86976,88923..88983,89245..89318,
FT                   90616..90670,94998..95078,99056..99096,99545..99622,
FT                   102381..102468,105014..105294,106985..107163,
FT                   109772..109901,114323..114494,119485..119555,
FT                   120378..123692,125054..125130,126844..126889,
FT                   128045..128147,129073..129212,130992..131080,
FT                   132581..132658,137034..137087,146070..146149))
FT                   /codon_start=1
FT                   /gene="Brca1"
FT                   /locus_tag="mCG_20241"
FT                   /product="breast cancer 1"
FT                   /note="gene_id=mCG20241.2 transcript_id=mCT19983.3
FT                   protein_id=mCP23423.2"
FT                   /protein_id="EDL34053.1"
FT                   /translation="MDLSAVQIQEVQNVLHAMQKILECPICLELIKEPVSTKCDHIFCK
FT                   FCMLKLLNQKKGPSQCPLCKNEITKRSLQGSTRFSQLAEELLRIMAAFELDTGMQLTNG
FT                   FSFSKKRNNSCERLNEEASIIQSVGYRNRVRRLPQVEPGNATLKDSLGVQLSNLGIVRS
FT                   VKKNRQTQPRKKSVYIELDSDSSEETVTKPGDCSVRDQELLQTAPQEAGDEGKLHSAEE
FT                   AACEFSEGIRNIEHHQCSDDLNPTENHATERHPEKCQSISISNVCVEPCGTDAHASSLQ
FT                   PETSSLLLIEDRMNAEKAEFCNKSKQPGIAVSQQSRWAASKGTCNDRQVPSTGEKVGPN
FT                   ADSLSDREKWTHPQSLCPENSGATTDVPWITLNSSVQKVNEWFSRTGEMLTSDSASARR
FT                   HESNAEAAVVLEVSNEVDGGFSSSRKTDLVTPDPHHTLMCKSGRDFSKPVEDNISDKIF
FT                   GKSYQRKGSRPHLNHVTEIIGTFITEPQITQEQPFTNKLKRKRSTSLQPEDFIKKADSA
FT                   GVQRTPDNINQGTDLMEPNEQAVSTTSNCQENKIAGSNLQKEKSAHPTESLRKEPASTA
FT                   GAKSISNSVSDLEVELNVHSSKAPKKNRLRRKSSIRCALPLEPISRNPSPPTCAELQID
FT                   SCGSSEETKKNHSNQQPAGHLREPQLIEDTEPAADAKKNEPNEHIRKRRASDAFPEEKL
FT                   MNKAGLLTSCSSPRKSQGPVNPSPQRTGTEQLETRQMSDSAKELGDRVLGGEPSGKTTD
FT                   RSEESTSVSLVSDTDYDTQNSVSVLDAHTVRYARTGSAQCMTQFVASENPKELVHGSNN
FT                   AGSGTEGLKPPLRHALNLSQEKVEMEDSELDTQYLQNTFQVSKRQSFALFSKPRSPQKD
FT                   CAHSVPSKELSPKVTAKGKQKERQGQEEFEISHVQAVAATVGLPVPCQEGKLAADTMCD
FT                   RGSRLCPSSHYRSGENGLSATGKSGISQNSHFKQSVSPIRSSIKTDNRKPLTEGRFERH
FT                   TSSTEMAVGNENILQSTVHTVSLNNRGNACQEAGSGSIHEVCSTGDSFPGQLGRNRGPK
FT                   VNTVPPLDSMQPGVCQQSVPVSDKYLEIKKQEGEAVCADFSPCLFSDHLEQSMSGKVFQ
FT                   VCSETPDDLLDDVEIQGHTSFGEGDIMERSAVFNGSILRRESSRSPSPVTHASKSQSLH
FT                   RASRKLESSEESDSTEDEDLPCFQHLLSRISNTPELTRCSSAVTQRMPEKAEGTQAPWK
FT                   GSSSDCNNEVIMIEASQEHQFSEDPRCSGSMFSSQHSAAQGSTANANSQDSNFIPPSKQ
FT                   RSHQCGNEEAFLSDKELISDNEEMATCLEEDNDQEEDSIIPDSEASGYESETNLSEDCS
FT                   QSDILTTQQRATMKYNLIKLQQEMAHLEAVLEQRGNQPSGHSPSLLADPCALEDLPDLE
FT                   PNMSGAAILTSKNINENPVSQNLKSACDDKFQLQHLEGPTSGDDESGMGRPSPFKSPLA
FT                   GSRGSAHGCSRHLQKRNSPSQEELLQPAGSEASSEPHNSTGQSCLPRRELEGTPYLGSG
FT                   ISLFSSRDPESESPKEPAHIGTTPASTSALKIPQGQVAFRSAAAAGADKAVVGIVSKIK
FT                   PELTSSEERADRDISMVVSGLTPKEVMTVQKFAEKYRLTLTDAITEETTHVIIKTDAEF
FT                   VCERTLKYFLGIAGGKWIVSYSWVVRSIQERRLLNVHEFEVKGDVVTGRNHQGPRRSRE
FT                   SREKLFKGLQVYCCEPFTNMPKDELERMLQLCGASVVKELPSLTHDTGAHLVVIVQPSA
FT                   WTEDSNCPDIGQLCKARLVMWDWVLDSLSSYRCRDLDAYLVQNITCDSSEPQDSND"
FT   gene            <149209..179008
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /note="gene_id=mCG20206.3"
FT   mRNA            join(<149209..149639,151042..151152,152864..152929,
FT                   153229..153345,156573..156635,157487..157505,
FT                   159351..159373,161683..161880,162758..162835,
FT                   163250..163464,164149..164316,165454..165663,
FT                   166311..166470,166553..166843,168339..168488,
FT                   168957..169032,169517..169627,169863..170027,
FT                   170158..170232,172054..172471,173358..173464,
FT                   174249..174306,174987..175092,177640..177849)
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, transcript variant
FT                   mCT193189"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193189.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(149794..150009,151042..151152,152864..152929,
FT                   153229..153345,156573..156635,157487..157505,
FT                   159351..159373,161683..161880,162758..162835,
FT                   163250..163464,164149..164316,165454..165663,
FT                   166311..166470,166553..166843,168339..168488,
FT                   168957..169032,169517..169627,169863..170027,
FT                   170158..170232,172054..172471,173358..173464,
FT                   174249..174306,174987..175092,177640..179000)
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, transcript variant
FT                   mCT19895"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT19895.2 created
FT                   on 15-JUL-2002"
FT   mRNA            join(<149916..150009,151042..151152,152864..152929,
FT                   153229..153345,156573..156635,157487..157505,
FT                   159351..159373,161683..161880,162758..162835,
FT                   163250..163464,164149..164316,165454..165663,
FT                   166311..166470,166553..166843,168339..168488,
FT                   168957..169032,169863..170027,170158..170232,
FT                   172054..172471,173358..173464,174249..174306,
FT                   174987..175092,177640..178999)
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, transcript variant
FT                   mCT193190"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193190.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<149918..150009,151042..151152,152864..152929,
FT                   153229..153345,156573..156635,157487..157505,
FT                   159351..159373,161683..161880,162758..162835,
FT                   163250..163464,164149..164316,165454..165663,
FT                   166311..166470,166553..166843,168339..168488,
FT                   168957..169032,169517..169627,169863..170027,
FT                   170158..170232,172054..172471,173358..173464,
FT                   174987..175092,177640..178999)
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, transcript variant
FT                   mCT193192"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193192.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<149938..150009,151042..151152,152864..152929,
FT                   153229..153345,156573..156635,157487..157505,
FT                   159351..159373,161683..161880,162758..162835,
FT                   163250..163464,164149..164316,165454..165663,
FT                   166311..166470,166553..166843,168339..168488,
FT                   168957..169032,169517..169627,169863..170027,
FT                   170158..170232,172054..172471,173358..173464,
FT                   174249..174306,177640..179008)
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, transcript variant
FT                   mCT193191"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193191.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<152918..152929,153229..153345,156573..156635,
FT                   157487..157505,159351..159373,161683..161880,
FT                   162758..162835,163250..163464,164149..164316,
FT                   165454..165663,166311..166470,166553..166843,
FT                   168339..168488,168957..169032,169517..169627,
FT                   169863..170027,170158..170232,172054..172471,
FT                   173358..173464,174249..174306,174987..175092,
FT                   177640..177813)
FT                   /codon_start=1
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, isoform CRA_a"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193189.0
FT                   protein_id=mCP114160.0 isoform=CRA_a"
FT                   /protein_id="EDL34054.1"
FT                   /translation="LGLQLQPDSMEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVK
FT                   VSFDLNTIQIKYLDEENEEISINSQGEYEEALKMANIKQGNQLQMQVHEGYHVVDEALP
FT                   KNVVENQAAARTGKKPLAHYSSLVRVLGSDMKTTEEPAPEQCSSAPCDTDQPQDKPPDW
FT                   FTSYLEMFREQVVKETVEKLEQRLQEKLVLQKPLLSSSPTEVSMPISEETLFLPENQFS
FT                   WHIACSHCQKRIVGVRYQCSLCPSYNICEDCEAGPYTHDTNHVLLKLRRPVVISSEPFF
FT                   YSKYSAPRLPAALEQVRLQKQVDKNFVKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIH
FT                   LWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCAPVMPTLSAAFVDENLPDGTHLQPG
FT                   TKFIKHWRMKNTGNVKWNTDTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIA
FT                   PTLEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSSESPDNVEGDRISSSKADDFSCEQ
FT                   EEAFLLAEEEIPLGEVTKQTEGTGASASQKTRRAASERELYIPSVDLLTAQDLLSFELL
FT                   DINIVQELERVPHNTPVDMTPCMSPLPHDSPLIEKPGLGQIQEESEGAGFKAPPDSTVS
FT                   AKRKAETPASVEETEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQRSPQRELQLYSTE
FT                   GQQPLVLPGFCRKDSSLKFALPEEGPRGDEREEIVHIVEEEVVEEEEEVQDEEVQSQSS
FT                   ASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGEPGIESGLEPTEARERLPE
FT                   RESQPQEQSISDILTTSQPLDTVPLVPEVAGLPAALSRSAPCGQCESSGVDSPGVDSPA
FT                   TMHEVPPAPDDIRGEPRGSTGLANSRQRSCDHSRHHNGSSIAGGLVKGALSVAASAYKA
FT                   LFSGPPVTAQPIVSEDQTTALMAHLFEMGFCDRQLNLRLLRKHNYNILQVVTELLQVNN
FT                   NDWYSHRY"
FT   CDS             join(<152918..152929,153229..153345,156573..156635,
FT                   157487..157505,159351..159373,161683..161880,
FT                   162758..162835,163250..163464,164149..164316,
FT                   165454..165663,166311..166470,166553..166843,
FT                   168339..168488,168957..169032,169863..170027,
FT                   170158..170232,172054..172471,173358..173464,
FT                   174249..174306,174987..175092,177640..177813)
FT                   /codon_start=1
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, isoform CRA_b"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193190.0
FT                   protein_id=mCP114161.0 isoform=CRA_b"
FT                   /protein_id="EDL34055.1"
FT                   /translation="LGLQLQPDSMEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVK
FT                   VSFDLNTIQIKYLDEENEEISINSQGEYEEALKMANIKQGNQLQMQVHEGYHVVDEALP
FT                   KNVVENQAAARTGKKPLAHYSSLVRVLGSDMKTTEEPAPEQCSSAPCDTDQPQDKPPDW
FT                   FTSYLEMFREQVVKETVEKLEQRLQEKLVLQKPLLSSSPTEVSMPISEETLFLPENQFS
FT                   WHIACSHCQKRIVGVRYQCSLCPSYNICEDCEAGPYTHDTNHVLLKLRRPVVISSEPFF
FT                   YSKYSAPRLPAALEQVRLQKQVDKNFVKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIH
FT                   LWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCAPVMPTLSAAFVDENLPDGTHLQPG
FT                   TKFIKHWRMKNTGNVKWNTDTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIA
FT                   PTLEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSSESPDNVEGDRISSSKADDFSCEQ
FT                   EEAFLLAEEEIPLGEVTKQTEGTGASASQKTRRAASERELYIPSVDLLTAQDLLSFELL
FT                   DINIVQELERVPHNTPVDSTVSAKRKAETPASVEETEEDLSGTQFVCETVIRSLTLDAA
FT                   PDHNPPCRQRSPQRELQLYSTEGQQPLVLPGFCRKDSSLKFALPEEGPRGDEREEIVHI
FT                   VEEEVVEEEEEVQDEEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERG
FT                   AEGEPGIESGLEPTEARERLPERESQPQEQSISDILTTSQPLDTVPLVPEVAGLPAALS
FT                   RSAPCGQCESSGVDSPGVDSPATMHEVPPAPDDIRGEPRGSTGLANSRQRSCDHSRHHN
FT                   GSSIAGGLVKGALSVAASAYKALFSGPPVTAQPIVSEDQTTALMAHLFEMGFCDRQLNL
FT                   RLLRKHNYNILQVVTELLQVNNNDWYSHRY"
FT   CDS             join(<152918..152929,153229..153345,156573..156635,
FT                   157487..157505,159351..159373,161683..161880,
FT                   162758..162835,163250..163464,164149..164316,
FT                   165454..165663,166311..166470,166553..166843,
FT                   168339..168488,168957..169032,169517..169627,
FT                   169863..170027,170158..170232,172054..172471,
FT                   173358..173464,174249..174306,177640..177673)
FT                   /codon_start=1
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, isoform CRA_c"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193191.0
FT                   protein_id=mCP114162.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q6ZQK3"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR032350"
FT                   /db_xref="InterPro:IPR033513"
FT                   /db_xref="InterPro:IPR034852"
FT                   /db_xref="MGI:MGI:108498"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZQK3"
FT                   /protein_id="EDL34056.1"
FT                   /translation="LGLQLQPDSMEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVK
FT                   VSFDLNTIQIKYLDEENEEISINSQGEYEEALKMANIKQGNQLQMQVHEGYHVVDEALP
FT                   KNVVENQAAARTGKKPLAHYSSLVRVLGSDMKTTEEPAPEQCSSAPCDTDQPQDKPPDW
FT                   FTSYLEMFREQVVKETVEKLEQRLQEKLVLQKPLLSSSPTEVSMPISEETLFLPENQFS
FT                   WHIACSHCQKRIVGVRYQCSLCPSYNICEDCEAGPYTHDTNHVLLKLRRPVVISSEPFF
FT                   YSKYSAPRLPAALEQVRLQKQVDKNFVKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIH
FT                   LWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCAPVMPTLSAAFVDENLPDGTHLQPG
FT                   TKFIKHWRMKNTGNVKWNTDTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIA
FT                   PTLEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSSESPDNVEGDRISSSKADDFSCEQ
FT                   EEAFLLAEEEIPLGEVTKQTEGTGASASQKTRRAASERELYIPSVDLLTAQDLLSFELL
FT                   DINIVQELERVPHNTPVDMTPCMSPLPHDSPLIEKPGLGQIQEESEGAGFKAPPDSTVS
FT                   AKRKAETPASVEETEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQRSPQRELQLYSTE
FT                   GQQPLVLPGFCRKDSSLKFALPEEGPRGDEREEIVHIVEEEVVEEEEEVQDEEVQSQSS
FT                   ASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGEPGIESGLEPTEARERLPE
FT                   RESQPQEQSISDILTTSQPLDTVPLVPEVAGLPAALSRSAPCGQCESSGVDSPGVDSPA
FT                   TMHEVPPAPDDIRGEPRGSTGLANSRQRSCDHSSPSFLKIRPQP"
FT   CDS             join(<152918..152929,153229..153345,156573..156635,
FT                   157487..157505,159351..159373,161683..161880,
FT                   162758..162835,163250..163464,164149..164316,
FT                   165454..165663,166311..166470,166553..166843,
FT                   168339..168488,168957..169032,169517..169627,
FT                   169863..170027,170158..170232,172054..172471,
FT                   173358..173464,174987..175024)
FT                   /codon_start=1
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, isoform CRA_d"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT193192.0
FT                   protein_id=mCP114163.0 isoform=CRA_d"
FT                   /protein_id="EDL34057.1"
FT                   /translation="LGLQLQPDSMEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVK
FT                   VSFDLNTIQIKYLDEENEEISINSQGEYEEALKMANIKQGNQLQMQVHEGYHVVDEALP
FT                   KNVVENQAAARTGKKPLAHYSSLVRVLGSDMKTTEEPAPEQCSSAPCDTDQPQDKPPDW
FT                   FTSYLEMFREQVVKETVEKLEQRLQEKLVLQKPLLSSSPTEVSMPISEETLFLPENQFS
FT                   WHIACSHCQKRIVGVRYQCSLCPSYNICEDCEAGPYTHDTNHVLLKLRRPVVISSEPFF
FT                   YSKYSAPRLPAALEQVRLQKQVDKNFVKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIH
FT                   LWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCAPVMPTLSAAFVDENLPDGTHLQPG
FT                   TKFIKHWRMKNTGNVKWNTDTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIA
FT                   PTLEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSSESPDNVEGDRISSSKADDFSCEQ
FT                   EEAFLLAEEEIPLGEVTKQTEGTGASASQKTRRAASERELYIPSVDLLTAQDLLSFELL
FT                   DINIVQELERVPHNTPVDMTPCMSPLPHDSPLIEKPGLGQIQEESEGAGFKAPPDSTVS
FT                   AKRKAETPASVEETEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQRSPQRELQLYSTE
FT                   GQQPLVLPGFCRKDSSLKFALPEEGPRGDEREEIVHIVEEEVVEEEEEVQDEEVQSQSS
FT                   ASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGEPGIESGLEPTEARERLPE
FT                   RESQPQEQSISDILTTSQPLDTVPLVPEVAGLPAALSRSAPCGQCESSGVDSPGVDSPA
FT                   TMHEVPPAPDDIRGGTTMGAALLEDW"
FT   CDS             join(153244..153345,156573..156635,157487..157505,
FT                   159351..159373,161683..161880,162758..162835,
FT                   163250..163464,164149..164316,165454..165663,
FT                   166311..166470,166553..166843,168339..168488,
FT                   168957..169032,169517..169627,169863..170027,
FT                   170158..170232,172054..172471,173358..173464,
FT                   174249..174306,174987..175092,177640..177813)
FT                   /codon_start=1
FT                   /gene="Nbr1"
FT                   /locus_tag="mCG_20206"
FT                   /product="neighbor of Brca1 gene 1, isoform CRA_e"
FT                   /note="gene_id=mCG20206.3 transcript_id=mCT19895.2
FT                   protein_id=mCP23593.2 isoform=CRA_e"
FT                   /db_xref="GOA:A1L329"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR032350"
FT                   /db_xref="InterPro:IPR033513"
FT                   /db_xref="InterPro:IPR034852"
FT                   /db_xref="MGI:MGI:108498"
FT                   /db_xref="UniProtKB/TrEMBL:A1L329"
FT                   /protein_id="EDL34058.1"
FT                   /translation="MEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVKVSFDLNTIQ
FT                   IKYLDEENEEISINSQGEYEEALKMANIKQGNQLQMQVHEGYHVVDEALPKNVVENQAA
FT                   ARTGKKPLAHYSSLVRVLGSDMKTTEEPAPEQCSSAPCDTDQPQDKPPDWFTSYLEMFR
FT                   EQVVKETVEKLEQRLQEKLVLQKPLLSSSPTEVSMPISEETLFLPENQFSWHIACSHCQ
FT                   KRIVGVRYQCSLCPSYNICEDCEAGPYTHDTNHVLLKLRRPVVISSEPFFYSKYSAPRL
FT                   PAALEQVRLQKQVDKNFVKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQ
FT                   SPKSPLGRPESLLQSNTLMLPLQPCAPVMPTLSAAFVDENLPDGTHLQPGTKFIKHWRM
FT                   KNTGNVKWNTDTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIAPTLEGTYTS
FT                   HWRLSHKGQQFGPRVWCSIIVDPFPSSESPDNVEGDRISSSKADDFSCEQEEAFLLAEE
FT                   EIPLGEVTKQTEGTGASASQKTRRAASERELYIPSVDLLTAQDLLSFELLDINIVQELE
FT                   RVPHNTPVDMTPCMSPLPHDSPLIEKPGLGQIQEESEGAGFKAPPDSTVSAKRKAETPA
FT                   SVEETEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQRSPQRELQLYSTEGQQPLVLPG
FT                   FCRKDSSLKFALPEEGPRGDEREEIVHIVEEEVVEEEEEVQDEEVQSQSSASSEDYIII
FT                   LPECFDTSRPLGDSMYSSALSQPGLERGAEGEPGIESGLEPTEARERLPERESQPQEQS
FT                   ISDILTTSQPLDTVPLVPEVAGLPAALSRSAPCGQCESSGVDSPGVDSPATMHEVPPAP
FT                   DDIRGEPRGSTGLANSRQRSCDHSRHHNGSSIAGGLVKGALSVAASAYKALFSGPPVTA
FT                   QPIVSEDQTTALMAHLFEMGFCDRQLNLRLLRKHNYNILQVVTELLQVNNNDWYSHRY"
FT   gene            179296..188839
FT                   /gene="Tmem106a"
FT                   /locus_tag="mCG_20225"
FT                   /note="gene_id=mCG20225.2"
FT   mRNA            join(179296..179380,179680..179759,180613..180839,
FT                   181501..181564,183294..183447,185906..186046,
FT                   186151..186194,186988..187041,187386..188838)
FT                   /gene="Tmem106a"
FT                   /locus_tag="mCG_20225"
FT                   /product="transmembrane protein 106A, transcript variant
FT                   mCT19967"
FT                   /note="gene_id=mCG20225.2 transcript_id=mCT19967.2 created
FT                   on 05-SEP-2002"
FT   mRNA            join(179360..179759,180613..180839,181501..181564,
FT                   183294..183447,185906..186046,186151..186194,
FT                   186988..187041,187386..188839)
FT                   /gene="Tmem106a"
FT                   /locus_tag="mCG_20225"
FT                   /product="transmembrane protein 106A, transcript variant
FT                   mCT172766"
FT                   /note="gene_id=mCG20225.2 transcript_id=mCT172766.0 created
FT                   on 05-SEP-2002"
FT   CDS             join(180632..180839,181501..181564,183294..183447,
FT                   185906..186046,186151..186194,186988..187041,
FT                   187386..187506)
FT                   /codon_start=1
FT                   /gene="Tmem106a"
FT                   /locus_tag="mCG_20225"
FT                   /product="transmembrane protein 106A, isoform CRA_a"
FT                   /note="gene_id=mCG20225.2 transcript_id=mCT172766.0
FT                   protein_id=mCP95685.0 isoform=CRA_a"
FT                   /protein_id="EDL34059.1"
FT                   /translation="MGKAVSQLTSRKDEDKPILPDNPAMASQAANYFSTGSSKPAHSCM
FT                   PYEKAASSSFVTCPTCQGNGEIPQEQEKQLVALIPYGDQRLKPRRTKLFVFLSVAICLL
FT                   IFSLTIFFLYPRPIAVRPVGLNSSTVTFEDAHVQLNTTNVLNIFNSNFYPITVTQLTAE
FT                   VLHQASVVGQVTSSLRLHIGPLASEQMPYEVASRILDENTYKICTWPKIRVHHILLNIQ
FT                   GSLTCSFLSHPQQLPFESFEYVDCRENMSLPHLELPRPA"
FT   CDS             join(180632..180839,181501..181564,183294..183447,
FT                   185906..186046,186151..186194,186988..187041,
FT                   187386..187506)
FT                   /codon_start=1
FT                   /gene="Tmem106a"
FT                   /locus_tag="mCG_20225"
FT                   /product="transmembrane protein 106A, isoform CRA_a"
FT                   /note="gene_id=mCG20225.2 transcript_id=mCT19967.2
FT                   protein_id=mCP23599.1 isoform=CRA_a"
FT                   /protein_id="EDL34060.1"
FT                   /translation="MGKAVSQLTSRKDEDKPILPDNPAMASQAANYFSTGSSKPAHSCM
FT                   PYEKAASSSFVTCPTCQGNGEIPQEQEKQLVALIPYGDQRLKPRRTKLFVFLSVAICLL
FT                   IFSLTIFFLYPRPIAVRPVGLNSSTVTFEDAHVQLNTTNVLNIFNSNFYPITVTQLTAE
FT                   VLHQASVVGQVTSSLRLHIGPLASEQMPYEVASRILDENTYKICTWPKIRVHHILLNIQ
FT                   GSLTCSFLSHPQQLPFESFEYVDCRENMSLPHLELPRPA"
FT   assembly_gap    204230..207400
FT                   /estimated_length=3171
FT                   /gap_type="unknown"
FT   assembly_gap    208437..215262
FT                   /estimated_length=6826
FT                   /gap_type="unknown"
FT   assembly_gap    219094..219113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <220864..226307
FT                   /locus_tag="mCG_146305"
FT                   /note="gene_id=mCG146305.0"
FT   mRNA            join(<220864..221073,221256..221341,226149..226307)
FT                   /locus_tag="mCG_146305"
FT                   /product="mCG146305"
FT                   /note="gene_id=mCG146305.0 transcript_id=mCT186408.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<220926..221073,221256..221341,226149..226265)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146305"
FT                   /product="mCG146305"
FT                   /note="gene_id=mCG146305.0 transcript_id=mCT186408.0
FT                   protein_id=mCP107585.0"
FT                   /protein_id="EDL34061.1"
FT                   /translation="VESPGHYQMFQCQNQIKICKGNRDQIRCAYTSDCIQKHRPEQYAW
FT                   CGVEGGARFDSNSSSRGSTTHFSTQSTNMNIYEETQLLELKAQRLFKSVQCCALRKSLP
FT                   QQKLATYTPWQI"
FT   assembly_gap    235967..235986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            239440..247587
FT                   /gene="Rdm1"
FT                   /locus_tag="mCG_20208"
FT                   /note="gene_id=mCG20208.1"
FT   mRNA            join(239440..239571,239780..239959,241732..241854,
FT                   242307..242466,245289..245387,246276..246361,
FT                   247236..247587)
FT                   /gene="Rdm1"
FT                   /locus_tag="mCG_20208"
FT                   /product="RAD52 motif 1, transcript variant mCT19898"
FT                   /note="gene_id=mCG20208.1 transcript_id=mCT19898.2 created
FT                   on 02-APR-2003"
FT   mRNA            join(239443..239571,239780..239931,242366..242466,
FT                   245289..245387,246276..>246358)
FT                   /gene="Rdm1"
FT                   /locus_tag="mCG_20208"
FT                   /product="RAD52 motif 1, transcript variant mCT181684"
FT                   /note="gene_id=mCG20208.1 transcript_id=mCT181684.0 created
FT                   on 02-APR-2003"
FT   CDS             join(239476..239571,239780..239959,241732..241854,
FT                   242307..242466,245289..245387,246276..246361,
FT                   247236..247337)
FT                   /codon_start=1
FT                   /gene="Rdm1"
FT                   /locus_tag="mCG_20208"
FT                   /product="RAD52 motif 1, isoform CRA_b"
FT                   /note="gene_id=mCG20208.1 transcript_id=mCT19898.2
FT                   protein_id=mCP23401.2 isoform=CRA_b"
FT                   /protein_id="EDL34063.1"
FT                   /translation="MAELISFVVPTQSDKVLLVWDLSTGPPAEALSHSLFTVFSQFGLL
FT                   YSVRVFPNAAVARPGFYAIIKFYSSRDAQRAQKACDGKPLFQTSPVKVRLGTRHKALQH
FT                   QAFALNSSRCQELANYYFGFSGWSKRIIKLQELSGLEDAALAVPMQKGSPQFLCAVEVV
FT                   LPPYGCRSPGVGISEEPLRQLEEGQSSFLMKRKTAQKLAFQAAVSDAFQKLTIVVLESG
FT                   RIAVEYRPTAEDLDARSEEELQNLIQVSCSSWSQSSQREEECLSDFSLEEEDLKLCDPH
FT                   "
FT   CDS             join(239476..239571,239780..239931,242366..242466,
FT                   245289..245387,246276..>246358)
FT                   /codon_start=1
FT                   /gene="Rdm1"
FT                   /locus_tag="mCG_20208"
FT                   /product="RAD52 motif 1, isoform CRA_a"
FT                   /note="gene_id=mCG20208.1 transcript_id=mCT181684.0
FT                   protein_id=mCP104606.0 isoform=CRA_a"
FT                   /protein_id="EDL34062.1"
FT                   /translation="MAELISFVVPTQSDKVLLVWDLSTGPPAEALSHSLFTVFSQFGLL
FT                   YSVRVFPNAAVARPGFYAIIKFYSSRDAQRAQKACDGNPQFLCAVEVVLPPYGCRSPGV
FT                   GISEEPLRQLEEGQSSFLMKRKTAQKLAFQAAVSDAFQKLTIVVLESGRIAVEYRPTAE
FT                   DLDARSEEELQNLI"
FT   gene            277046..279333
FT                   /gene="Arfl4"
FT                   /locus_tag="mCG_20217"
FT                   /note="gene_id=mCG20217.1"
FT   mRNA            join(277046..277121,278032..279333)
FT                   /gene="Arfl4"
FT                   /locus_tag="mCG_20217"
FT                   /product="ADP-ribosylation factor 4-like"
FT                   /note="gene_id=mCG20217.1 transcript_id=mCT19907.1 created
FT                   on 15-JUL-2002"
FT   CDS             278134..278739
FT                   /codon_start=1
FT                   /gene="Arfl4"
FT                   /locus_tag="mCG_20217"
FT                   /product="ADP-ribosylation factor 4-like"
FT                   /note="gene_id=mCG20217.1 transcript_id=mCT19907.1
FT                   protein_id=mCP23588.2"
FT                   /db_xref="GOA:Q99PE9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR024156"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1933155"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99PE9"
FT                   /protein_id="EDL34064.1"
FT                   /translation="MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKE
FT                   FVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDSA
FT                   ETERLEEARMELHRISKASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLT
FT                   HVQGCSAVDGLGLQPGLEHLYEMILKRKKAPRSSKKRR"
FT   assembly_gap    286494..286513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    291466..296278
FT                   /estimated_length=4813
FT                   /gap_type="unknown"
FT   gene            344217..380565
FT                   /gene="Dhx8"
FT                   /locus_tag="mCG_20209"
FT                   /note="gene_id=mCG20209.2"
FT   mRNA            join(344217..344450,345418..345503,346640..346712,
FT                   347071..347156,348919..349028,349392..349823,
FT                   350966..351110,352138..352341,352976..353063,
FT                   354551..354648,356582..356729,361369..361550,
FT                   362362..362556,363495..363680,363769..363979,
FT                   364632..364813,366216..366356,369069..369224,
FT                   373675..373812,375363..375491,375611..375807,
FT                   376244..376423,378106..380565)
FT                   /gene="Dhx8"
FT                   /locus_tag="mCG_20209"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 8"
FT                   /note="gene_id=mCG20209.2 transcript_id=mCT19899.2 created
FT                   on 05-SEP-2002"
FT   CDS             join(344303..344450,345418..345503,346640..346712,
FT                   347071..347156,348919..349028,349392..349823,
FT                   350966..351110,352138..352341,352976..353063,
FT                   354551..354648,356582..356729,361369..361550,
FT                   362362..362556,363495..363680,363769..363979,
FT                   364632..364813,366216..366356,369069..369224,
FT                   373675..373812,375363..375491,375611..375807,
FT                   376244..376423,378106..378325)
FT                   /codon_start=1
FT                   /gene="Dhx8"
FT                   /locus_tag="mCG_20209"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 8"
FT                   /note="gene_id=mCG20209.2 transcript_id=mCT19899.2
FT                   protein_id=mCP23482.2"
FT                   /protein_id="EDL34065.1"
FT                   /translation="MAVAVAAAGVLMGSEPGPAEELAKLEYLSLVSKVCTELDNHLGIN
FT                   DKDLAEFVISLAEKNTTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDP
FT                   VVKPKTEKEKLRELFPVLCQPDNPSARTMLDEEDVKVAVDVLKELEALMPSAAGQEKQR
FT                   DPEHRDRTKKKKRSRSRDRDRDRDRDRDRDRDRDRDRDKDRERDRDRERDRERDRERDH
FT                   KRRHRSRSRSHSRTRERTKGKSRYRSRSRSQSPFKDRKDREKYGERNLDRWRDKHVDRP
FT                   PPEEPAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKG
FT                   QRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSL
FT                   VSAPEVEDDSLERKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEED
FT                   EDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQ
FT                   REAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGK
FT                   KTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRG
FT                   KIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLREC
FT                   LIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYF
FT                   YEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDT
FT                   ACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLT
FT                   IDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTER
FT                   AYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLG
FT                   ALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDK
FT                   QALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQML
FT                   GIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALF
FT                   NRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPL
FT                   YNRYEEPNAWRISRAFRRR"
FT   gene            complement(381212..>396866)
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /note="gene_id=mCG20218.2"
FT   mRNA            complement(join(381212..382056,382435..382536,
FT                   382794..382966,383155..383223,383347..383421,
FT                   385071..385339,385543..385689,386779..386905,
FT                   388598..388651,395472..395519,395735..395828,
FT                   396059..396169,396650..>396866))
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /product="ets variant gene 4 (E1A enhancer binding protein,
FT                   E1AF), transcript variant mCT19908"
FT                   /note="gene_id=mCG20218.2 transcript_id=mCT19908.2 created
FT                   on 15-JUL-2002"
FT   mRNA            complement(join(381213..382056,382435..382536,
FT                   382794..382966,383155..383223,383347..383421,
FT                   385071..385339,385543..385707,386779..386905,
FT                   388598..388651,395472..395519,395735..395831,
FT                   396650..>396866))
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /product="ets variant gene 4 (E1A enhancer binding protein,
FT                   E1AF), transcript variant mCT170711"
FT                   /note="gene_id=mCG20218.2 transcript_id=mCT170711.0 created
FT                   on 15-JUL-2002"
FT   mRNA            complement(join(381213..382056,382435..382536,
FT                   382794..382966,383155..383223,383347..383421,
FT                   385071..385339,385543..385707,386779..386905,
FT                   388598..388651,395472..395519,395735..395828,
FT                   396059..396169,396650..>396866))
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /product="ets variant gene 4 (E1A enhancer binding protein,
FT                   E1AF), transcript variant mCT170712"
FT                   /note="gene_id=mCG20218.2 transcript_id=mCT170712.0 created
FT                   on 15-JUL-2002"
FT   CDS             complement(join(381832..382056,382435..382536,
FT                   382794..382966,383155..383223,383347..383421,
FT                   385071..385339,385543..385707,386779..386905,
FT                   388598..388651,395472..395519,395735..395831,
FT                   396650..>396865))
FT                   /codon_start=1
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /product="ets variant gene 4 (E1A enhancer binding protein,
FT                   E1AF), isoform CRA_a"
FT                   /note="gene_id=mCG20218.2 transcript_id=mCT170711.0
FT                   protein_id=mCP93629.0 isoform=CRA_a"
FT                   /protein_id="EDL34066.1"
FT                   /translation="EERERRPRQRKCTNQLLPRAHNCLLRPENKPGLWGPGAQAASLRP
FT                   SPATLVVSSPGHAEHPPAAPAQTPGPQQKSPGNGSLGEALMVPQGKLMDPGSLPPSDSE
FT                   DLFQDLSHFQETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSC
FT                   SRKPPLPYHHGEQCLYSSAYDSPRQIAIKSPAPGAPGQSPLQPFSRAEQQQSLLRASSS
FT                   SQSHPGHGYLGEHSSVFQQPVDMCHSFTSPQGGGREPLPAPYQHQLSEPCPPYPQQNFK
FT                   QEYHDPLYEQAGQPASSQGGVSGHRYPGAGVVIKQERTDFAYDSDVPGCASMYLHPEGF
FT                   SGPSPGDGVMGYGYEKSLRPFPDDVCIVPEKFEGDIKQEGIGAFREGPPYQRRGALQLW
FT                   QFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYY
FT                   EKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDES
FT                   PAYLPELTGPAPPFGHRGGYSY"
FT   CDS             complement(join(381832..382056,382435..382536,
FT                   382794..382966,383155..383223,383347..383421,
FT                   385071..385339,385543..385689,386779..386905,
FT                   388598..388651,395472..395519,395735..395828,
FT                   396059..396169,396650..>396865))
FT                   /codon_start=1
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /product="ets variant gene 4 (E1A enhancer binding protein,
FT                   E1AF), isoform CRA_c"
FT                   /note="gene_id=mCG20218.2 transcript_id=mCT19908.2
FT                   protein_id=mCP23590.2 isoform=CRA_c"
FT                   /protein_id="EDL34068.1"
FT                   /translation="EERERRPRQRKCTNQLLPRAHNCLLRPENKPGLWGPGAQAASLRP
FT                   SPATLVVSSPGHAEHPPAAPAQTPGPQVSASARGPGPVAGGSGRMERRMKGGYLDQRVP
FT                   YTFCSKSPGNGSLGEALMVPQGKLMDPGSLPPSDSEDLFQDLSHFQETWLAEAQVPDSD
FT                   EQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSRQIAIK
FT                   SPAPGAPGQSPLQPFSRAEQQQSLLRASSSSQSHPGHGYLGEHSSVFQQPVDMCHSFTS
FT                   PQGGGREPLPAPYQHQLSEPCPPYPQQNFKQEYHDPLYEQAGQPASSQGGVSGHRYPGA
FT                   GVVIKQERTDFAYDSDVPGCASMYLHPEGFSGPSPGDGVMGYGYEKSLRPFPDDVCIVP
FT                   EKFEGDIKQEGIGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIE
FT                   PEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAF
FT                   PDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELTGPAPPFGHRGGYSY"
FT   CDS             complement(join(381832..382056,382435..382536,
FT                   382794..382966,383155..383223,383347..383421,
FT                   385071..385339,385543..385707,386779..386905,
FT                   388598..388651,395472..395519,395735..395828,
FT                   396059..396169,396650..>396865))
FT                   /codon_start=1
FT                   /gene="Etv4"
FT                   /locus_tag="mCG_20218"
FT                   /product="ets variant gene 4 (E1A enhancer binding protein,
FT                   E1AF), isoform CRA_b"
FT                   /note="gene_id=mCG20218.2 transcript_id=mCT170712.0
FT                   protein_id=mCP93630.0 isoform=CRA_b"
FT                   /protein_id="EDL34067.1"
FT                   /translation="EERERRPRQRKCTNQLLPRAHNCLLRPENKPGLWGPGAQAASLRP
FT                   SPATLVVSSPGHAEHPPAAPAQTPGPQVSASARGPGPVAGGSGRMERRMKGGYLDQRVP
FT                   YTFCSKSPGNGSLGEALMVPQGKLMDPGSLPPSDSEDLFQDLSHFQETWLAEAQVPDSD
FT                   EQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSSAYDSP
FT                   RQIAIKSPAPGAPGQSPLQPFSRAEQQQSLLRASSSSQSHPGHGYLGEHSSVFQQPVDM
FT                   CHSFTSPQGGGREPLPAPYQHQLSEPCPPYPQQNFKQEYHDPLYEQAGQPASSQGGVSG
FT                   HRYPGAGVVIKQERTDFAYDSDVPGCASMYLHPEGFSGPSPGDGVMGYGYEKSLRPFPD
FT                   DVCIVPEKFEGDIKQEGIGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGM
FT                   EFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEA
FT                   LFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELTGPAPPFGHRGGYSY"
FT   assembly_gap    395972..395991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    400706..400789
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   gene            complement(488940..506938)
FT                   /gene="Meox1"
FT                   /locus_tag="mCG_21357"
FT                   /note="gene_id=mCG21357.2"
FT   mRNA            complement(join(488940..490164,491884..492059,
FT                   506172..506938))
FT                   /gene="Meox1"
FT                   /locus_tag="mCG_21357"
FT                   /product="mesenchyme homeobox 1"
FT                   /note="gene_id=mCG21357.2 transcript_id=mCT22043.2 created
FT                   on 15-JUL-2002"
FT   CDS             complement(join(490042..490164,491884..492059,
FT                   506172..506634))
FT                   /codon_start=1
FT                   /gene="Meox1"
FT                   /locus_tag="mCG_21357"
FT                   /product="mesenchyme homeobox 1"
FT                   /note="gene_id=mCG21357.2 transcript_id=mCT22043.2
FT                   protein_id=mCP23463.2"
FT                   /db_xref="GOA:P32442"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:103220"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32442"
FT                   /protein_id="EDL34069.1"
FT                   /translation="MDPVANSCVRNPQPPAPVWGCLRNPHSEDSSASGLSHYPPTPFSF
FT                   HQKSDFPATAAYPDFSASCLAATPHSLPRTERIFNEQHPAFPQTPDWHFPISEAGQRLN
FT                   LGPAGSAREMGAGSPGLVDGTAGLGEDCMVLGTIANETEKKSSRRKKERSDNQENGGGK
FT                   PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRR
FT                   MKWKRVKGGQPVSPQEQDREDGDSAASPSSE"
FT   gene            <498849..503797
FT                   /locus_tag="mCG_1042067"
FT                   /note="gene_id=mCG1042067.0"
FT   mRNA            join(<498849..498967,503534..503797)
FT                   /locus_tag="mCG_1042067"
FT                   /product="mCG1042067"
FT                   /note="gene_id=mCG1042067.0 transcript_id=mCT159771.0
FT                   created on 05-SEP-2002"
FT   CDS             <503546..503698
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042067"
FT                   /product="mCG1042067"
FT                   /note="gene_id=mCG1042067.0 transcript_id=mCT159771.0
FT                   protein_id=mCP75432.0"
FT                   /protein_id="EDL34070.1"
FT                   /translation="RLQECNNVLRVAVTLSLHLPDNEVQWSRLAHLPGLSHGDLDEAPR
FT                   SQQSR"
FT   gene            552669..553099
FT                   /locus_tag="mCG_49945"
FT                   /note="gene_id=mCG49945.1"
FT   mRNA            552669..553099
FT                   /locus_tag="mCG_49945"
FT                   /product="mCG49945"
FT                   /note="gene_id=mCG49945.1 transcript_id=mCT50128.1 created
FT                   on 05-SEP-2002"
FT   CDS             552673..553071
FT                   /codon_start=1
FT                   /locus_tag="mCG_49945"
FT                   /product="mCG49945"
FT                   /note="gene_id=mCG49945.1 transcript_id=mCT50128.1
FT                   protein_id=mCP42949.0"
FT                   /protein_id="EDL34071.1"
FT                   /translation="MGKFMKSRKVVLVLAGRKAVIVKNIDDGTSDRPYSHALVAGIDRY
FT                   PRKVTAAMAKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKR
FT                   KARREAKVKFEEQYKTGKNKWFFQKLHF"
FT   assembly_gap    564785..564804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <567538..575690
FT                   /locus_tag="mCG_145529"
FT                   /note="gene_id=mCG145529.0"
FT   mRNA            join(<567538..567596,570812..570981,571168..571218,
FT                   574787..575690)
FT                   /locus_tag="mCG_145529"
FT                   /product="mCG145529"
FT                   /note="gene_id=mCG145529.0 transcript_id=mCT184953.0
FT                   created on 05-JUN-2003"
FT   CDS             <574891..575391
FT                   /codon_start=1
FT                   /locus_tag="mCG_145529"
FT                   /product="mCG145529"
FT                   /note="gene_id=mCG145529.0 transcript_id=mCT184953.0
FT                   protein_id=mCP105798.0"
FT                   /protein_id="EDL34072.1"
FT                   /translation="LSASPVPGYLMPSSDLLRHQACKCYTGIYSSKSTHTPKLNHKQNK
FT                   NTFNTCGTFPRPETSCALRWGNQGALQEWGRPKCSHPQWSGDRVGECGLLSGNLWKRVY
FT                   TGLSTRFQCLWLWVTQEASADPSVFPATSPSHFKESGDPVALLGFCNFVSFMRRNGLFL
FT                   ECK"
FT   gene            complement(577653..582132)
FT                   /gene="Sost"
FT                   /locus_tag="mCG_21360"
FT                   /note="gene_id=mCG21360.2"
FT   mRNA            complement(join(577653..579384,581877..582132))
FT                   /gene="Sost"
FT                   /locus_tag="mCG_21360"
FT                   /product="sclerostin"
FT                   /note="gene_id=mCG21360.2 transcript_id=mCT22041.2 created
FT                   on 15-JUL-2002"
FT   CDS             complement(join(578963..579384,581877..582090))
FT                   /codon_start=1
FT                   /gene="Sost"
FT                   /locus_tag="mCG_21360"
FT                   /product="sclerostin"
FT                   /note="gene_id=mCG21360.2 transcript_id=mCT22041.2
FT                   protein_id=mCP23468.2"
FT                   /db_xref="GOA:B2RQA5"
FT                   /db_xref="InterPro:IPR008835"
FT                   /db_xref="InterPro:IPR015665"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:1921749"
FT                   /db_xref="UniProtKB/TrEMBL:B2RQA5"
FT                   /protein_id="EDL34073.1"
FT                   /translation="MQPSLAPCLICLLVHAAFCAVEGQGWQAFRNDATEVIPGLGEYPE
FT                   PPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCS
FT                   GQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASC
FT                   KCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY"
FT   gene            complement(589275..602104)
FT                   /gene="Dusp3"
FT                   /locus_tag="mCG_21353"
FT                   /note="gene_id=mCG21353.1"
FT   mRNA            complement(join(589275..590056,596730..596956,
FT                   599725..599864,601980..602104))
FT                   /gene="Dusp3"
FT                   /locus_tag="mCG_21353"
FT                   /product="dual specificity phosphatase 3 (vaccinia virus
FT                   phosphatase VH1-related), transcript variant mCT22038"
FT                   /note="gene_id=mCG21353.1 transcript_id=mCT22038.1 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(589276..590056,596730..596956,
FT                   599725..>599884))
FT                   /gene="Dusp3"
FT                   /locus_tag="mCG_21353"
FT                   /product="dual specificity phosphatase 3 (vaccinia virus
FT                   phosphatase VH1-related), transcript variant mCT193262"
FT                   /note="gene_id=mCG21353.1 transcript_id=mCT193262.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(589851..590056,596730..596956,
FT                   599725..>599882))
FT                   /codon_start=1
FT                   /gene="Dusp3"
FT                   /locus_tag="mCG_21353"
FT                   /product="dual specificity phosphatase 3 (vaccinia virus
FT                   phosphatase VH1-related), isoform CRA_a"
FT                   /note="gene_id=mCG21353.1 transcript_id=mCT193262.0
FT                   protein_id=mCP114228.0 isoform=CRA_a"
FT                   /protein_id="EDL34074.1"
FT                   /translation="SCPGVQRPAAAMSSSFELSVQDLNDLLSDGSGCYSLPSQPCNEVV
FT                   PRVYVGNASVAQDITQLQKLGITHVLNAAEGRSFMHVNTSASFYEDSGITYLGIKANDT
FT                   QEFNLSAYFERATDFIDQALAHKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALS
FT                   TVRQNREIGPNDGFLAQLCQLNDRLAKEGKVKL"
FT   CDS             complement(join(589851..590056,596730..596956,
FT                   599725..599849))
FT                   /codon_start=1
FT                   /gene="Dusp3"
FT                   /locus_tag="mCG_21353"
FT                   /product="dual specificity phosphatase 3 (vaccinia virus
FT                   phosphatase VH1-related), isoform CRA_b"
FT                   /note="gene_id=mCG21353.1 transcript_id=mCT22038.1
FT                   protein_id=mCP23566.1 isoform=CRA_b"
FT                   /protein_id="EDL34075.1"
FT                   /translation="MSSSFELSVQDLNDLLSDGSGCYSLPSQPCNEVVPRVYVGNASVA
FT                   QDITQLQKLGITHVLNAAEGRSFMHVNTSASFYEDSGITYLGIKANDTQEFNLSAYFER
FT                   ATDFIDQALAHKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSTVRQNREIGPN
FT                   DGFLAQLCQLNDRLAKEGKVKL"
FT   gene            602164..607350
FT                   /locus_tag="mCG_21361"
FT                   /note="gene_id=mCG21361.1"
FT   mRNA            join(602164..602350,603060..603130,603559..603677,
FT                   605881..606004,606543..606599,607207..607350)
FT                   /locus_tag="mCG_21361"
FT                   /product="mCG21361"
FT                   /note="gene_id=mCG21361.1 transcript_id=mCT22046.2 created
FT                   on 05-SEP-2002"
FT   CDS             join(602227..602350,603060..603130,603559..603677,
FT                   605881..606004,606543..606599)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21361"
FT                   /product="mCG21361"
FT                   /note="gene_id=mCG21361.1 transcript_id=mCT22046.2
FT                   protein_id=mCP23540.2"
FT                   /db_xref="GOA:Q9DAN9"
FT                   /db_xref="InterPro:IPR029488"
FT                   /db_xref="MGI:MGI:1922687"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DAN9"
FT                   /protein_id="EDL34076.1"
FT                   /translation="MNNSLDYLAYPVIVSNHRQSTTFRKKLDFGHYILHKNRVQIVKPA
FT                   VDTKPPMAHTHYILKLSKIQGEQKRIDKIEYENRQLCQKIANAYRGPAKVDCWNEYLSK
FT                   SLNRESRNRELVRITMENQGILRRLSDRKPNYDRRSSEMDWQNSRRYIRNTTRYLLFQE
FT                   D"
FT   gene            complement(614732..>642003)
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /note="gene_id=mCG21363.3"
FT   mRNA            complement(join(614732..615799,617094..617216,
FT                   620060..620168,620417..620510,623426..623506,
FT                   623590..623754,624713..624754,625277..625297,
FT                   626790..626854,628385..628581,631697..631771,
FT                   633680..633765,635540..635621,638395..638532,
FT                   638770..638850,640145..640222,640449..640567,
FT                   640800..640924,641935..642001))
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /product="membrane protein, palmitoylated 3 (MAGUK p55
FT                   subfamily member 3), transcript variant mCT22049"
FT                   /note="gene_id=mCG21363.3 transcript_id=mCT22049.2 created
FT                   on 15-JUL-2002"
FT   mRNA            complement(join(614732..615799,617094..617216,
FT                   620060..620168,620417..620510,623426..623506,
FT                   623590..623754,624713..624754,626775..626854,
FT                   628385..628581,631697..631771,633680..633765,
FT                   635540..635621,638395..638532,638770..638850,
FT                   640145..640222,640449..640567,640800..640924,
FT                   641935..>641973))
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /product="membrane protein, palmitoylated 3 (MAGUK p55
FT                   subfamily member 3), transcript variant mCT193170"
FT                   /note="gene_id=mCG21363.3 transcript_id=mCT193170.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(615256..615799,617094..617216,
FT                   620060..620168,620417..620510,623426..623506,
FT                   623590..623754,624713..624754,626775..626854,
FT                   628385..628581,631697..631771,633680..633765,
FT                   635540..635621,638395..638532,638770..640222,
FT                   640449..640567,640800..640924,641935..>642003))
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /product="membrane protein, palmitoylated 3 (MAGUK p55
FT                   subfamily member 3), transcript variant mCT193171"
FT                   /note="gene_id=mCG21363.3 transcript_id=mCT193171.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(615623..615799,617094..617216,
FT                   620060..620168,620417..620510,623426..623506,
FT                   623590..623754,624713..624754,625277..625297,
FT                   626790..626854,628385..628581,631697..631771,
FT                   633680..633765,635540..635621,638395..638532,
FT                   638770..638850,640145..640222,640449..640567,
FT                   640800..640824))
FT                   /codon_start=1
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /product="membrane protein, palmitoylated 3 (MAGUK p55
FT                   subfamily member 3), isoform CRA_c"
FT                   /note="gene_id=mCG21363.3 transcript_id=mCT22049.2
FT                   protein_id=mCP23470.2 isoform=CRA_c"
FT                   /protein_id="EDL34079.1"
FT                   /translation="MPILSEDSGLHETLALLTSQLRPDSNHREEMGFLRDVFSEKSLSY
FT                   LMKIHEKLRYYERQSPTPVLHSAMALAEDVMEELQAASVHSDERELLQLLSTPHLRAVL
FT                   MVHDTVAQKNFDPVLPPLPDNIDEDFEEESVKIVRLVKNKEPLGATIRRDEHSGAVVVA
FT                   RIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQEED
FT                   RFKDSKVFMRALFHYDPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTNL
FT                   RAGLIPSKQFQERRLSYRRTTGTLPSPQNFKKPPYDQPCDKETCDCDGYFKGHYVAGLR
FT                   RSFRLGCRERLGGSQEAKVPTGAESQVLLTYEEVARYQHQPGERPRLVVLIGSLGAHLH
FT                   ELKQRVVAEDPQQFAVAVPHTTRPRKSHERDGVEYHFVSKQAFEADVHHNKFLEHGEYK
FT                   ENLYGTSLEAIQAVMAKNKVCLVDVEPEALRHLRTPEFKPYVIFVKPAIQERRKTPPVS
FT                   PDSEDIASSLDEQQQEMAASAAFIDQHYGHLIDTVLVRQDLQEACSQLRAVIETLSKDT
FT                   SWVPISWVR"
FT   CDS             complement(join(626782..626854,628385..628581,
FT                   631697..631771,633680..633765,635540..635621,
FT                   638395..638532,638770..638850,640145..640222,
FT                   640449..640567,640800..>640884))
FT                   /codon_start=1
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /product="membrane protein, palmitoylated 3 (MAGUK p55
FT                   subfamily member 3), isoform CRA_a"
FT                   /note="gene_id=mCG21363.3 transcript_id=mCT193170.0
FT                   protein_id=mCP114166.0 isoform=CRA_a"
FT                   /protein_id="EDL34077.1"
FT                   /translation="EIPLPPTQTVGTAGDLLGTGMPILSEDSGLHETLALLTSQLRPDS
FT                   NHREEMGFLRDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAMALAEDVMEELQAASV
FT                   HSDERELLQLLSTPHLRAVLMVHDTVAQKNFDPVLPPLPDNIDEDFEEESVKIVRLVKN
FT                   KEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQI
FT                   LAQSQGSITLKIIPATQEEDRFKDSKVFMRALFHYDPREDRAIPCQEAGLPFQRRQVLE
FT                   VVSQDDPTWWQAKRVGDTNLRAGLIPSKQFQERRLSYRRTTGTLPSPQNFKKPPCE"
FT   CDS             complement(join(626782..626854,628385..628581,
FT                   631697..631771,633680..633765,635540..635621,
FT                   638395..638532,638770..>639051))
FT                   /codon_start=1
FT                   /gene="Mpp3"
FT                   /locus_tag="mCG_21363"
FT                   /product="membrane protein, palmitoylated 3 (MAGUK p55
FT                   subfamily member 3), isoform CRA_b"
FT                   /note="gene_id=mCG21363.3 transcript_id=mCT193171.0
FT                   protein_id=mCP114167.0 isoform=CRA_b"
FT                   /protein_id="EDL34078.1"
FT                   /translation="VHSRPWFDFPRASASLGVASVTCFRVLRPFLRGSLCPRPREEGFP
FT                   PRGSIQQAPARGTSASCLLLLQVMEELQAASVHSDERELLQLLSTPHLRAVLMVHDTVA
FT                   QKNFDPVLPPLPDNIDEDFEEESVKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGA
FT                   ADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQEEDRFKDSKV
FT                   FMRALFHYDPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPS
FT                   KQFQERRLSYRRTTGTLPSPQNFKKPPCE"
FT   gene            complement(645337..650161)
FT                   /locus_tag="mCG_148168"
FT                   /note="gene_id=mCG148168.0"
FT   mRNA            complement(join(645337..645537,649911..650161))
FT                   /locus_tag="mCG_148168"
FT                   /product="mCG148168"
FT                   /note="gene_id=mCG148168.0 transcript_id=mCT188431.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(645372..645470)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148168"
FT                   /product="mCG148168"
FT                   /note="gene_id=mCG148168.0 transcript_id=mCT188431.0
FT                   protein_id=mCP109345.0"
FT                   /protein_id="EDL34080.1"
FT                   /translation="MRQTHVPLICRLMTQTGHDQLLHILLAVNSLP"
FT   gene            <656592..670682
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /note="gene_id=mCG21358.2"
FT   mRNA            join(<656592..656718,658057..658389,661921..662254,
FT                   663756..663868,665544..665596,668539..668658,
FT                   669160..669747)
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /product="CD300 antigen like family member G, transcript
FT                   variant mCT193269"
FT                   /note="gene_id=mCG21358.2 transcript_id=mCT193269.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<656592..656718,658057..658389,661921..662254,
FT                   663756..663868,665544..665596,668539..668658,
FT                   669160..669279)
FT                   /codon_start=1
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /product="CD300 antigen like family member G, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21358.2 transcript_id=mCT193269.0
FT                   protein_id=mCP114229.0 isoform=CRA_a"
FT                   /protein_id="EDL34081.1"
FT                   /translation="PPFLAPARQKLKLRRAPNCRQLQCPAPTMRPLVLLWGCLVLPGYE
FT                   ALKGPKEISGFEGDTVSLRCTYVEKMKEHRKYWCRQGGILVSRCGDIVYANQDQEVTRG
FT                   RMSIRDSPQELSMTVIMRDLTLKDSGKYWCGIDRLGRDESFEVTLIVFPASPGLHPTVV
FT                   TAKQGKTGVKAPVFTEAAPAWSTGTSQVPPGISPYAGSSPHTATPARSAGTSQVPPGIS
FT                   PYAGRSPHTATSPHAGSSRPVVWLPLTTPQDSRAVASSVSKPSVSIPMVRMMAPVLILL
FT                   SLLLAAGLIAFGSHMLRWRKKAWLATETQKNEKVYLETSLPGNGWTTEDSTIDLAVTPE
FT                   CLRNLNPSAVPSPETQNLSQSTEEEEAARSLDDDKEDVMAPPPLQMSAEELAFSEFISV
FT                   "
FT   mRNA            join(656595..656718,658057..658389,662173..662254,
FT                   663756..663868,665544..665596,668539..668658,
FT                   669160..670682)
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /product="CD300 antigen like family member G, transcript
FT                   variant mCT22044"
FT                   /note="gene_id=mCG21358.2 transcript_id=mCT22044.1 created
FT                   on 05-SEP-2002"
FT   mRNA            join(<656649..656718,658057..658389,661156..661287,
FT                   661921..662254,663756..663868,665544..665596,
FT                   668539..668658,669160..669753)
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /product="CD300 antigen like family member G, transcript
FT                   variant mCT193270"
FT                   /note="gene_id=mCG21358.2 transcript_id=mCT193270.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<656649..656718,658057..658389,661156..661287,
FT                   661921..662254,663756..663868,665544..665596,
FT                   668539..668658,669160..669279)
FT                   /codon_start=1
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /product="CD300 antigen like family member G, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21358.2 transcript_id=mCT193270.0
FT                   protein_id=mCP114230.0 isoform=CRA_b"
FT                   /protein_id="EDL34082.1"
FT                   /translation="RQLQCPAPTMRPLVLLWGCLVLPGYEALKGPKEISGFEGDTVSLR
FT                   CTYVEKMKEHRKYWCRQGGILVSRCGDIVYANQDQEVTRGRMSIRDSPQELSMTVIMRD
FT                   LTLKDSGKYWCGIDRLGRDESFEVTLIVFPGKRDNAVPAGTCCPSSPTPSFQPLTPTRS
FT                   LQPKAKAWQTQLPEPTSPGLHPTVVTAKQGKTGVKAPVFTEAAPAWSTGTSQVPPGISP
FT                   YAGSSPHTATPARSAGTSQVPPGISPYAGRSPHTATSPHAGSSRPVVWLPLTTPQDSRA
FT                   VASSVSKPSVSIPMVRMMAPVLILLSLLLAAGLIAFGSHMLRWRKKAWLATETQKNEKV
FT                   YLETSLPGNGWTTEDSTIDLAVTPECLRNLNPSAVPSPETQNLSQSTEEEEAARSLDDD
FT                   KEDVMAPPPLQMSAEELAFSEFISV"
FT   CDS             join(656676..656718,658057..658389,662173..662254,
FT                   663756..663868,665544..665596,668539..668658,
FT                   669160..669279)
FT                   /codon_start=1
FT                   /gene="Cd300lg"
FT                   /locus_tag="mCG_21358"
FT                   /product="CD300 antigen like family member G, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG21358.2 transcript_id=mCT22044.1
FT                   protein_id=mCP23586.2 isoform=CRA_c"
FT                   /protein_id="EDL34083.1"
FT                   /translation="MRPLVLLWGCLVLPGYEALKGPKEISGFEGDTVSLRCTYVEKMKE
FT                   HRKYWCRQGGILVSRCGDIVYANQDQEVTRGRMSIRDSPQELSMTVIMRDLTLKDSGKY
FT                   WCGIDRLGRDESFEVTLIVFPGSSRPVVWLPLTTPQDSRAVASSVSKPSVSIPMVRMMA
FT                   PVLILLSLLLAAGLIAFGSHMLRWRKKAWLATETQKNEKVYLETSLPGNGWTTEDSTID
FT                   LAVTPECLRNLNPSAVPSPETQNLSQSTEEEEAARSLDDDKEDVMAPPPLQMSAEELAF
FT                   SEFISV"
FT   gene            complement(672059..704152)
FT                   /gene="Mpp2"
FT                   /locus_tag="mCG_21348"
FT                   /note="gene_id=mCG21348.2"
FT   mRNA            complement(join(672059..674542,675470..675598,
FT                   675816..676018,676545..676706,676952..677020,
FT                   677106..677211,677302..677433,678239..678466,
FT                   679345..679494,679620..679772,696305..696423,
FT                   700954..701016,704059..704152))
FT                   /gene="Mpp2"
FT                   /locus_tag="mCG_21348"
FT                   /product="membrane protein, palmitoylated 2 (MAGUK p55
FT                   subfamily member 2), transcript variant mCT21545"
FT                   /note="gene_id=mCG21348.2 transcript_id=mCT21545.2 created
FT                   on 16-JUL-2002"
FT   mRNA            complement(join(672062..674542,675470..675598,
FT                   675816..676018,676545..676706,676952..677020,
FT                   677106..677211,677302..677433,678239..678466,
FT                   679345..679494,679620..679772,696305..696423,
FT                   700954..701016,703780..703917,704059..704152))
FT                   /gene="Mpp2"
FT                   /locus_tag="mCG_21348"
FT                   /product="membrane protein, palmitoylated 2 (MAGUK p55
FT                   subfamily member 2), transcript variant mCT170720"
FT                   /note="gene_id=mCG21348.2 transcript_id=mCT170720.0 created
FT                   on 16-JUL-2002"
FT   CDS             complement(join(674366..674542,675470..675598,
FT                   675816..676018,676545..676706,676952..677020,
FT                   677106..677211,677302..677433,678239..678466,
FT                   679345..679494,679620..679772,696305..696423,
FT                   700954..700984))
FT                   /codon_start=1
FT                   /gene="Mpp2"
FT                   /locus_tag="mCG_21348"
FT                   /product="membrane protein, palmitoylated 2 (MAGUK p55
FT                   subfamily member 2), isoform CRA_a"
FT                   /note="gene_id=mCG21348.2 transcript_id=mCT170720.0
FT                   protein_id=mCP93638.0 isoform=CRA_a"
FT                   /protein_id="EDL34084.1"
FT                   /translation="MPVAATNSESAMQQVLDNLGSLPNATGAAELDLIFLRGIMESPIV
FT                   RSLAKAHERLEETKLEAVRDNNLELVQEILRDLAELAEQSSTAAELARILQEPHFQSLL
FT                   ETHDSVASKTYETPPPSPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGGELV
FT                   IARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRSASGSVILKILPSYQEP
FT                   HLPRQVFVKCHFDYDPARDSLSPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEGGSAG
FT                   LIPSQLLEEKRKAFVKRDLELTPTSGTLCGSLSGKKKKRMMYLTTKNAEFDRHELLIYE
FT                   EVARMPPFRRKTLVLIGAQGVGRRSLKNKLILWDPDRYGTTVPYTSRRPKDSEREGQGY
FT                   SFVSRGEMEADIRAGRYLEHGEYEGNLYGTRIDSIRGVVASGKVCVLDVNPQAVKVLRT
FT                   AEFVPYVVFIEAPDYETLRAMNRAALESGVSTKQLTEADLRRTVEESSRIQRGYGHYFD
FT                   LSLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY"
FT   CDS             complement(join(674366..674542,675470..675598,
FT                   675816..676018,676545..676706,676952..677020,
FT                   677106..677211,677302..677433,678239..678466,
FT                   679345..679494,679620..679772,696305..696423,
FT                   700954..700984))
FT                   /codon_start=1
FT                   /gene="Mpp2"
FT                   /locus_tag="mCG_21348"
FT                   /product="membrane protein, palmitoylated 2 (MAGUK p55
FT                   subfamily member 2), isoform CRA_a"
FT                   /note="gene_id=mCG21348.2 transcript_id=mCT21545.2
FT                   protein_id=mCP23419.2 isoform=CRA_a"
FT                   /protein_id="EDL34085.1"
FT                   /translation="MPVAATNSESAMQQVLDNLGSLPNATGAAELDLIFLRGIMESPIV
FT                   RSLAKAHERLEETKLEAVRDNNLELVQEILRDLAELAEQSSTAAELARILQEPHFQSLL
FT                   ETHDSVASKTYETPPPSPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGGELV
FT                   IARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRSASGSVILKILPSYQEP
FT                   HLPRQVFVKCHFDYDPARDSLSPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEGGSAG
FT                   LIPSQLLEEKRKAFVKRDLELTPTSGTLCGSLSGKKKKRMMYLTTKNAEFDRHELLIYE
FT                   EVARMPPFRRKTLVLIGAQGVGRRSLKNKLILWDPDRYGTTVPYTSRRPKDSEREGQGY
FT                   SFVSRGEMEADIRAGRYLEHGEYEGNLYGTRIDSIRGVVASGKVCVLDVNPQAVKVLRT
FT                   AEFVPYVVFIEAPDYETLRAMNRAALESGVSTKQLTEADLRRTVEESSRIQRGYGHYFD
FT                   LSLVNSNLERTFRELQTAMEKLRTEPQWVPVSWVY"
FT   assembly_gap    685722..685741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    709072..709211
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            complement(715663..717059)
FT                   /gene="Ppy"
FT                   /locus_tag="mCG_21350"
FT                   /note="gene_id=mCG21350.2"
FT   mRNA            complement(join(715663..715799,715899..716016,
FT                   716280..716470,717025..717059))
FT                   /gene="Ppy"
FT                   /locus_tag="mCG_21350"
FT                   /product="pancreatic polypeptide"
FT                   /note="gene_id=mCG21350.2 transcript_id=mCT21547.2 created
FT                   on 16-JUL-2002"
FT   CDS             complement(join(715905..716016,716280..716470))
FT                   /codon_start=1
FT                   /gene="Ppy"
FT                   /locus_tag="mCG_21350"
FT                   /product="pancreatic polypeptide"
FT                   /note="gene_id=mCG21350.2 transcript_id=mCT21547.2
FT                   protein_id=mCP23441.2"
FT                   /db_xref="GOA:Q496X5"
FT                   /db_xref="InterPro:IPR001955"
FT                   /db_xref="InterPro:IPR015480"
FT                   /db_xref="InterPro:IPR020392"
FT                   /db_xref="MGI:MGI:97753"
FT                   /db_xref="UniProtKB/TrEMBL:Q496X5"
FT                   /protein_id="EDL34086.1"
FT                   /translation="MAVAYCCLSLFLVSTWVALLLQPLQGTWGAPLEPMYPGDYATPEQ
FT                   MAQYETQLRRYINTLTRPRYGKRAEEENTGGLPGVQLSPCTSPPVGLIPCSAPWS"
FT   gene            complement(722425..723581)
FT                   /gene="Pyy"
FT                   /locus_tag="mCG_21368"
FT                   /note="gene_id=mCG21368.1"
FT   mRNA            complement(join(722425..722616,722723..722806,
FT                   722915..723102,723491..723581))
FT                   /gene="Pyy"
FT                   /locus_tag="mCG_21368"
FT                   /product="peptide YY, transcript variant mCT22053"
FT                   /note="gene_id=mCG21368.1 transcript_id=mCT22053.1 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(722430..722616,722717..722806,
FT                   722915..723102,723491..723571))
FT                   /gene="Pyy"
FT                   /locus_tag="mCG_21368"
FT                   /product="peptide YY, transcript variant mCT172782"
FT                   /note="gene_id=mCG21368.1 transcript_id=mCT172782.0 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(722592..722616,722723..722806,
FT                   722915..723102))
FT                   /codon_start=1
FT                   /gene="Pyy"
FT                   /locus_tag="mCG_21368"
FT                   /product="peptide YY, isoform CRA_b"
FT                   /note="gene_id=mCG21368.1 transcript_id=mCT22053.1
FT                   protein_id=mCP23391.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V334"
FT                   /db_xref="InterPro:IPR001955"
FT                   /db_xref="InterPro:IPR020392"
FT                   /db_xref="MGI:MGI:99924"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V334"
FT                   /protein_id="EDL34088.1"
FT                   /translation="MVAVRRPWPVTVAMLLILLACLGALVDAYPAKPEAPGEDASPEEL
FT                   SRYYASLRHYLNLVTRQRYGKRDVPAALFSKLLFTDDSDSENLPFRPEGLDQW"
FT   CDS             complement(join(722592..722616,722717..722806,
FT                   722915..723102))
FT                   /codon_start=1
FT                   /gene="Pyy"
FT                   /locus_tag="mCG_21368"
FT                   /product="peptide YY, isoform CRA_a"
FT                   /note="gene_id=mCG21368.1 transcript_id=mCT172782.0
FT                   protein_id=mCP95701.0 isoform=CRA_a"
FT                   /db_xref="GOA:H3BK86"
FT                   /db_xref="InterPro:IPR001955"
FT                   /db_xref="InterPro:IPR020392"
FT                   /db_xref="MGI:MGI:99924"
FT                   /db_xref="UniProtKB/TrEMBL:H3BK86"
FT                   /protein_id="EDL34087.1"
FT                   /translation="MVAVRRPWPVTVAMLLILLACLGALVDAYPAKPEAPGEDASPEEL
FT                   SRYYASLRHYLNLVTRQRYGKRDVPAALFSKLLFTDDSDSENLPFRSRPEGLDQW"
FT   gene            739807..740418
FT                   /locus_tag="mCG_141025"
FT                   /note="gene_id=mCG141025.0"
FT   mRNA            739807..740418
FT                   /locus_tag="mCG_141025"
FT                   /product="mCG141025"
FT                   /note="gene_id=mCG141025.0 transcript_id=mCT172754.0
FT                   created on 05-SEP-2002"
FT   CDS             739835..740401
FT                   /codon_start=1
FT                   /locus_tag="mCG_141025"
FT                   /product="mCG141025"
FT                   /note="gene_id=mCG141025.0 transcript_id=mCT172754.0
FT                   protein_id=mCP95673.0"
FT                   /protein_id="EDL34089.1"
FT                   /translation="MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQ
FT                   FCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRH
FT                   SAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIEFQAPLGKR
FT                   VQAWTHSLTCPALTGILALILMPTE"
FT   assembly_gap    747719..747738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <761102..765116
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /note="gene_id=mCG21373.1"
FT   mRNA            join(761102..761580,762079..762353,762452..762665,
FT                   762953..763133,763399..763570,763681..763863,
FT                   764507..765116)
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /product="N-acetylglutamate synthase, transcript variant
FT                   mCT22059"
FT                   /note="gene_id=mCG21373.1 transcript_id=mCT22059.1 created
FT                   on 05-SEP-2002"
FT   mRNA            join(<761102..761580,762079..763570,763681..763863,
FT                   764507..765065)
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /product="N-acetylglutamate synthase, transcript variant
FT                   mCT193211"
FT                   /note="gene_id=mCG21373.1 transcript_id=mCT193211.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<761104..761580,762079..762582)
FT                   /codon_start=1
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /product="N-acetylglutamate synthase, isoform CRA_a"
FT                   /note="gene_id=mCG21373.1 transcript_id=mCT193211.0
FT                   protein_id=mCP114169.0 isoform=CRA_a"
FT                   /protein_id="EDL34090.1"
FT                   /translation="TPSAVRSRATVTCGWGGRVGLVVVMATAWVATALRSAAAARRLRS
FT                   PGGPGGSRRLSGSARRRGAKSASPGRRLSTARAHAEDAEGAKGRVQSPAVEEPSWTPLP
FT                   TPLESPAPPAGRSLVQRDIQAFLNQCGASPGEARHWLTQFQTCYHSVDKPFAVMEVDEE
FT                   VIRCPQAVSRLAFALAFLQRMDMKPLVVLGLPTPTAPSGCLSFWEAKAQLAQSCKVLVD
FT                   ELRHNAATAVPFFGGGSVLSAAEPAPHARLVSTQPAPASSERADHSAGPALVPLKHHIW
FT                   PTATVASSRWRQTCCSGVWNPTASPSCAPLGKRLRAVPCSLTRWR"
FT   CDS             join(761176..761580,762079..762353,762452..762665,
FT                   762953..763133,763399..763570,763681..763863,
FT                   764507..764660)
FT                   /codon_start=1
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /product="N-acetylglutamate synthase, isoform CRA_b"
FT                   /note="gene_id=mCG21373.1 transcript_id=mCT22059.1
FT                   protein_id=mCP23454.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8R4H7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011243"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="MGI:MGI:2387600"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R4H7"
FT                   /protein_id="EDL34091.1"
FT                   /translation="MATAWVATALRSAAAARRLRSPGGPGGSRRLSGSARRRGAKSASP
FT                   GRRLSTARAHAEDAEGAKGRVQSPAVEEPSWTPLPTPLESPAPPAGRSLVQRDIQAFLN
FT                   QCGASPGEARHWLTQFQTCYHSVDKPFAVMEVDEEVIRCPQAVSRLAFALAFLQRMDMK
FT                   PLVVLGLPTPTAPSGCLSFWEAKAQLAQSCKVLVDELRHNAATAVPFFGGGSVLSAAEP
FT                   APHASYGGIVAVETDLLQWCLESNSIPILCPIGETAARRSVLLDSLEVTASLAKALQPT
FT                   KIIFLNNSGGLRNNSQKILSNVNLPADLDLVTNAEWLSIKERQQIRLIVDVLSRLPHYS
FT                   SAVITAASTLLTELFSNKGCGTLFKNAERMLRVRNLDSLDQGRLVNLVNASFGKKLRED
FT                   YLESLRPRLHSIYVSEGYNAAAILTVEPVLGGTPYLDKFVVSSSRQGQGSGQMLWECLR
FT                   RDLQTLFWRSRVTNPINPWYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDS
FT                   FCKPASDPGS"
FT   mRNA            join(761953..762353,762452..762665,762953..763133,
FT                   763399..763570,763681..763863,764507..765065)
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /product="N-acetylglutamate synthase, transcript variant
FT                   mCT172786"
FT                   /note="gene_id=mCG21373.1 transcript_id=mCT172786.0 created
FT                   on 05-SEP-2002"
FT   CDS             join(762151..762353,762452..762665,762953..763133,
FT                   763399..763570,763681..763863,764507..764660)
FT                   /codon_start=1
FT                   /gene="Nags"
FT                   /locus_tag="mCG_21373"
FT                   /product="N-acetylglutamate synthase, isoform CRA_c"
FT                   /note="gene_id=mCG21373.1 transcript_id=mCT172786.0
FT                   protein_id=mCP95705.0 isoform=CRA_c"
FT                   /protein_id="EDL34092.1"
FT                   /translation="MDMKPLVVLGLPTPTAPSGCLSFWEAKAQLAQSCKVLVDELRHNA
FT                   ATAVPFFGGGSVLSAAEPAPHASYGGIVAVETDLLQWCLESNSIPILCPIGETAARRSV
FT                   LLDSLEVTASLAKALQPTKIIFLNNSGGLRNNSQKILSNVNLPADLDLVTNAEWLSIKE
FT                   RQQIRLIVDVLSRLPHYSSAVITAASTLLTELFSNKGCGTLFKNAERMLRVRNLDSLDQ
FT                   GRLVNLVNASFGKKLREDYLESLRPRLHSIYVSEGYNAAAILTVEPVLGGTPYLDKFVV
FT                   SSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSDGSFSNKQWIFFWFGLA
FT                   DIRDSYELVNHAKGLPDSFCKPASDPGS"
FT   gene            complement(768142..771954)
FT                   /gene="Tmem101"
FT                   /locus_tag="mCG_21351"
FT                   /note="gene_id=mCG21351.1"
FT   mRNA            complement(join(768142..769188,770151..770297,
FT                   771318..771498,771802..771954))
FT                   /gene="Tmem101"
FT                   /locus_tag="mCG_21351"
FT                   /product="transmembrane protein 101"
FT                   /note="gene_id=mCG21351.1 transcript_id=mCT21548.1 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(768880..769188,770151..770297,
FT                   771318..771498,771802..771938))
FT                   /codon_start=1
FT                   /gene="Tmem101"
FT                   /locus_tag="mCG_21351"
FT                   /product="transmembrane protein 101"
FT                   /note="gene_id=mCG21351.1 transcript_id=mCT21548.1
FT                   protein_id=mCP23563.1"
FT                   /protein_id="EDL34093.1"
FT                   /translation="MASKIGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEAR
FT                   RKPDIPVPYLYFDMGAAVLCASFMSFGVKRRWFALGAALQLAISTYTAYIGGYVHYGDW
FT                   LKVRMYSRTVAIIGGFLVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSK
FT                   EDRLAYLNHLPGGELMVQLFFVLYGVLALAFLSGYYVTLAAQILAVLLPPVMLLIDGNV
FT                   SYWHNTRRVEFWNQMKLLGESVGIFGAAVILATDG"
FT   assembly_gap    773328..773433
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            complement(778160..800984)
FT                   /gene="2600001B17Rik"
FT                   /locus_tag="mCG_21364"
FT                   /note="gene_id=mCG21364.2"
FT   mRNA            complement(join(778160..779819,781012..781138,
FT                   782739..782848,798564..798697,800814..800983))
FT                   /gene="2600001B17Rik"
FT                   /locus_tag="mCG_21364"
FT                   /product="RIKEN cDNA 2600001B17, transcript variant
FT                   mCT22047"
FT                   /note="gene_id=mCG21364.2 transcript_id=mCT22047.2 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(778165..779819,780196..780288,
FT                   781012..781138,782739..782848,798564..798697,
FT                   800814..800984))
FT                   /gene="2600001B17Rik"
FT                   /locus_tag="mCG_21364"
FT                   /product="RIKEN cDNA 2600001B17, transcript variant
FT                   mCT172781"
FT                   /note="gene_id=mCG21364.2 transcript_id=mCT172781.0 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(779727..779819,781012..781138,
FT                   782739..782848,798564..798697,800814..800937))
FT                   /codon_start=1
FT                   /gene="2600001B17Rik"
FT                   /locus_tag="mCG_21364"
FT                   /product="RIKEN cDNA 2600001B17, isoform CRA_b"
FT                   /note="gene_id=mCG21364.2 transcript_id=mCT22047.2
FT                   protein_id=mCP23542.2 isoform=CRA_b"
FT                   /protein_id="EDL34095.1"
FT                   /translation="MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPS
FT                   SSGKPNHADILLINLQYVSEVEIINDRTETPPPLASLNVSKLASKARTEKEEKLSQAYA
FT                   ISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVMEEVVITPPYQVENCKGKEGSALSHVR
FT                   KIVEKHFRDVESQKILQRSQAQQPQKEAALSS"
FT   CDS             complement(join(780262..780288,781012..781138,
FT                   782739..782848,798564..798697,800814..800937))
FT                   /codon_start=1
FT                   /gene="2600001B17Rik"
FT                   /locus_tag="mCG_21364"
FT                   /product="RIKEN cDNA 2600001B17, isoform CRA_a"
FT                   /note="gene_id=mCG21364.2 transcript_id=mCT172781.0
FT                   protein_id=mCP95700.0 isoform=CRA_a"
FT                   /protein_id="EDL34094.1"
FT                   /translation="MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPS
FT                   SSGKPNHADILLINLQYVSEVEIINDRTETPPPLASLNVSKLASKARTEKEEKLSQAYA
FT                   ISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVMEEVVITPPYQVENCKGKEGSALSHVR
FT                   KIIGRRGLKR"
FT   assembly_gap    787015..787034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            805341..809801
FT                   /gene="G6pc3"
FT                   /locus_tag="mCG_21355"
FT                   /note="gene_id=mCG21355.1"
FT   mRNA            join(805341..805376,805595..805867,807752..807858,
FT                   808190..808280,808466..808584,808802..808943,
FT                   809160..809801)
FT                   /gene="G6pc3"
FT                   /locus_tag="mCG_21355"
FT                   /product="glucose 6 phosphatase, catalytic, 3, transcript
FT                   variant mCT22040"
FT                   /note="gene_id=mCG21355.1 transcript_id=mCT22040.1 created
FT                   on 05-SEP-2002"
FT   mRNA            join(805413..805867,807752..807858,808190..808280,
FT                   808466..808584,808802..808943,809160..809796)
FT                   /gene="G6pc3"
FT                   /locus_tag="mCG_21355"
FT                   /product="glucose 6 phosphatase, catalytic, 3, transcript
FT                   variant mCT172780"
FT                   /note="gene_id=mCG21355.1 transcript_id=mCT172780.0 created
FT                   on 05-SEP-2002"
FT   CDS             join(805650..805867,807752..807858,808190..808280,
FT                   808466..808584,808802..808943,809160..809523)
FT                   /codon_start=1
FT                   /gene="G6pc3"
FT                   /locus_tag="mCG_21355"
FT                   /product="glucose 6 phosphatase, catalytic, 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21355.1 transcript_id=mCT172780.0
FT                   protein_id=mCP95699.0 isoform=CRA_a"
FT                   /protein_id="EDL34096.1"
FT                   /translation="MESTLSAGIIMAEALQNRLPGLENMWLWVTFLGDPKNLFQFCFPA
FT                   AYYASRRLGISVLWITFIAEWLNLVFKWFLFGDRPFWWVHESGYSTQTPIQIHQFPSSC
FT                   ETGPGSPSGHCMITGAALWPVMTAISSQVASRSRSPWVRVIPGLAYCTFLLAVGLSRVF
FT                   LLAHFPHQVLGGLIVGAALGWLMSPRVPMERELSFYGLTALALMLGASLMYWTLFTLGL
FT                   DLSWSINLASKWCERPEWVHMDSRPFASLSRDSGSALGLGIALHTPCYAQIRRAHLGNG
FT                   QKIACFVLAMGLLVFLEWLGYPPQISLFYIFNFLKYTLWPCLVLALVPWVVHTLSDQEA
FT                   PPIRSS"
FT   CDS             join(805650..805867,807752..807858,808190..808280,
FT                   808466..808584,808802..808943,809160..809523)
FT                   /codon_start=1
FT                   /gene="G6pc3"
FT                   /locus_tag="mCG_21355"
FT                   /product="glucose 6 phosphatase, catalytic, 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21355.1 transcript_id=mCT22040.1
FT                   protein_id=mCP23580.1 isoform=CRA_a"
FT                   /protein_id="EDL34097.1"
FT                   /translation="MESTLSAGIIMAEALQNRLPGLENMWLWVTFLGDPKNLFQFCFPA
FT                   AYYASRRLGISVLWITFIAEWLNLVFKWFLFGDRPFWWVHESGYSTQTPIQIHQFPSSC
FT                   ETGPGSPSGHCMITGAALWPVMTAISSQVASRSRSPWVRVIPGLAYCTFLLAVGLSRVF
FT                   LLAHFPHQVLGGLIVGAALGWLMSPRVPMERELSFYGLTALALMLGASLMYWTLFTLGL
FT                   DLSWSINLASKWCERPEWVHMDSRPFASLSRDSGSALGLGIALHTPCYAQIRRAHLGNG
FT                   QKIACFVLAMGLLVFLEWLGYPPQISLFYIFNFLKYTLWPCLVLALVPWVVHTLSDQEA
FT                   PPIRSS"
FT   gene            complement(811459..846494)
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /note="gene_id=mCG140723.0"
FT   mRNA            complement(join(811459..811585,811669..811834,
FT                   811955..812039,812256..812389,812776..812894,
FT                   813056..813153,813383..813502,814514..814601,
FT                   814722..814777,815083..815190,815323..815372,
FT                   815656..815776,816087..816220,816920..817091,
FT                   817746..818030,818240..818451,820127..820349,
FT                   820528..820659,820980..821092,821181..821327,
FT                   821486..821616,822118..822232,822326..822470,
FT                   822576..822835,834081..834155,840399..840620,
FT                   846359..846494))
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /product="histone deacetylase 5, transcript variant
FT                   mCT171073"
FT                   /note="gene_id=mCG140723.0 transcript_id=mCT171073.0
FT                   created on 02-APR-2003"
FT   mRNA            complement(join(811466..811585,811665..811834,
FT                   811955..812039,812256..812389,812776..812894,
FT                   813056..813153,813383..813502,814514..814601,
FT                   814722..814777,815083..815190,815323..815372,
FT                   815656..815776,816087..816220,816920..817091,
FT                   817746..818030,818240..818451,820127..820349,
FT                   820528..820659,820980..821092,821181..821327,
FT                   821486..821616,822118..822232,822326..822470,
FT                   822576..822835,834081..834446,834810..834946,
FT                   837433..837516,840399..840620,846359..>846478))
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /product="histone deacetylase 5, transcript variant
FT                   mCT193221"
FT                   /note="gene_id=mCG140723.0 transcript_id=mCT193221.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(811466..811585,811669..811834,
FT                   811955..812039,812256..812389,812776..812894,
FT                   813056..813153,813383..813502,814514..814601,
FT                   814722..814777,815083..815190,815323..815372,
FT                   815656..815776,816087..816220,816920..817091,
FT                   817746..818030,818240..818451,820127..820349,
FT                   820528..820659,820980..821092,821181..821327,
FT                   821486..821616,822118..822232,822326..822470,
FT                   822576..822835,834081..834152,840399..840504))
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /product="histone deacetylase 5, transcript variant
FT                   mCT181660"
FT                   /note="gene_id=mCG140723.0 transcript_id=mCT181660.0
FT                   created on 02-APR-2003"
FT   CDS             complement(join(811546..811585,811669..811834,
FT                   811955..812039,812256..812389,812776..812894,
FT                   813056..813153,813383..813502,814514..814601,
FT                   814722..814777,815083..815190,815323..815372,
FT                   815656..815776,816087..816220,816920..817091,
FT                   817746..818030,818240..818451,820127..820349,
FT                   820528..820659,820980..821092,821181..821327,
FT                   821486..821616,822118..822232,822326..822470,
FT                   822576..822835,834081..834152,840399..840420))
FT                   /codon_start=1
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /product="histone deacetylase 5, isoform CRA_a"
FT                   /note="gene_id=mCG140723.0 transcript_id=mCT181660.0
FT                   protein_id=mCP104582.0 isoform=CRA_a"
FT                   /protein_id="EDL34098.1"
FT                   /translation="MNSPNESDGMSGREPSLEILPRTPLHSIPVAVEVKPVLPGAMPSS
FT                   MGGGGGGSPSPVELRGALAGPMDPALREQQLQQELLVLKQQQQLQKQLLFAEFQKQHDH
FT                   LTRQHEVQLQKHLKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEK
FT                   SKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGP
FT                   PGTPPSYKLPLLGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVI
FT                   STFKKRAVEITGTGPGVSSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMIPQH
FT                   RALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLR
FT                   QGGTLTGKFMSTSSIPGCLLGVALEGDTSPHGHASLLQHVLLLEQARQQSTLIAVPLHG
FT                   QSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQ
FT                   QQMQLGKILTKTGELSRQPTTHPEETEEELTEQQEALLGEGALTIPREGSTESESTQED
FT                   LEEEEEEEEEEEEEDCIQVKDEDGESGPDEGPDLEESSAGYKKLFADAQQLQPLQVYQA
FT                   PLSLATVPHQALGRTQSSPAAPGSMKSPTDQPTVVKHLFTTGVVYDTFMLKHQCMCGNT
FT                   HVHPEHAGRIQSIWSRLQETGLLGKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQ
FT                   KLDSKKLLGPISQKMYAMLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLVELAFKVAAGE
FT                   LKNGFAIIRPPGHHAEESTAMGFCFFNSVAITAKLLQQKLSVGKVLIVDWDIHHGNGTQ
FT                   QAFYNDPSVLYISLHRYDNGNFFPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEY
FT                   LTAFRTVVMPIAQEFSPDVVLVSAGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGG
FT                   RVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVLQQKPSVNAVATLEKVIEIQS
FT                   KHWSCVQRFAAGLGCSLREAQTGEKEEAETVSAMALLSVGAEQAQAVATQEHSPRPAEE
FT                   PMEQEPAL"
FT   CDS             complement(join(811546..811585,811669..811834,
FT                   811955..812039,812256..812389,812776..812894,
FT                   813056..813153,813383..813502,814514..814601,
FT                   814722..814777,815083..815190,815323..815372,
FT                   815656..815776,816087..816220,816920..817091,
FT                   817746..818030,818240..818451,820127..820349,
FT                   820528..820659,820980..821092,821181..821327,
FT                   821486..821616,822118..822232,822326..822470,
FT                   822576..822835,834081..834155,840399..840420))
FT                   /codon_start=1
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /product="histone deacetylase 5, isoform CRA_c"
FT                   /note="gene_id=mCG140723.0 transcript_id=mCT171073.0
FT                   protein_id=mCP93991.0 isoform=CRA_c"
FT                   /protein_id="EDL34100.1"
FT                   /translation="MNSPNESADGMSGREPSLEILPRTPLHSIPVAVEVKPVLPGAMPS
FT                   SMGGGGGGSPSPVELRGALAGPMDPALREQQLQQELLVLKQQQQLQKQLLFAEFQKQHD
FT                   HLTRQHEVQLQKHLKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKE
FT                   KSKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSG
FT                   PPGTPPSYKLPLLGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTV
FT                   ISTFKKRAVEITGTGPGVSSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMIPQ
FT                   HRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSL
FT                   RQGGTLTGKFMSTSSIPGCLLGVALEGDTSPHGHASLLQHVLLLEQARQQSTLIAVPLH
FT                   GQSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQK
FT                   QQQMQLGKILTKTGELSRQPTTHPEETEEELTEQQEALLGEGALTIPREGSTESESTQE
FT                   DLEEEEEEEEEEEEEDCIQVKDEDGESGPDEGPDLEESSAGYKKLFADAQQLQPLQVYQ
FT                   APLSLATVPHQALGRTQSSPAAPGSMKSPTDQPTVVKHLFTTGVVYDTFMLKHQCMCGN
FT                   THVHPEHAGRIQSIWSRLQETGLLGKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNR
FT                   QKLDSKKLLGPISQKMYAMLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLVELAFKVAAG
FT                   ELKNGFAIIRPPGHHAEESTAMGFCFFNSVAITAKLLQQKLSVGKVLIVDWDIHHGNGT
FT                   QQAFYNDPSVLYISLHRYDNGNFFPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVE
FT                   YLTAFRTVVMPIAQEFSPDVVLVSAGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAG
FT                   GRVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVLQQKPSVNAVATLEKVIEIQ
FT                   SKHWSCVQRFAAGLGCSLREAQTGEKEEAETVSAMALLSVGAEQAQAVATQEHSPRPAE
FT                   EPMEQEPAL"
FT   CDS             complement(join(811665..811834,811955..812039,
FT                   812256..812389,812776..812894,813056..813153,
FT                   813383..813502,814514..814601,814722..814777,
FT                   815083..815190,815323..815372,815656..815776,
FT                   816087..816220,816920..817091,817746..818030,
FT                   818240..818451,820127..820349,820528..820659,
FT                   820980..821092,821181..821327,821486..821616,
FT                   822118..822232,822326..822470,822576..822835,
FT                   834081..>834396))
FT                   /codon_start=1
FT                   /gene="Hdac5"
FT                   /locus_tag="mCG_140723"
FT                   /product="histone deacetylase 5, isoform CRA_b"
FT                   /note="gene_id=mCG140723.0 transcript_id=mCT193221.0
FT                   protein_id=mCP114210.0 isoform=CRA_b"
FT                   /protein_id="EDL34099.1"
FT                   /translation="PPCVCCLRSAPRPDEVPPCLVGPSGSGLRESLSSQLAPLTTFSLT
FT                   GFRLGRPLPGMLLVPKAQGLVEMLQTIYETESCFSADGMSGREPSLEILPRTPLHSIPV
FT                   AVEVKPVLPGAMPSSMGGGGGGSPSPVELRGALAGPMDPALREQQLQQELLVLKQQQQL
FT                   QKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQQEMLAAKRQQELEQQRQREQQRQEELEK
FT                   QRLEQQLLILRNKEKSKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGA
FT                   HHASLDQSSPPQSGPPGTPPSYKLPLLGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAE
FT                   RRSSPLLRRKDGTVISTFKKRAVEITGTGPGVSSVCNSAPGSGPSSPNSSHSTIAENGF
FT                   TGSVPNIPTEMIPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKL
FT                   STQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDTSPHGHASLLQHVLLLE
FT                   QARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQL
FT                   VMQQQHQQFLEKQKQQQMQLGKILTKTGELSRQPTTHPEETEEELTEQQEALLGEGALT
FT                   IPREGSTESESTQEDLEEEEEEEEEEEEEDCIQVKDEDGESGPDEGPDLEESSAGYKKL
FT                   FADAQQLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGSMKSPTDQPTVVKHLFTTGVV
FT                   YDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQETGLLGKCERIRGRKATLDEIQTVHS
FT                   EYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAMLPCGGIGVDSDTVWNEMHSSSAVRMA
FT                   VGCLVELAFKVAAGELKNGFAIIRPPGHHAEESTAMGFCFFNSVAITAKLLQQKLSVGK
FT                   VLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNFFPGSGAPEEVGGGPGVGYNVNV
FT                   AWTGGVDPPIGDVEYLTAFRTVVMPIAQEFSPDVVLVSAGFDAVEGHLSPLGGYSVTAR
FT                   CFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVLQQKPS
FT                   VNAVATLEKVIEIQSKHWSCVQRFAAGLGCSLREAQTGEKEEAETVSAMALLSVGAEQA
FT                   QAVATQEHSPR"
FT   assembly_gap    815199..815314
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    846214..846233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    860678..860697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <865566..881887
FT                   /gene="BC030867"
FT                   /locus_tag="mCG_122973"
FT                   /note="gene_id=mCG122973.1"
FT   mRNA            join(<865566..865775,867362..867412,871641..872708,
FT                   874574..874657,876006..876146,876520..876628,
FT                   876765..876850,877177..877302,878869..878986,
FT                   880620..880885,881334..881887)
FT                   /gene="BC030867"
FT                   /locus_tag="mCG_122973"
FT                   /product="cDNA sequence BC030867, transcript variant
FT                   mCT193196"
FT                   /note="gene_id=mCG122973.1 transcript_id=mCT193196.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(865583..865775,867362..867412,871641..872708,
FT                   874574..874657,876006..876146,876520..876628,
FT                   876765..876850,877177..877302,878869..878986,
FT                   881334..881887)
FT                   /gene="BC030867"
FT                   /locus_tag="mCG_122973"
FT                   /product="cDNA sequence BC030867, transcript variant
FT                   mCT124199"
FT                   /note="gene_id=mCG122973.1 transcript_id=mCT124199.0
FT                   created on 05-SEP-2002"
FT   CDS             join(<865680..865775,867362..867412,871641..872708,
FT                   874574..874657,876006..876146,876520..876628,
FT                   876765..876850,877177..877302,878869..878986,
FT                   880620..880648)
FT                   /codon_start=1
FT                   /gene="BC030867"
FT                   /locus_tag="mCG_122973"
FT                   /product="cDNA sequence BC030867, isoform CRA_b"
FT                   /note="gene_id=mCG122973.1 transcript_id=mCT193196.0
FT                   protein_id=mCP114140.0 isoform=CRA_b"
FT                   /protein_id="EDL34102.1"
FT                   /translation="FPTLRLGRVGGEPLSLTRPGRPAGPSPRPVVMTCGFQKLFSVEED
FT                   FEDEDFLSALENAENHVVSALPRDAGCLRPVSSRPQETVQTQSSRPVPSYPTSNQSVPR
FT                   LCLPPSSMRENAKAPLSTGVMSLRPASISSSSLSSQQRMTGAKVFQESSGPQPSAAHSG
FT                   YIFESHQQGIGDFEAPDQDDLDKALASMEFEGAGLELEADSGATQILPAKHCEDPVLAK
FT                   KARVADLSGSLRKEPMVHCRNPWPSLRPTSATGSLPVPATSCVSTSQQRGSPAPAPQYL
FT                   PVAGRTIRSSPQNYGPGQPLQSPRAWSSGKPRFSGPQRPHGSSAAFCQGPLSSRAPVSS
FT                   VESPVSTPRNTSTPVTQPALQTPVVTNHLVQLVTATNRTPQQPSRPSIRAKTRRFPGPA
FT                   GLLPHQHSGENLEEIMVSTPQTPTHGALAKFQTEIATSSQGSVEEDFGQGPWLTMKSAL
FT                   GLDEGDPTCFLYTYSIVMVLRKAALKQLPRNKVPNMAVMIKSLTRSTMDASVVFKDPTG
FT                   EMLGTVHRVLLETHQSELRPGSVLLLKQIGVFSPSLRNHYLNVTPNNLVHIYSLDSGDG
FT                   DFLEPPQPLPKDLGNSHGSLQPDVAAEPTRGLRTAQNPAVAFPEEELSEAGGRPAMTPV
FT                   "
FT   CDS             join(865773..865775,867362..867412,871641..872708,
FT                   874574..874657,876006..876146,876520..876628,
FT                   876765..876850,877177..877302,878869..878986,
FT                   881334..881395)
FT                   /codon_start=1
FT                   /gene="BC030867"
FT                   /locus_tag="mCG_122973"
FT                   /product="cDNA sequence BC030867, isoform CRA_a"
FT                   /note="gene_id=mCG122973.1 transcript_id=mCT124199.0
FT                   protein_id=mCP74967.1 isoform=CRA_a"
FT                   /protein_id="EDL34101.1"
FT                   /translation="MTCGFQKLFSVEEDFEDEDFLSALENAENHVVSALPRDAGCLRPV
FT                   SSRPQETVQTQSSRPVPSYPTSNQSVPRLCLPPSSMRENAKAPLSTGVMSLRPASISSS
FT                   SLSSQQRMTGAKVFQESSGPQPSAAHSGYIFESHQQGIGDFEAPDQDDLDKALASMEFE
FT                   GAGLELEADSGATQILPAKHCEDPVLAKKARVADLSGSLRKEPMVHCRNPWPSLRPTSA
FT                   TGSLPVPATSCVSTSQQRGSPAPAPQYLPVAGRTIRSSPQNYGPGQPLQSPRAWSSGKP
FT                   RFSGPQRPHGSSAAFCQGPLSSRAPVSSVESPVSTPRNTSTPVTQPALQTPVVTNHLVQ
FT                   LVTATNRTPQQPSRPSIRAKTRRFPGPAGLLPHQHSGENLEEIMVSTPQTPTHGALAKF
FT                   QTEIATSSQGSVEEDFGQGPWLTMKSALGLDEGDPTCFLYTYSIVMVLRKAALKQLPRN
FT                   KVPNMAVMIKSLTRSTMDASVVFKDPTGEMLGTVHRVLLETHQSELRPGSVLLLKQIGV
FT                   FSPSLRNHYLNVTPNNLVHIYSLDSGDGDFLEPPQPLPKDLGNSHGSLQPDVAAEPTRG
FT                   LRTAQNPAVAFPEEELSEADDLDGLLSELPEDFFCEPSS"
FT   gene            <885521..894809
FT                   /gene="Asb16"
FT                   /locus_tag="mCG_49416"
FT                   /note="gene_id=mCG49416.2"
FT   mRNA            join(<885521..885821,889183..889450,893085..893577,
FT                   893884..893997,894584..894809)
FT                   /gene="Asb16"
FT                   /locus_tag="mCG_49416"
FT                   /product="ankyrin repeat and SOCS box-containing 16"
FT                   /note="gene_id=mCG49416.2 transcript_id=mCT49599.2 created
FT                   on 05-SEP-2002"
FT   CDS             join(885521..885821,889183..889450,893085..893577,
FT                   893884..893997,894584..894769)
FT                   /codon_start=1
FT                   /gene="Asb16"
FT                   /locus_tag="mCG_49416"
FT                   /product="ankyrin repeat and SOCS box-containing 16"
FT                   /note="gene_id=mCG49416.2 transcript_id=mCT49599.2
FT                   protein_id=mCP42946.2"
FT                   /protein_id="EDL34103.1"
FT                   /translation="MAGESFPFTSSTLRALRLQREWLDWEDRRRAAAQQCRRHRDLPCP
FT                   QAQLLRPRRSCRDPAVHNALFSGDLQQLQILFQDEDAANMIVETVSNQLAWSAEQGFWV
FT                   LTPKTKQTAPLTIAVARGYTDCARHLILQGAELDARIGGRAALHEACAQAHPDCVRLLL
FT                   TFGAKANVSSEEGMTPLHLCTSPESLQCAKLLLEAGASVNVASQESEVTPLHVAAARGL
FT                   EQHVALYLQNGADVALRTSQGETALNAACAGAEGPGSSRQHEAAARQLLEAGADPQAAG
FT                   RKRHTPLHNACANGCGGLAELLLRHGASPGVTNGAGHTPMDCALQAVQDAPNWEPEVLF
FT                   AALLDYGAQPVHPEMLKHCANFPRALEVLLNAYPCVPSCDPWVEAVLPELWQEHEAFYS
FT                   SALSMENQPRQLQHLARLAVRAQLGSHCRQAAAQLPLPPLLRDYLLLGVEGRIQ"
FT   assembly_gap    897807..897911
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            901646..905932
FT                   /locus_tag="mCG_21372"
FT                   /note="gene_id=mCG21372.3"
FT   mRNA            join(901646..901787,902363..902417,904005..904568,
FT                   904773..905930)
FT                   /locus_tag="mCG_21372"
FT                   /product="mCG21372, transcript variant mCT22058"
FT                   /note="gene_id=mCG21372.3 transcript_id=mCT22058.2 created
FT                   on 05-SEP-2002"
FT   mRNA            join(<901684..901787,904005..904568,904773..905932)
FT                   /locus_tag="mCG_21372"
FT                   /product="mCG21372, transcript variant mCT193207"
FT                   /note="gene_id=mCG21372.3 transcript_id=mCT193207.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<901684..901787,904005..904568,904773..905133)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21372"
FT                   /product="mCG21372, isoform CRA_b"
FT                   /note="gene_id=mCG21372.3 transcript_id=mCT193207.0
FT                   protein_id=mCP114168.0 isoform=CRA_b"
FT                   /protein_id="EDL34105.1"
FT                   /translation="PGQNPELPAPPLTPTERELQRLSWRSQNIYPGFVSVDPVSSQAME
FT                   LSDVTLIEGVGNEVMVVAGVVALTLALVLAWLSTYVADSGNNQLLGTIVSAGDTSVLHL
FT                   GHVDQLVNQGTPEPTEHPHPSGGNDDKAEETSDSGGDATGEPGARGEMEPSLEHLLDIQ
FT                   GLPKRQAGLGSSRPEAPLGLDDGSCLSPSPSLINVRLKFLNDTEELAVARPEDTVGTLK
FT                   SKYFPGQENQMKLIYQGRLLQDPARTLSSLNITNNCVIHCHRSPPGAAVSGPSASLTPT
FT                   TEQSSLGVNVGSLMVPVFVVLLGVVWYFRINYRQFFTGPATISLVGVTVFFSILVFGMY
FT                   GR"
FT   mRNA            join(901713..902417,904005..904568,904773..905882)
FT                   /locus_tag="mCG_21372"
FT                   /product="mCG21372, transcript variant mCT172785"
FT                   /note="gene_id=mCG21372.3 transcript_id=mCT172785.0 created
FT                   on 05-SEP-2002"
FT   CDS             join(902383..902417,904005..904568,904773..905133)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21372"
FT                   /product="mCG21372, isoform CRA_a"
FT                   /note="gene_id=mCG21372.3 transcript_id=mCT172785.0
FT                   protein_id=mCP95704.0 isoform=CRA_a"
FT                   /protein_id="EDL34104.1"
FT                   /translation="MISRLLQNNLMSVDPVSSQAMELSDVTLIEGVGNEVMVVAGVVAL
FT                   TLALVLAWLSTYVADSGNNQLLGTIVSAGDTSVLHLGHVDQLVNQGTPEPTEHPHPSGG
FT                   NDDKAEETSDSGGDATGEPGARGEMEPSLEHLLDIQGLPKRQAGLGSSRPEAPLGLDDG
FT                   SCLSPSPSLINVRLKFLNDTEELAVARPEDTVGTLKSKYFPGQENQMKLIYQGRLLQDP
FT                   ARTLSSLNITNNCVIHCHRSPPGAAVSGPSASLTPTTEQSSLGVNVGSLMVPVFVVLLG
FT                   VVWYFRINYRQFFTGPATISLVGVTVFFSILVFGMYGR"
FT   CDS             join(902383..902417,904005..904568,904773..905133)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21372"
FT                   /product="mCG21372, isoform CRA_a"
FT                   /note="gene_id=mCG21372.3 transcript_id=mCT22058.2
FT                   protein_id=mCP23453.2 isoform=CRA_a"
FT                   /protein_id="EDL34106.1"
FT                   /translation="MISRLLQNNLMSVDPVSSQAMELSDVTLIEGVGNEVMVVAGVVAL
FT                   TLALVLAWLSTYVADSGNNQLLGTIVSAGDTSVLHLGHVDQLVNQGTPEPTEHPHPSGG
FT                   NDDKAEETSDSGGDATGEPGARGEMEPSLEHLLDIQGLPKRQAGLGSSRPEAPLGLDDG
FT                   SCLSPSPSLINVRLKFLNDTEELAVARPEDTVGTLKSKYFPGQENQMKLIYQGRLLQDP
FT                   ARTLSSLNITNNCVIHCHRSPPGAAVSGPSASLTPTTEQSSLGVNVGSLMVPVFVVLLG
FT                   VVWYFRINYRQFFTGPATISLVGVTVFFSILVFGMYGR"
FT   gene            complement(907157..911762)
FT                   /locus_tag="mCG_21369"
FT                   /note="gene_id=mCG21369.2"
FT   mRNA            complement(join(907157..908500,908595..908752,
FT                   908833..908904,909139..909182,909402..909470,
FT                   909764..909792,909973..910018,910343..910365,
FT                   910541..910638,910831..911002,911207..911339,
FT                   911646..911762))
FT                   /locus_tag="mCG_21369"
FT                   /product="mCG21369, transcript variant mCT172784"
FT                   /note="gene_id=mCG21369.2 transcript_id=mCT172784.0 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(907157..908500,908595..908752,
FT                   908833..908904,909139..909182,909402..909470,
FT                   909764..909849,909973..910018,910343..910365,
FT                   910541..910638,910831..911002,911207..911339,
FT                   911646..911760))
FT                   /locus_tag="mCG_21369"
FT                   /product="mCG21369, transcript variant mCT172783"
FT                   /note="gene_id=mCG21369.2 transcript_id=mCT172783.0 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(907157..908500,908595..908752,
FT                   908833..908904,909139..909182,909402..909470,
FT                   909764..909792,909973..910039,910343..910365,
FT                   910541..910638,910831..911002,911207..911339,
FT                   911646..911756))
FT                   /locus_tag="mCG_21369"
FT                   /product="mCG21369, transcript variant mCT22054"
FT                   /note="gene_id=mCG21369.2 transcript_id=mCT22054.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(908352..908500,908595..908752,
FT                   908833..908904,909139..909182,909402..909470,
FT                   909764..909792,909973..910018,910343..910365,
FT                   910541..910638,910831..911002,911207..911339,
FT                   911646..911696))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21369"
FT                   /product="mCG21369, isoform CRA_a"
FT                   /note="gene_id=mCG21369.2 transcript_id=mCT172784.0
FT                   protein_id=mCP95702.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AWT3"
FT                   /db_xref="InterPro:IPR013243"
FT                   /db_xref="InterPro:IPR013246"
FT                   /db_xref="MGI:MGI:3036270"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2AWT3"
FT                   /protein_id="EDL34107.1"
FT                   /translation="MKMEEMSLSGLDNSKLEAIAQEIYADLVEDSCLGFCFEVHRAVKC
FT                   GYFFLDDTDPDSMKDFEIVDQPGLDIFGQVFNQWKSKECVCPNCSRSIAASRFAPHLEK
FT                   CLGMGRNSSRIANRRIANSNNMNKSESDQEDNDDINDNDWSYGSEKKAKKRKSDKNPNS
FT                   PRRSKSLKHKNGELSNSDPFKYSNSTGISYETLGPEELRSLLTTQCGVISEHTKKMCTR
FT                   SLRCPQHTDEQRRTVRIYFLGPSAVLPEVESSLDNDGFDMTDSQALISRLQWDGSSDLS
FT                   PSDSGSSKTSENQGWGLGTNSSESRKTKKKKSHLSLVGTASGLGSNKKKKPKPPAPPTP
FT                   SIYDDIN"
FT   CDS             complement(join(908352..908500,908595..908752,
FT                   908833..908904,909139..909182,909402..909470,
FT                   909764..909849,909973..910018,910343..910365,
FT                   910541..910638,910831..911002,911207..911339,
FT                   911646..911696))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21369"
FT                   /product="mCG21369, isoform CRA_b"
FT                   /note="gene_id=mCG21369.2 transcript_id=mCT172783.0
FT                   protein_id=mCP95703.0 isoform=CRA_b"
FT                   /protein_id="EDL34108.1"
FT                   /translation="MKMEEMSLSGLDNSKLEAIAQEIYADLVEDSCLGFCFEVHRAVKC
FT                   GYFFLDDTDPDSMKDFEIVDQPGLDIFGQVFNQWKSKECVCPNCSRSIAASRFAPHLEK
FT                   CLGMGRNSSRIANRRIANSNNMNKSESDQEDNDDINDNDWSYGSEKKAKKRKSDKNPNS
FT                   PRRSKSLKHKNGFSVCTSASNTLPLLFSSSGELSNSDPFKYSNSTGISYETLGPEELRS
FT                   LLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSAVLPEVESSLDNDGFDM
FT                   TDSQALISRLQWDGSSDLSPSDSGSSKTSENQGWGLGTNSSESRKTKKKKSHLSLVGTA
FT                   SGLGSNKKKKPKPPAPPTPSIYDDIN"
FT   CDS             complement(join(908352..908500,908595..908752,
FT                   908833..908904,909139..909182,909402..909470,
FT                   909764..909792,909973..910039,910343..910365,
FT                   910541..910638,910831..911002,911207..911339,
FT                   911646..911696))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21369"
FT                   /product="mCG21369, isoform CRA_c"
FT                   /note="gene_id=mCG21369.2 transcript_id=mCT22054.2
FT                   protein_id=mCP23404.2 isoform=CRA_c"
FT                   /protein_id="EDL34109.1"
FT                   /translation="MKMEEMSLSGLDNSKLEAIAQEIYADLVEDSCLGFCFEVHRAVKC
FT                   GYFFLDDTDPDSMKDFEIVDQPGLDIFGQVFNQWKSKECVCPNCSRSIAASRFAPHLEK
FT                   CLGMGRNSSRIANRRIANSNNMNKSESDQEDNDDINDNDWSYGSEKKAKKRKSDKLWYL
FT                   PFQNPNSPRRSKSLKHKNGELSNSDPFKYSNSTGISYETLGPEELRSLLTTQCGVISEH
FT                   TKKMCTRSLRCPQHTDEQRRTVRIYFLGPSAVLPEVESSLDNDGFDMTDSQALISRLQW
FT                   DGSSDLSPSDSGSSKTSENQGWGLGTNSSESRKTKKKKSHLSLVGTASGLGSNKKKKPK
FT                   PPAPPTPSIYDDIN"
FT   assembly_gap    913034..913804
FT                   /estimated_length=771
FT                   /gap_type="unknown"
FT   gene            921519..922029
FT                   /locus_tag="mCG_1042023"
FT                   /note="gene_id=mCG1042023.0"
FT   mRNA            join(921519..921953,921985..922029)
FT                   /locus_tag="mCG_1042023"
FT                   /product="mCG1042023"
FT                   /note="gene_id=mCG1042023.0 transcript_id=mCT159727.0
FT                   created on 05-SEP-2002"
FT   CDS             921798..921908
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042023"
FT                   /product="mCG1042023"
FT                   /note="gene_id=mCG1042023.0 transcript_id=mCT159727.0
FT                   protein_id=mCP74974.1"
FT                   /protein_id="EDL34110.1"
FT                   /translation="MSCSKLFLSENAFHSSVTVQGVQTRRWSSLQALSGT"
FT   assembly_gap    921957..921976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(922771..936002)
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /note="gene_id=mCG140722.0"
FT   mRNA            complement(join(922771..923760,923852..923995,
FT                   924075..924146,924240..924287,924945..925134,
FT                   925225..925313,925691..925801,925886..926041,
FT                   926389..926544,926646..926759,926860..926901,
FT                   927183..927324,927435..927568,928364..928484,
FT                   928738..928802,930882..931037,931123..931206,
FT                   931848..932023,933333..933457,935772..936002))
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /product="upstream binding transcription factor, RNA
FT                   polymerase I, transcript variant mCT171074"
FT                   /note="gene_id=mCG140722.0 transcript_id=mCT171074.0
FT                   created on 02-APR-2003"
FT   mRNA            complement(join(922771..923760,923852..923995,
FT                   924075..924146,924240..924287,924945..925134,
FT                   925225..925313,925691..925801,925886..926041,
FT                   926389..926544,926646..926759,926860..926901,
FT                   927183..927324,927435..927568,927918..928028,
FT                   928364..928484,928738..928802,930882..931037,
FT                   931123..931206,931848..932023,933333..933391,
FT                   933410..933458))
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /product="upstream binding transcription factor, RNA
FT                   polymerase I, transcript variant mCT171075"
FT                   /note="gene_id=mCG140722.0 transcript_id=mCT171075.0
FT                   created on 02-APR-2003"
FT   mRNA            complement(join(922990..923760,923852..923995,
FT                   924079..924146,924240..924287,924945..925134,
FT                   925225..925313,925691..925801,925886..926041,
FT                   926389..926544,926646..926759,926860..926901,
FT                   927183..927324,927435..927568,928364..928484,
FT                   928738..928802,930882..931037,931123..931206,
FT                   931848..932023,933333..933457,935772..935887))
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /product="upstream binding transcription factor, RNA
FT                   polymerase I, transcript variant mCT181661"
FT                   /note="gene_id=mCG140722.0 transcript_id=mCT181661.0
FT                   created on 02-APR-2003"
FT   CDS             complement(join(923556..923760,923852..923995,
FT                   924079..924146,924240..924287,924945..925134,
FT                   925225..925313,925691..925801,925886..926041,
FT                   926389..926544,926646..926759,926860..926901,
FT                   927183..927324,927435..927568,928364..928484,
FT                   928738..928802,930882..931037,931123..931206,
FT                   931848..932023,933333..933390))
FT                   /codon_start=1
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /product="upstream binding transcription factor, RNA
FT                   polymerase I, isoform CRA_b"
FT                   /note="gene_id=mCG140722.0 transcript_id=mCT181661.0
FT                   protein_id=mCP104583.0 isoform=CRA_b"
FT                   /db_xref="GOA:A2AWT7"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR029215"
FT                   /db_xref="MGI:MGI:98512"
FT                   /db_xref="UniProtKB/TrEMBL:A2AWT7"
FT                   /protein_id="EDL34112.1"
FT                   /translation="MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSK
FT                   FKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKK
FT                   LKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQ
FT                   DFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDEI
FT                   MRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKD
FT                   VPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEE
FT                   KMLNINKKQTTSPASKKPSQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESE
FT                   LTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREDRGKLPESPKRAEEIWQQS
FT                   VIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAA
FT                   TNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKE
FT                   HYKKLAEEQQRQYKVHLDLWVKSLSPQDRAAYKEYISNKRKNMTKLRGPNPKSSRTTLQ
FT                   SKSPRRMTMRRRRTTRRRRKRKMMRTVTLLRMAGTLLSPAVKMKARMGMRMMMTTTMKM
FT                   TKMTTMRMKTTSLRAVAPALHPQGTLRILTPTEAQPPPQAGRQAGSQGESPCRAHLPN"
FT   CDS             complement(join(923635..923760,923852..923995,
FT                   924075..924146,924240..924287,924945..925134,
FT                   925225..925313,925691..925801,925886..926041,
FT                   926389..926544,926646..926759,926860..926901,
FT                   927183..927324,927435..927568,928364..928484,
FT                   928738..928802,930882..931037,931123..931206,
FT                   931848..932023,933333..933390))
FT                   /codon_start=1
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /product="upstream binding transcription factor, RNA
FT                   polymerase I, isoform CRA_a"
FT                   /note="gene_id=mCG140722.0 transcript_id=mCT171074.0
FT                   protein_id=mCP93993.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AWT6"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR029215"
FT                   /db_xref="MGI:MGI:98512"
FT                   /db_xref="UniProtKB/TrEMBL:A2AWT6"
FT                   /protein_id="EDL34111.1"
FT                   /translation="MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSK
FT                   FKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKK
FT                   LKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQ
FT                   DFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDEI
FT                   MRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKD
FT                   VPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEE
FT                   KMLNINKKQTTSPASKKPSQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESE
FT                   LTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREDRGKLPESPKRAEEIWQQS
FT                   VIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAA
FT                   TNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKE
FT                   HYKKLAEEQQRQYKVHLDLWVKSLSPQDRAAYKEYISNKRKNMTKLRGPNPKSSRTTLQ
FT                   SKSESEEDDDEEEEDDEEEEEEEDDENGDSSEDGGDSSESSSEDESEDGDENDDDDDDE
FT                   DDEDDDDEDEDNESEGSSSSSSSSGDSSDSDSN"
FT   CDS             complement(join(923635..923760,923852..923995,
FT                   924075..924146,924240..924287,924945..925134,
FT                   925225..925313,925691..925801,925886..926041,
FT                   926389..926544,926646..926759,926860..926901,
FT                   927183..927324,927435..927568,927918..928028,
FT                   928364..928484,928738..928802,930882..931037,
FT                   931123..931206,931848..932023,933333..933390))
FT                   /codon_start=1
FT                   /gene="Ubtf"
FT                   /locus_tag="mCG_140722"
FT                   /product="upstream binding transcription factor, RNA
FT                   polymerase I, isoform CRA_c"
FT                   /note="gene_id=mCG140722.0 transcript_id=mCT171075.0
FT                   protein_id=mCP93992.0 isoform=CRA_c"
FT                   /db_xref="GOA:A2AWT5"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR029215"
FT                   /db_xref="MGI:MGI:98512"
FT                   /db_xref="UniProtKB/TrEMBL:A2AWT5"
FT                   /protein_id="EDL34113.1"
FT                   /translation="MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSK
FT                   FKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKK
FT                   LKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQ
FT                   DFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDAT
FT                   TKEVKDSLGKQWSQLSDKKRLKWIHKALEQRKEYEEIMRDYIQKHPELNISEEGITKST
FT                   LTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQKEK
FT                   DAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQTTSPASKKPSQEG
FT                   GKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKA
FT                   REAALKAQSERKPGGEREDRGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEM
FT                   TWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQ
FT                   KFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQRQYKVHLDLWVK
FT                   SLSPQDRAAYKEYISNKRKNMTKLRGPNPKSSRTTLQSKSESEEDDDEEEEDDEEEEEE
FT                   EDDENGDSSEDGGDSSESSSEDESEDGDENDDDDDDEDDEDDDDEDEDNESEGSSSSSS
FT                   SSGDSSDSDSN"
FT   assembly_gap    928071..928109
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    934773..935650
FT                   /estimated_length=878
FT                   /gap_type="unknown"
FT   assembly_gap    942785..943386
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   assembly_gap    949343..949362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    952671..952781
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    954454..954473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    960948..966170
FT                   /estimated_length=5223
FT                   /gap_type="unknown"
FT   gene            complement(968039..984492)
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /note="gene_id=mCG21367.2"
FT   mRNA            complement(join(968039..969582,970317..970490,
FT                   970572..970741,971654..971907,972406..972572,
FT                   973039..973128,973481..973651,975295..975489,
FT                   975598..975746,975935..976147,976259..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980681,984275..984492))
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, transcript variant mCT22052"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT22052.2 created
FT                   on 16-JUL-2002"
FT   mRNA            complement(join(968043..969582,970317..970490,
FT                   970572..970741,971654..971907,972406..972572,
FT                   973039..973128,973481..973651,975295..975489,
FT                   975598..975746,975935..976147,976259..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980681,981844..981917,
FT                   984275..984355))
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, transcript variant mCT170732"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT170732.0 created
FT                   on 16-JUL-2002"
FT   mRNA            complement(join(968043..969582,970317..970490,
FT                   970572..970741,971654..971907,972406..972572,
FT                   973039..973128,973481..973651,975295..975489,
FT                   975598..975746,975935..976147,976259..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980681,982179..982231,
FT                   982883..982924))
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, transcript variant mCT170733"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT170733.0 created
FT                   on 16-JUL-2002"
FT   mRNA            complement(join(<968044..968123,976389..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980681,984275..984329))
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, transcript variant mCT170731"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT170731.0 created
FT                   on 16-JUL-2002"
FT   CDS             complement(join(<968044..968123,976389..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980613))
FT                   /codon_start=1
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT170731.0
FT                   protein_id=mCP93651.0 isoform=CRA_a"
FT                   /protein_id="EDL34114.1"
FT                   /translation="MGDMRDHEEVLEIPDRDSEEELENIIGQIAYRDLTIPVTEMQDPE
FT                   ALPTEQTATDYVPSSTSTPHPSSGQVYVELQELMMDQRNQELQWVEAAHWIGLEENLRE
FT                   DGVWGRPHLSYLTFWSLLELQKVFSKGTFLLGLAETSLAGVANHLLDCFIYEDQIRPQD
FT                   REELLRALLLKRSHAEDLGNLEGVKPAVLTRSGGASEPLLPHQPSLETQLYCGQAEGGS
FT                   EGPSTSGTLKIPPDSETTLVLVGRANFLEKPVLGFVRLKEAVPLEDLVLPEPVGFLLVL
FT                   LGPEAPHVDYTQLGRAAATLMTERVFRITASMAHNREELLRSLESFLDCSLGSCRPLCQ
FT                   RSSPPLCLGIGFANKRVCV"
FT   CDS             complement(join(969502..969582,970317..970490,
FT                   970572..970741,971654..971907,972406..972572,
FT                   973039..973128,973481..973651,975295..975489,
FT                   975598..975746,975935..976147,976259..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980613))
FT                   /codon_start=1
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT170732.0
FT                   protein_id=mCP93650.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q53ZN9"
FT                   /db_xref="InterPro:IPR001717"
FT                   /db_xref="InterPro:IPR002977"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="InterPro:IPR013769"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR018241"
FT                   /db_xref="MGI:MGI:109393"
FT                   /db_xref="UniProtKB/TrEMBL:Q53ZN9"
FT                   /protein_id="EDL34115.1"
FT                   /translation="MGDMRDHEEVLEIPDRDSEEELENIIGQIAYRDLTIPVTEMQDPE
FT                   ALPTEQTATDYVPSSTSTPHPSSGQVYVELQELMMDQRNQELQWVEAAHWIGLEENLRE
FT                   DGVWGRPHLSYLTFWSLLELQKVFSKGTFLLGLAETSLAGVANHLLDCFIYEDQIRPQD
FT                   REELLRALLLKRSHAEDLGNLEGVKPAVLTRSGGASEPLLPHQPSLETQLYCGQAEGGS
FT                   EGPSTSGTLKIPPDSETTLVLVGRANFLEKPVLGFVRLKEAVPLEDLVLPEPVGFLLVL
FT                   LGPEAPHVDYTQLGRAAATLMTERVFRITASMAHNREELLRSLESFLDCSLVLPPTDAP
FT                   SEKALLNLVPVQKELLRRRYLPSPAKPDPNLYNTLDLNGGKGGPGDEDDPLRRTGRIFG
FT                   GLIRDIRRRYPYYLSDITDALSPQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSE
FT                   LLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLI
FT                   LLVMLVVAFEGSFLVQYISRYTQEIFSFLISLIFIYETFSKLIKIFQDYPLQQTYAPVV
FT                   MKPKPQGPVPNTALFSLVLMAGTFLLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIM
FT                   VLVDSFIKGTYTQKLSVPDGLKVSNSSARGWVIHPLGLYRLFPTWMMFASVLPALLVFI
FT                   LIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHA
FT                   NALTVMGKASGPGAAAQIQEVKEQRISGLLVSVLVGLSILMEPILSRIPLAVLFGIFLY
FT                   MGVTSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRMHLFTGIQIICLAVLWVVKST
FT                   PASLALPFVLILTVPLRRLILPLIFRELELQCLDGDDAKVTFDEENGLDEYDEVPMPV"
FT   CDS             complement(join(969502..969582,970317..970490,
FT                   970572..970741,971654..971907,972406..972572,
FT                   973039..973128,973481..973651,975295..975489,
FT                   975598..975746,975935..976147,976259..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980613))
FT                   /codon_start=1
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT170733.0
FT                   protein_id=mCP93649.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q53ZN9"
FT                   /db_xref="InterPro:IPR001717"
FT                   /db_xref="InterPro:IPR002977"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="InterPro:IPR013769"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR018241"
FT                   /db_xref="MGI:MGI:109393"
FT                   /db_xref="UniProtKB/TrEMBL:Q53ZN9"
FT                   /protein_id="EDL34116.1"
FT                   /translation="MGDMRDHEEVLEIPDRDSEEELENIIGQIAYRDLTIPVTEMQDPE
FT                   ALPTEQTATDYVPSSTSTPHPSSGQVYVELQELMMDQRNQELQWVEAAHWIGLEENLRE
FT                   DGVWGRPHLSYLTFWSLLELQKVFSKGTFLLGLAETSLAGVANHLLDCFIYEDQIRPQD
FT                   REELLRALLLKRSHAEDLGNLEGVKPAVLTRSGGASEPLLPHQPSLETQLYCGQAEGGS
FT                   EGPSTSGTLKIPPDSETTLVLVGRANFLEKPVLGFVRLKEAVPLEDLVLPEPVGFLLVL
FT                   LGPEAPHVDYTQLGRAAATLMTERVFRITASMAHNREELLRSLESFLDCSLVLPPTDAP
FT                   SEKALLNLVPVQKELLRRRYLPSPAKPDPNLYNTLDLNGGKGGPGDEDDPLRRTGRIFG
FT                   GLIRDIRRRYPYYLSDITDALSPQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSE
FT                   LLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLI
FT                   LLVMLVVAFEGSFLVQYISRYTQEIFSFLISLIFIYETFSKLIKIFQDYPLQQTYAPVV
FT                   MKPKPQGPVPNTALFSLVLMAGTFLLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIM
FT                   VLVDSFIKGTYTQKLSVPDGLKVSNSSARGWVIHPLGLYRLFPTWMMFASVLPALLVFI
FT                   LIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHA
FT                   NALTVMGKASGPGAAAQIQEVKEQRISGLLVSVLVGLSILMEPILSRIPLAVLFGIFLY
FT                   MGVTSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRMHLFTGIQIICLAVLWVVKST
FT                   PASLALPFVLILTVPLRRLILPLIFRELELQCLDGDDAKVTFDEENGLDEYDEVPMPV"
FT   CDS             complement(join(969502..969582,970317..970490,
FT                   970572..970741,971654..971907,972406..972572,
FT                   973039..973128,973481..973651,975295..975489,
FT                   975598..975746,975935..976147,976259..976469,
FT                   977141..977322,977436..977517,977622..977745,
FT                   978228..978363,978443..978623,979365..979438,
FT                   980359..980479,980599..980613))
FT                   /codon_start=1
FT                   /gene="Slc4a1"
FT                   /locus_tag="mCG_21367"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG21367.2 transcript_id=mCT22052.2
FT                   protein_id=mCP23490.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q53ZN9"
FT                   /db_xref="InterPro:IPR001717"
FT                   /db_xref="InterPro:IPR002977"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="InterPro:IPR013769"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR018241"
FT                   /db_xref="MGI:MGI:109393"
FT                   /db_xref="UniProtKB/TrEMBL:Q53ZN9"
FT                   /protein_id="EDL34117.1"
FT                   /translation="MGDMRDHEEVLEIPDRDSEEELENIIGQIAYRDLTIPVTEMQDPE
FT                   ALPTEQTATDYVPSSTSTPHPSSGQVYVELQELMMDQRNQELQWVEAAHWIGLEENLRE
FT                   DGVWGRPHLSYLTFWSLLELQKVFSKGTFLLGLAETSLAGVANHLLDCFIYEDQIRPQD
FT                   REELLRALLLKRSHAEDLGNLEGVKPAVLTRSGGASEPLLPHQPSLETQLYCGQAEGGS
FT                   EGPSTSGTLKIPPDSETTLVLVGRANFLEKPVLGFVRLKEAVPLEDLVLPEPVGFLLVL
FT                   LGPEAPHVDYTQLGRAAATLMTERVFRITASMAHNREELLRSLESFLDCSLVLPPTDAP
FT                   SEKALLNLVPVQKELLRRRYLPSPAKPDPNLYNTLDLNGGKGGPGDEDDPLRRTGRIFG
FT                   GLIRDIRRRYPYYLSDITDALSPQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSE
FT                   LLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLI
FT                   LLVMLVVAFEGSFLVQYISRYTQEIFSFLISLIFIYETFSKLIKIFQDYPLQQTYAPVV
FT                   MKPKPQGPVPNTALFSLVLMAGTFLLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIM
FT                   VLVDSFIKGTYTQKLSVPDGLKVSNSSARGWVIHPLGLYRLFPTWMMFASVLPALLVFI
FT                   LIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHA
FT                   NALTVMGKASGPGAAAQIQEVKEQRISGLLVSVLVGLSILMEPILSRIPLAVLFGIFLY
FT                   MGVTSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRMHLFTGIQIICLAVLWVVKST
FT                   PASLALPFVLILTVPLRRLILPLIFRELELQCLDGDDAKVTFDEENGLDEYDEVPMPV"
FT   assembly_gap    1008029..1009002
FT                   /estimated_length=974
FT                   /gap_type="unknown"
FT   assembly_gap    1009845..1010631
FT                   /estimated_length=787
FT                   /gap_type="unknown"
FT   gene            1012686..1021755
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /note="gene_id=mCG21347.2"
FT   mRNA            join(1012686..1012984,1016773..1016888,1017287..1017435,
FT                   1017579..1017664,1018397..1018486,1018585..1018665,
FT                   1018817..1018982,1019090..1019247,1019863..1020000,
FT                   1020096..1020202,1021183..1021755)
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, transcript variant
FT                   mCT21544"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT21544.2 created
FT                   on 17-JUL-2002"
FT   mRNA            join(1012686..1012984,1016773..1016888,1017287..1017435,
FT                   1017579..1017664,1018397..1018486,1018585..1018665,
FT                   1018817..1018982,1019090..1019247,1020096..1020202,
FT                   1021183..1021755)
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, transcript variant
FT                   mCT170717"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT170717.0 created
FT                   on 17-JUL-2002"
FT   mRNA            join(<1012705..1012984,1016773..1016888,1017287..1017435,
FT                   1017579..1017664,1018397..1018486,1018585..1018665,
FT                   1018817..1018982,1019090..1019247,1019839..1020000,
FT                   1020096..1020202,1020591..1020954)
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, transcript variant
FT                   mCT193236"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT193236.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1012764..1012984,1016773..1016888,1017287..1017435,
FT                   1017579..1017664,1018397..1018486,1018585..1018665,
FT                   1018817..1018982,1019090..1019247,1019839..1020000,
FT                   1020096..1020202,1020591..1020610)
FT                   /codon_start=1
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, isoform CRA_b"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT193236.0
FT                   protein_id=mCP114227.0 isoform=CRA_b"
FT                   /protein_id="EDL34119.1"
FT                   /translation="RRRRAPGGRRPSRDPARRAGAPGGVGGSGRRQQWPHIWMEASFVQ
FT                   TTMALGLPSKKASSRNVIVERRNLITVCRFSVKTLLEKYTAEPIDDSSEEFVNFAAILE
FT                   QILSHRFKACAPAGPASWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAKG
FT                   RAWIRVALMEKRMSEYITTALRDNRTTRRFYDSGAIMLREEATVLTGMLIGLSAIDFSF
FT                   CLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTD
FT                   EDSWYNKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQR
FT                   EKRELEGVILELQEQLPDPPPPPRTGLIPGDHAPLAQGSKELTTSLVNQWPSLSTLHRP
FT                   EGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLGEAKRDEEPWGPIGSSEPN"
FT   CDS             join(1012878..1012984,1016773..1016888,1017287..1017435,
FT                   1017579..1017664,1018397..1018486,1018585..1018665,
FT                   1018817..1018982,1019090..1019247,1019863..1020000,
FT                   1020096..1020202,1021183..1021325)
FT                   /codon_start=1
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, isoform CRA_c"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT21544.2
FT                   protein_id=mCP23512.2 isoform=CRA_c"
FT                   /protein_id="EDL34120.1"
FT                   /translation="MEASFVQTTMALGLPSKKASSRNVIVERRNLITVCRFSVKTLLEK
FT                   YTAEPIDDSSEEFVNFAAILEQILSHRFKACAPAGPASWFSSDGQRGFWDYIRLACSKV
FT                   PNNCVSSIENMENISTARAKGRAWIRVALMEKRMSEYITTALRDNRTTRRFYDSGAIML
FT                   REEATVLTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHS
FT                   AESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYAQKGYLEELVRLRESQLKD
FT                   LEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPGDHAPLAQGSKELTTSL
FT                   VNQWPSLSTLHRPEGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLGEAKRDEEPWGPI
FT                   GKDPTPSMLGLCGSLASIPSCKSLASFKSNECLVSDSPEGSPALSPS"
FT   CDS             join(1012878..1012984,1016773..1016888,1017287..1017435,
FT                   1017579..1017664,1018397..1018486,1018585..1018665,
FT                   1018817..1018982,1019090..1019247,1020096..1020202,
FT                   1021183..1021325)
FT                   /codon_start=1
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, isoform CRA_d"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT170717.0
FT                   protein_id=mCP93636.0 isoform=CRA_d"
FT                   /protein_id="EDL34121.1"
FT                   /translation="MEASFVQTTMALGLPSKKASSRNVIVERRNLITVCRFSVKTLLEK
FT                   YTAEPIDDSSEEFVNFAAILEQILSHRFKACAPAGPASWFSSDGQRGFWDYIRLACSKV
FT                   PNNCVSSIENMENISTARAKGRAWIRVALMEKRMSEYITTALRDNRTTRRFYDSGAIML
FT                   REEATVLTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHS
FT                   AESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYAQKGYLEELVRLRESQLKD
FT                   LEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLHSFMSTEPLSAEASLSSDSQRL
FT                   GEAKRDEEPWGPIGKDPTPSMLGLCGSLASIPSCKSLASFKSNECLVSDSPEGSPALSP
FT                   S"
FT   mRNA            join(<1017066..1017435,1017579..1017664,1018397..1018486,
FT                   1018585..1018665,1018817..1018982,1019090..1019247,
FT                   1019863..1020000,1020096..1020202,1021183..1021755)
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, transcript variant
FT                   mCT170718"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT170718.0 created
FT                   on 17-JUL-2002"
FT   CDS             join(<1017205..1017435,1017579..1017664,1018397..1018486,
FT                   1018585..1018665,1018817..1018982,1019090..1019247,
FT                   1019863..1020000,1020096..1020202,1021183..1021325)
FT                   /codon_start=1
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, isoform CRA_a"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT170718.0
FT                   protein_id=mCP93635.0 isoform=CRA_a"
FT                   /protein_id="EDL34118.1"
FT                   /translation="AYACKCFVTWTFSKLPGIAESPPCPGSACAPAGPASWFSSDGQRG
FT                   FWDYIRLACSKVPNNCVSSIENMENISTARAKGRAWIRVALMEKRMSEYITTALRDNRT
FT                   TRRFYDSGAIMLREEATVLTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQS
FT                   YDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYAQKGYLE
FT                   ELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPGDHAP
FT                   LAQGSKELTTSLVNQWPSLSTLHRPEGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLG
FT                   EAKRDEEPWGPIGKDPTPSMLGLCGSLASIPSCKSLASFKSNECLVSDSPEGSPALSPS
FT                   "
FT   mRNA            join(1018368..1018486,1018585..1018665,1018817..1018982,
FT                   1019090..1019247,1019863..1020000,1020096..1020202,
FT                   1021183..1021755)
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, transcript variant
FT                   mCT170719"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT170719.0 created
FT                   on 17-JUL-2002"
FT   CDS             join(1018422..1018486,1018585..1018665,1018817..1018982,
FT                   1019090..1019247,1019863..1020000,1020096..1020202,
FT                   1021183..1021325)
FT                   /codon_start=1
FT                   /gene="Rap2ip"
FT                   /locus_tag="mCG_21347"
FT                   /product="Rap2 interacting protein, isoform CRA_e"
FT                   /note="gene_id=mCG21347.2 transcript_id=mCT170719.0
FT                   protein_id=mCP93637.0 isoform=CRA_e"
FT                   /protein_id="EDL34122.1"
FT                   /translation="MLREEATVLTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLK
FT                   FTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYAQK
FT                   GYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPG
FT                   DHAPLAQGSKELTTSLVNQWPSLSTLHRPEGASNSKLYRRHSFMSTEPLSAEASLSSDS
FT                   QRLGEAKRDEEPWGPIGKDPTPSMLGLCGSLASIPSCKSLASFKSNECLVSDSPEGSPA
FT                   LSPS"
FT   gene            complement(1021012..1027139)
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /note="gene_id=mCG21352.1"
FT   mRNA            complement(join(1021012..1021293,1023045..1023074,
FT                   1023233..1023342,1023654..1023827,1023997..1024121,
FT                   1024214..1024281,1024892..1025025,1025405..1025449,
FT                   1025561..1025620,1025754..1025853,1026589..1026708))
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   transcript variant mCT170722"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170722.0 created
FT                   on 18-JUL-2002"
FT   CDS             complement(join(1021261..1021293,1023045..1023074,
FT                   1023233..1023342,1023654..1023827,1023997..1024121,
FT                   1024214..1024281,1024892..1025025,1025405..1025449,
FT                   1025561..1025620,1025754..1025838))
FT                   /codon_start=1
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170722.0
FT                   protein_id=mCP93642.0 isoform=CRA_b"
FT                   /protein_id="EDL34124.1"
FT                   /translation="MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPS
FT                   ATSELTTPSRFWSLSYTKSSSALQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRF
FT                   TGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYA
FT                   PMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPT
FT                   ALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDGCRS
FT                   PGIRWI"
FT   mRNA            complement(join(1021626..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025853,
FT                   1026977..1027139))
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   transcript variant mCT170725"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170725.0 created
FT                   on 18-JUL-2002"
FT   mRNA            complement(join(1021626..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025853,
FT                   1026589..1026708))
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   transcript variant mCT22037"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT22037.1 created
FT                   on 18-JUL-2002"
FT   mRNA            complement(join(1021626..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025853,
FT                   1026449..1026514))
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   transcript variant mCT170724"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170724.0 created
FT                   on 18-JUL-2002"
FT   mRNA            complement(join(1021626..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025853,
FT                   1026025..1026124))
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   transcript variant mCT170723"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170723.0 created
FT                   on 18-JUL-2002"
FT   mRNA            complement(join(1021626..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1026007))
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   transcript variant mCT170721"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170721.0 created
FT                   on 18-JUL-2002"
FT   CDS             complement(join(1022622..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025838))
FT                   /codon_start=1
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170721.0
FT                   protein_id=mCP93640.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q14BQ5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:1196386"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BQ5"
FT                   /protein_id="EDL34123.1"
FT                   /translation="MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPS
FT                   ATSELTTPSRFWSLSYTKSSSALQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRF
FT                   TGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYA
FT                   PMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPT
FT                   ALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDVVKT
FT                   QRQMSLGAVEAVRVKPPRVDSTWLLLRRIRAESGTRGLFAGFLPRIIKAAPSCAIMIST
FT                   YEFGKSFFQRLNQEQPLGR"
FT   CDS             complement(join(1022622..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025838))
FT                   /codon_start=1
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170723.0
FT                   protein_id=mCP93641.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q14BQ5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:1196386"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BQ5"
FT                   /protein_id="EDL34125.1"
FT                   /translation="MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPS
FT                   ATSELTTPSRFWSLSYTKSSSALQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRF
FT                   TGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYA
FT                   PMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPT
FT                   ALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDVVKT
FT                   QRQMSLGAVEAVRVKPPRVDSTWLLLRRIRAESGTRGLFAGFLPRIIKAAPSCAIMIST
FT                   YEFGKSFFQRLNQEQPLGR"
FT   CDS             complement(join(1022622..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025838))
FT                   /codon_start=1
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170724.0
FT                   protein_id=mCP93639.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q14BQ5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:1196386"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BQ5"
FT                   /protein_id="EDL34126.1"
FT                   /translation="MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPS
FT                   ATSELTTPSRFWSLSYTKSSSALQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRF
FT                   TGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYA
FT                   PMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPT
FT                   ALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDVVKT
FT                   QRQMSLGAVEAVRVKPPRVDSTWLLLRRIRAESGTRGLFAGFLPRIIKAAPSCAIMIST
FT                   YEFGKSFFQRLNQEQPLGR"
FT   CDS             complement(join(1022622..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025838))
FT                   /codon_start=1
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT170725.0
FT                   protein_id=mCP93643.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q14BQ5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:1196386"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BQ5"
FT                   /protein_id="EDL34127.1"
FT                   /translation="MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPS
FT                   ATSELTTPSRFWSLSYTKSSSALQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRF
FT                   TGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYA
FT                   PMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPT
FT                   ALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDVVKT
FT                   QRQMSLGAVEAVRVKPPRVDSTWLLLRRIRAESGTRGLFAGFLPRIIKAAPSCAIMIST
FT                   YEFGKSFFQRLNQEQPLGR"
FT   CDS             complement(join(1022622..1022737,1022835..1022915,
FT                   1022993..1023074,1023233..1023342,1023654..1023827,
FT                   1023997..1024121,1024214..1024281,1024892..1025025,
FT                   1025405..1025449,1025561..1025620,1025754..1025838))
FT                   /codon_start=1
FT                   /gene="D11Ertd333e"
FT                   /locus_tag="mCG_21352"
FT                   /product="DNA segment, Chr 11, ERATO Doi 333, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21352.1 transcript_id=mCT22037.1
FT                   protein_id=mCP23443.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q14BQ5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:1196386"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BQ5"
FT                   /protein_id="EDL34128.1"
FT                   /translation="MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPS
FT                   ATSELTTPSRFWSLSYTKSSSALQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRF
FT                   TGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYA
FT                   PMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPT
FT                   ALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDVVKT
FT                   QRQMSLGAVEAVRVKPPRVDSTWLLLRRIRAESGTRGLFAGFLPRIIKAAPSCAIMIST
FT                   YEFGKSFFQRLNQEQPLGR"
FT   assembly_gap    1029626..1029645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1050479..1056809
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /note="gene_id=mCG21354.2"
FT   mRNA            join(1050479..1050541,1052967..1053111,1053227..1053352,
FT                   1053488..1053572,1053938..1054030,1055139..1055158,
FT                   1055248..1055493,1055711..1055944,1056026..1056250,
FT                   1056337..1056809)
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, transcript variant mCT170726"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170726.0 created
FT                   on 18-JUL-2002"
FT   mRNA            join(1050479..1050541,1052967..1053111,1053227..1053352,
FT                   1053488..1053548,1054483..1054511,1054705..1054828,
FT                   1055061..1055158,1055248..1055493,1055711..1055944,
FT                   1056026..1056250,1056337..1056809)
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, transcript variant mCT170727"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170727.0 created
FT                   on 18-JUL-2002"
FT   mRNA            join(1050479..1050541,1052967..1053111,1053227..1053352,
FT                   1053488..1053572,1053938..1054047,1054144..1054279,
FT                   1054402..1054511,1054705..1054828,1055061..1055158,
FT                   1055248..1055493,1055711..1055944,1056026..1056250,
FT                   1056337..1056807)
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, transcript variant mCT170730"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170730.0 created
FT                   on 18-JUL-2002"
FT   mRNA            join(1052787..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054705..1054828,1055061..1055158,1055248..1055493,
FT                   1055711..1055944,1056026..1056250,1056337..1056809)
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, transcript variant mCT22039"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT22039.1 created
FT                   on 18-JUL-2002"
FT   mRNA            join(1052967..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054705..1054828,1055061..1055158,1055248..1055493,
FT                   1055771..1055944,1056026..1056250,1056337..1056809)
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, transcript variant mCT170729"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170729.0 created
FT                   on 18-JUL-2002"
FT   mRNA            join(1052967..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054774..1054828,1055061..1055158,1055248..1055493,
FT                   1055711..1055944,1056026..1056250,1056337..1056809)
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, transcript variant mCT170728"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170728.0 created
FT                   on 18-JUL-2002"
FT   CDS             join(1052974..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054705..1054828,1055061..1055158,1055248..1055493,
FT                   1055711..1055944,1056026..1056250,1056337..1056474)
FT                   /codon_start=1
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, isoform CRA_e"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170730.0
FT                   protein_id=mCP93648.0 isoform=CRA_e"
FT                   /db_xref="InterPro:IPR000118"
FT                   /db_xref="MGI:MGI:95832"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Y8"
FT                   /protein_id="EDL34133.1"
FT                   /translation="MWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPL
FT                   LDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH
FT                   CSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHC
FT                   CPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCE
FT                   LPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKLPGYPVKEVK
FT                   CDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQV
FT                   PWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQ
FT                   HCCPQGFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSL
FT                   KGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVEC
FT                   GEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRW
FT                   DMFLRDPVPRPLL"
FT   CDS             join(1052974..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054705..1054828,1055061..1055158,1055248..1055493,
FT                   1055711..1055944,1056026..1056250,1056337..1056474)
FT                   /codon_start=1
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, isoform CRA_e"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT22039.1
FT                   protein_id=mCP23462.0 isoform=CRA_e"
FT                   /db_xref="InterPro:IPR000118"
FT                   /db_xref="MGI:MGI:95832"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Y8"
FT                   /protein_id="EDL34134.1"
FT                   /translation="MWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPL
FT                   LDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH
FT                   CSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHC
FT                   CPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCE
FT                   LPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKLPGYPVKEVK
FT                   CDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQV
FT                   PWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQ
FT                   HCCPQGFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSL
FT                   KGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVEC
FT                   GEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRW
FT                   DMFLRDPVPRPLL"
FT   CDS             join(1052974..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054705..1054828,1055061..1055158,1055248..1055493,
FT                   1055771..1055944,1056026..1056250,1056337..1056474)
FT                   /codon_start=1
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, isoform CRA_d"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170729.0
FT                   protein_id=mCP93644.0 isoform=CRA_d"
FT                   /protein_id="EDL34132.1"
FT                   /translation="MWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPL
FT                   LDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH
FT                   CSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHC
FT                   CPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCE
FT                   LPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKLPGYPVKEVK
FT                   CDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQV
FT                   PWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEGYCQKGDT
FT                   MVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQH
FT                   CCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVW
FT                   ACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFLRDPVPRPLL"
FT   CDS             join(1052974..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054047,1054144..1054279,1054402..1054511,
FT                   1054774..1054828,1055061..1055158,1055248..1055493,
FT                   1055711..1055944,1056026..1056250,1056337..1056474)
FT                   /codon_start=1
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, isoform CRA_c"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170728.0
FT                   protein_id=mCP93647.0 isoform=CRA_c"
FT                   /protein_id="EDL34131.1"
FT                   /translation="MWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPL
FT                   LDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH
FT                   CSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHC
FT                   CPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCE
FT                   LPTGKYGCCPMPNCLSKNYTTDLLTKLPGYPVKEVKCDMEVSCPEGYTCCRLNTGAWGC
FT                   CPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTP
FT                   CDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGYCQKGDTMVA
FT                   GLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCP
FT                   AGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVWACC
FT                   PYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFLRDPVPRPLL"
FT   CDS             join(1052974..1053111,1053227..1053352,1053488..1053572,
FT                   1053938..1054030,1055139..1055158,1055248..1055493,
FT                   1055711..1055944,1056026..1056250,1056337..1056474)
FT                   /codon_start=1
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, isoform CRA_a"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170726.0
FT                   protein_id=mCP93646.0 isoform=CRA_a"
FT                   /protein_id="EDL34129.1"
FT                   /translation="MWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPL
FT                   LDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH
FT                   CSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCCPFAKAVCCEDHIH
FT                   CCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCC
FT                   KLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQ
FT                   IGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEK
FT                   DVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHC
FT                   CPGGFHCSARGTKCLRKKIPRWDMFLRDPVPRPLL"
FT   CDS             join(1052974..1053111,1053227..1053352,1053488..1053548,
FT                   1054483..1054511,1054705..1054828,1055061..1055158,
FT                   1055248..1055493,1055711..1055944,1056026..1056250,
FT                   1056337..1056474)
FT                   /codon_start=1
FT                   /gene="Grn"
FT                   /locus_tag="mCG_21354"
FT                   /product="granulin, isoform CRA_b"
FT                   /note="gene_id=mCG21354.2 transcript_id=mCT170727.0
FT                   protein_id=mCP93645.0 isoform=CRA_b"
FT                   /protein_id="EDL34130.1"
FT                   /translation="MWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPL
FT                   LDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH
FT                   CSADGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKLPGYPVKEV
FT                   KCDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQ
FT                   VPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDN
FT                   QHCCPQGFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPS
FT                   LKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVE
FT                   CGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPR
FT                   WDMFLRDPVPRPLL"
FT   gene            complement(1057293..1067614)
FT                   /gene="BC025575"
FT                   /locus_tag="mCG_21371"
FT                   /note="gene_id=mCG21371.1"
FT   mRNA            complement(join(1057293..1057799,1057917..1058901,
FT                   1059424..1059550,1059660..1059776,1059874..1060053,
FT                   1060136..1060294,1063646..1063738,1063960..1064187,
FT                   1067385..1067614))
FT                   /gene="BC025575"
FT                   /locus_tag="mCG_21371"
FT                   /product="cDNA sequence BC025575"
FT                   /note="gene_id=mCG21371.1 transcript_id=mCT22057.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(1057476..1057799,1057917..1058901,
FT                   1059424..1059550,1059660..1059776,1059874..1060053,
FT                   1060136..1060294,1063646..1063738,1063960..1064187,
FT                   1067385..1067502))
FT                   /codon_start=1
FT                   /gene="BC025575"
FT                   /locus_tag="mCG_21371"
FT                   /product="cDNA sequence BC025575"
FT                   /note="gene_id=mCG21371.1 transcript_id=mCT22057.2
FT                   protein_id=mCP23447.2"
FT                   /protein_id="EDL34135.1"
FT                   /translation="MPPPSGPGVLARLLPLLGLLLGGASRAPGKSPPEPPSPQEILIKV
FT                   QVYVSGELVPLARASVDVFGNRTLLAAGTTDSEGVATLPLSYRLGTWVLVTAARPGFLT
FT                   NSVPWRVDKLPLYASVSLYLLPERPATLILYEDLVHILLGSPGARSQPWVQFQRRAARL
FT                   PVSSTYSQLWASLTPASTQQEMRAFPAFLGTEASSSGNGSWLELIPLAAVSVHLLTGNG
FT                   TEVPLSGPIHLSLPVPSEPRALAVGTSIPAWRFDPKSGLWVRNGTGVIRKEGRQLYWTF
FT                   VSPQLGYWVAAMASPTSGLVTITSGIQDIGTYHTIFLLTILAALALLVLILLCLLIYYC
FT                   RRRCLKPRQQHRKLQLSGPSDNKRDQATSMSQLHLICGGPLEPTSSGDPEAPPPGSLHS
FT                   AFSSSRDLASSRDDFFRAKPRSASRPAAEPPGARTVEGAGLKSARSVEGPGGLEPSLDE
FT                   YRRGPAGAAAFLHEPPSPPPSFDHYLGHKGAAESKTPDFLLSQSVDQLARPPSLSQPGQ
FT                   LIFCGSIDHLKDNVYRNVMPTLVIPAHYVRLGGEAGAAGVGDEATPPEGSAAGPARPFP
FT                   QPDPQRPLMQGHAGAGGDSGGGEGWGGGRSAPVSGSVTIPVLFNESTMAQLNGELQALT
FT                   EKKLLELGVKPHPRAWFVSLDGRSNSQVRHSYIDLPAPPPPAPPRLALSEDTEPSSSES
FT                   RTGLCSPEDNSLTPLLDEVVAPEGRAATVPRGRGRSRGDSSRSSASELRRDSLTSPEDE
FT                   LGAEVGDEAGDKKSPWQRREERP"
FT   gene            complement(1073320..1089888)
FT                   /gene="Itga2b"
FT                   /locus_tag="mCG_21359"
FT                   /note="gene_id=mCG21359.2"
FT   mRNA            complement(join(1073320..1073540,1075592..1075708,
FT                   1075927..1076028,1076258..1076374,1076993..1077112,
FT                   1077213..1077356,1077488..1077587,1077800..1077880,
FT                   1078141..1078220,1078370..1078462,1079900..1080047,
FT                   1080165..1080232,1080543..1080668,1080776..1080927,
FT                   1081017..1081072,1081157..1081261,1081346..1081391,
FT                   1081665..1081847,1084979..1085190,1085344..1085396,
FT                   1085536..1085589,1085750..1085793,1085929..1085976,
FT                   1086296..1086424,1086516..1086561,1087095..1087144,
FT                   1087368..1087530,1087634..1087731,1087821..1087942,
FT                   1089566..1089888))
FT                   /gene="Itga2b"
FT                   /locus_tag="mCG_21359"
FT                   /product="integrin alpha 2b"
FT                   /note="gene_id=mCG21359.2 transcript_id=mCT22045.2 created
FT                   on 18-JUL-2002"
FT   CDS             complement(join(1073484..1073540,1075592..1075708,
FT                   1075927..1076028,1076258..1076374,1076993..1077112,
FT                   1077213..1077356,1077488..1077587,1077800..1077880,
FT                   1078141..1078220,1078370..1078462,1079900..1080047,
FT                   1080165..1080232,1080543..1080668,1080776..1080927,
FT                   1081017..1081072,1081157..1081261,1081346..1081391,
FT                   1081665..1081847,1084979..1085190,1085344..1085396,
FT                   1085536..1085589,1085750..1085793,1085929..1085976,
FT                   1086296..1086424,1086516..1086561,1087095..1087144,
FT                   1087368..1087530,1087634..1087731,1087821..1087942,
FT                   1089566..1089753))
FT                   /codon_start=1
FT                   /gene="Itga2b"
FT                   /locus_tag="mCG_21359"
FT                   /product="integrin alpha 2b"
FT                   /note="gene_id=mCG21359.2 transcript_id=mCT22045.2
FT                   protein_id=mCP23544.2"
FT                   /db_xref="GOA:B2RPR7"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR013649"
FT                   /db_xref="InterPro:IPR018184"
FT                   /db_xref="InterPro:IPR032695"
FT                   /db_xref="MGI:MGI:96601"
FT                   /db_xref="UniProtKB/TrEMBL:B2RPR7"
FT                   /protein_id="EDL34136.1"
FT                   /translation="MARASCAWHSLWLLQWTPLFLGPSAVPPVWALNLDSEKFSVYAGP
FT                   NGSHFGFSVDFHKDKHGSVSIVVGAPRALNASQEETGAVFLCPWKANGGKCNPLLFDLR
FT                   DETRNLGFQIFQTFKTGQGLGASVVSWNDVIVACAPWQHWNVLEKRDEAEKTPVGGCFL
FT                   AQLQSGGRAEYSPCRANTMSSVYAESFRGDKRYCEAGFSLAVTQAGELVLGAPGGYFFL
FT                   GLLARVPIENIISSYRPGTLLWHVSNQRFTYDNSNPVFFDGYRGYSVAVGEFDGDPSTT
FT                   EYVSGAPTWSWTLGAVEILDSYYQPLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGA
FT                   PLYMESRADRKLAEVGRVYLFLQPKGPQALSTPTLLLTGTQLYGRFGSAIAPLGDLNRD
FT                   GYNDIAVAAPYGGPSGQGQVLIFLGQSEGLSPRPSQVLDSPFPTGSGFGFSLRGAVDID
FT                   DNGYPDLIVGAYGASKVAVYRAQPVVMATVQLMVQDSLNPTLKNCVLDQTKTPVSCFNI
FT                   QMCVGATGHNIPQKLHLKAELQLDLQKPRQGRRVLLLASQQASLTLSLDLGGRDKPICH
FT                   TTGAFLRDEADFRDKLSPIVLSLNVSLPPEETGGAPAVVLHGETHVQEQTRIILDCGED
FT                   DLCVPQLRLTATAGDSPLLIGADNVLELKIEAANDGEGAYEAELAVHLPPGAHYMRALS
FT                   NIEGFERLVCTQKKENESRVALCELGNPMKKDTRIGITMLVSVENLEEAGESVSFQLQV
FT                   RSKNSQNPNSKVVMLPVAIQAEATVELRGNSFPASLVVAAEEGDREQEDLDSWVSRLEH
FT                   TYELHNIGPGTVNGLRLLIHIPGQSQPSDLLYILDVQPQGGLLCSTQPSPKVDWKLSTP
FT                   SPSSIRPVHHQRERRQAFLQGPKPGQQDPVLVSCDGSASCTVVECELREMVRGQRAMVT
FT                   VQAMLGLSSLRQRPQEQFVLQSHAWFNVSSLPYSVPVVSLPSGQARVQTQLLRALEERA
FT                   IPVWWVLVGVLGGLLLLTLLVLAMWKAGFFKRNRPPLEEDEEEE"
FT   gene            complement(1096202..1107686)
FT                   /locus_tag="mCG_21366"
FT                   /note="gene_id=mCG21366.2"
FT   mRNA            complement(join(1096202..1100119,1100262..1102127,
FT                   1107556..1107686))
FT                   /locus_tag="mCG_21366"
FT                   /product="mCG21366"
FT                   /note="gene_id=mCG21366.2 transcript_id=mCT22051.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(1098229..1100119,1100262..1102108))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21366"
FT                   /product="mCG21366"
FT                   /note="gene_id=mCG21366.2 transcript_id=mCT22051.2
FT                   protein_id=mCP23562.2"
FT                   /protein_id="EDL34137.1"
FT                   /translation="MFRPTTVAVDEDGGEEDKDESSTNSGASAVSSCGFGADFSTDKGG
FT                   SFTSVQITNTTGLSQAPGLASQGISFGIKNNLGPPLQKLGVSFSFAKKAPVKLESIASV
FT                   FKDHAEEGSSEDGTKADEKSSDQGVQKVGDTDGTGNLDGKKEDEDPQDGGSLASTLSKL
FT                   KRMKREEGTGATEPEYYHYIPPAHCKVKPNFPFLLFMRASEQMEGDHSAHSKSAPENRK
FT                   SSSPKPQGCSKTAASPGAERTVSEASELQKEAAVAGPSEPGGKTETKKGSGGGEDEQSV
FT                   ESRETSESPMCESNPKDISQATPATKAGQGPKHPTGPFFPVLSKDESTALQWPSELLIF
FT                   TKAEPSISYSCNPLYFDFKLSRNKDAKAKGTEKPKDVAGSSKDHLQSLDPREPNKSQEE
FT                   EQDVVLSSEGRVDEPASGAACSSLNKQEPGGSHMSETEDTGRSHPSKKEPSGKSHRHKK
FT                   KKKHKKSSKHKRKHKADTEEKSSKAESGEKSKKRKKRKRKKNKSSAAADSERGPKSEPP
FT                   GSGSPAPPRRRRRAQDDSQRRSLPAEEGNSGKKDDGGGGSSCQDHSGRKHKGEPPTSSC
FT                   QRRANTKHSSRSSHRSQPSSGDEDSDDASSHRLHQKSPSHSSDASSDQSCYSRQHSYSD
FT                   DSYSDYSDRSRRHSKRSHDSDDSDYTSSKHRSKRHKYSSSDDDYSLSCSQSRSRSRSHT
FT                   RERSRSRGRSRSSSCSRSRSKRRSRSTTAHSWQRSRSYSRDRSRSTRSPSQRSGSRKGS
FT                   WGHESPEERRSGRRDFIRSKIYRSQSPHYFQSGRGEGPGKKEDGRGDDSKGAGLPSQNS
FT                   NTGTGRGSESDCSPEDKNSVTARLLLEKIQSRKVERKPNVCEEVLATPNKAGLKYKNPP
FT                   QGYFGPKLPPSLGNKPVLPMIGKLPATRKSNKKCEESGLERGEEQEHSEPEEGSPRSSD
FT                   APFGHQFSEEAAGPLSDPPPEEPKSEEATADHSVAPLGTPAHTDCYPGDPAISHNYLPD
FT                   PSDGDTLESLDSGSQPGPVESSLLPIAPDLEHFPNYAPPSGEPSIESTDGTEDASLAPL
FT                   ESQPITFTPEEMEKYSKLQQAAQQHIQQQLLAKQVKAFPASTALAPATPALQPIHIQQP
FT                   ATASATSITTVQHAILQHHAAAAAAAIGIHPHPHPQPLAQVHHIPQPHLTPISLSHLTH
FT                   SIIPGHPATFLASHPIHIIPASAIHPGPFTFHPVPHAALYPTLLAPRPAAAAATALHLH
FT                   PLLHPIFSGQDLQHPPSHGT"
FT   assembly_gap    1126711..1126730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1175376..1176245)
FT                   /locus_tag="mCG_148166"
FT                   /note="gene_id=mCG148166.0"
FT   mRNA            complement(1175376..1176245)
FT                   /locus_tag="mCG_148166"
FT                   /product="mCG148166"
FT                   /note="gene_id=mCG148166.0 transcript_id=mCT188429.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1175732..1176013)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148166"
FT                   /product="mCG148166"
FT                   /note="gene_id=mCG148166.0 transcript_id=mCT188429.0
FT                   protein_id=mCP109343.0"
FT                   /protein_id="EDL34138.1"
FT                   /translation="MRPRPRLHPYSRRFFGSAFLLFCSWLPAPQPGALWGLRFACLGAC
FT                   AGAGPARPPGERAGAGKAWASGFQAGAMEALAFARPDHPGDRLSVFPL"
FT   assembly_gap    1196362..1196512
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   gene            complement(1196648..1199506)
FT                   /locus_tag="mCG_21374"
FT                   /note="gene_id=mCG21374.2"
FT   mRNA            complement(join(1196648..1197047,1199004..1199149,
FT                   1199445..1199506))
FT                   /locus_tag="mCG_21374"
FT                   /product="mCG21374, transcript variant mCT172787"
FT                   /note="gene_id=mCG21374.2 transcript_id=mCT172787.0 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(1196695..1197047,1199004..1199149,
FT                   1199242..1199319))
FT                   /locus_tag="mCG_21374"
FT                   /product="mCG21374, transcript variant mCT22055"
FT                   /note="gene_id=mCG21374.2 transcript_id=mCT22055.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(1196933..1197047,1199004..1199056))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21374"
FT                   /product="mCG21374, isoform CRA_a"
FT                   /note="gene_id=mCG21374.2 transcript_id=mCT172787.0
FT                   protein_id=mCP95706.0 isoform=CRA_a"
FT                   /db_xref="GOA:A6PWP4"
FT                   /db_xref="MGI:MGI:3650659"
FT                   /db_xref="UniProtKB/TrEMBL:A6PWP4"
FT                   /protein_id="EDL34139.1"
FT                   /translation="MFGGNSQASKIFVRSGASNSYLHGTCRQEGLFVSKKICTGCTQIE
FT                   RHFDMKDFSP"
FT   CDS             complement(join(1196933..1197047,1199004..1199056))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21374"
FT                   /product="mCG21374, isoform CRA_a"
FT                   /note="gene_id=mCG21374.2 transcript_id=mCT22055.2
FT                   protein_id=mCP23472.2 isoform=CRA_a"
FT                   /db_xref="GOA:A6PWP4"
FT                   /db_xref="MGI:MGI:3650659"
FT                   /db_xref="UniProtKB/TrEMBL:A6PWP4"
FT                   /protein_id="EDL34140.1"
FT                   /translation="MFGGNSQASKIFVRSGASNSYLHGTCRQEGLFVSKKICTGCTQIE
FT                   RHFDMKDFSP"
FT   assembly_gap    1206664..1207452
FT                   /estimated_length=789
FT                   /gap_type="unknown"
FT   assembly_gap    1215780..1215960
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    1224400..1224419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1224425..1227368
FT                   /gene="Fzd2"
FT                   /locus_tag="mCG_21349"
FT                   /note="gene_id=mCG21349.3"
FT   mRNA            1224425..1227368
FT                   /gene="Fzd2"
FT                   /locus_tag="mCG_21349"
FT                   /product="frizzled homolog 2 (Drosophila)"
FT                   /note="gene_id=mCG21349.3 transcript_id=mCT21546.3 created
FT                   on 23-JUN-2003"
FT   CDS             1224762..1226474
FT                   /codon_start=1
FT                   /gene="Fzd2"
FT                   /locus_tag="mCG_21349"
FT                   /product="frizzled homolog 2 (Drosophila)"
FT                   /note="gene_id=mCG21349.3 transcript_id=mCT21546.3
FT                   protein_id=mCP23527.2"
FT                   /protein_id="EDL34141.1"
FT                   /translation="MRARSALPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQ
FT                   PISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPV
FT                   CTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSED
FT                   GAPALLTTAPPSGLQPGAGGTPGGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSYKFLG
FT                   ERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYP
FT                   ERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLY
FT                   FFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQID
FT                   GDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTE
FT                   KLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTP
FT                   RMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRHGETTV"
FT   assembly_gap    1227369..1227420
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   gene            complement(1239952..1244536)
FT                   /locus_tag="mCG_131532"
FT                   /note="gene_id=mCG131532.1"
FT   mRNA            complement(join(1239952..1240617,1241636..1241728,
FT                   1242216..1242363,1244448..1244517))
FT                   /locus_tag="mCG_131532"
FT                   /product="mCG131532, transcript variant mCT132867"
FT                   /note="gene_id=mCG131532.1 transcript_id=mCT132867.1
FT                   created on 05-SEP-2002"
FT   mRNA            complement(join(1240559..1241010,1241625..1241728,
FT                   1242216..1242363,1244448..1244505))
FT                   /locus_tag="mCG_131532"
FT                   /product="mCG131532, transcript variant mCT172757"
FT                   /note="gene_id=mCG131532.1 transcript_id=mCT172757.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(1240597..1240617,1241636..1241728,
FT                   1242216..1242347))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131532"
FT                   /product="mCG131532, isoform CRA_c"
FT                   /note="gene_id=mCG131532.1 transcript_id=mCT132867.1
FT                   protein_id=mCP75354.1 isoform=CRA_c"
FT                   /protein_id="EDL34144.1"
FT                   /translation="MMTQKYGALRSLPHNPHAIGLQSICGTQEEQQTKTLEPPTEKLQA
FT                   VASFRVSLPVSFAAAGFSGLGMELWDSCMLRKEDQP"
FT   CDS             complement(join(1241004..1241010,1241625..1241728,
FT                   1242216..1242347))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131532"
FT                   /product="mCG131532, isoform CRA_b"
FT                   /note="gene_id=mCG131532.1 transcript_id=mCT172757.0
FT                   protein_id=mCP95676.0 isoform=CRA_b"
FT                   /protein_id="EDL34143.1"
FT                   /translation="MMTQKYGALRSLPHNPHAIGLQSICGTQEEQQTKTLEPPTEKLQA
FT                   VASFRVSLPVSFAAAGFSGLGMELWDSCMLVSTLH"
FT   mRNA            complement(join(1241476..1241728,1242216..1242363,
FT                   1244448..1244536))
FT                   /locus_tag="mCG_131532"
FT                   /product="mCG131532, transcript variant mCT172756"
FT                   /note="gene_id=mCG131532.1 transcript_id=mCT172756.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(1241582..1241728,1242216..1242347))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131532"
FT                   /product="mCG131532, isoform CRA_a"
FT                   /note="gene_id=mCG131532.1 transcript_id=mCT172756.0
FT                   protein_id=mCP95675.0 isoform=CRA_a"
FT                   /protein_id="EDL34142.1"
FT                   /translation="MMTQKYGALRSLPHNPHAIGLQSICGTQEEQQTKTLEPPTEKLQA
FT                   VASFRVSLPVSFAAAGFSGLGMELWDSCMLVSTLPLSHILKLLSLSM"
FT   assembly_gap    1253789..1254525
FT                   /estimated_length=737
FT                   /gap_type="unknown"
FT   assembly_gap    1262143..1262315
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    1264041..1264060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1271015..1271423
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    1275838..1275987
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   gene            complement(<1279518..>1280263)
FT                   /locus_tag="mCG_7455"
FT                   /note="gene_id=mCG7455.2"
FT   mRNA            complement(join(<1279518..1280197,1280212..>1280263))
FT                   /locus_tag="mCG_7455"
FT                   /product="mCG7455"
FT                   /note="gene_id=mCG7455.2 transcript_id=mCT6549.2 created on
FT                   05-SEP-2002"
FT   CDS             complement(1279518..>1279952)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7455"
FT                   /product="mCG7455"
FT                   /note="gene_id=mCG7455.2 transcript_id=mCT6549.2
FT                   protein_id=mCP1162.2"
FT                   /protein_id="EDL34145.1"
FT                   /translation="QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMDTMICGWDK
FT                   RGPGLYYVDSEGNRISGTAFAVGSGFVYAYGVMDRGYSYDLKVEEAYDLACQAIYQATY
FT                   RDAYSGGAVNLYHVQEDGWIRVSSDTVADLHDKYSSVSVP"
FT   assembly_gap    1286812..1286831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1295321..1301127
FT                   /locus_tag="mCG_7453"
FT                   /note="gene_id=mCG7453.2"
FT   mRNA            join(1295321..1296213,1297036..1297170,1300246..1300426,
FT                   1300824..1301127)
FT                   /locus_tag="mCG_7453"
FT                   /product="mCG7453"
FT                   /note="gene_id=mCG7453.2 transcript_id=mCT6558.2 created on
FT                   05-SEP-2002"
FT   CDS             join(1295563..1296213,1297036..1297170,1300246..1300426,
FT                   1300824..1301053)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7453"
FT                   /product="mCG7453"
FT                   /note="gene_id=mCG7453.2 transcript_id=mCT6558.2
FT                   protein_id=mCP1167.2"
FT                   /protein_id="EDL34146.1"
FT                   /translation="MEGLTKTGEDNLFESVTEKKIKQPNGFCDSYSASQYGIIENVNKH
FT                   NFQAKPQSGHYDPEDIPKHFDGLPQNTYQDLLESQGHFNSHRQGSGDNNINSRVNRTQA
FT                   SCFSNNYMMGDLRHNQGFQQLGSNGFPLRSTHPFGHSVVPLLDSYDLFSYDDLSHLYPY
FT                   FNDMMYGDNSFSGFVPTFGFQRPIKTRSGPASELHIRLEECYEQWRALEKERKKTELAL
FT                   AKNYPGKKVSSTNNTPIPRLTSNPSRVDRLIVDELREQARVVTLLGKMERLRSSPLHAN
FT                   ISTALDRHLESIHIVQSRRKDEIVNASNRQRQGVPRCQDDRDVFALATAIKEMCVATRK
FT                   ARTTLWCALQMTLPKTASTAGQADMEKAFQDLVNCEEKVHESINSSNPMNQRGETSKH"
FT   gene            complement(1305002..1318030)
FT                   /gene="Ccdc43"
FT                   /locus_tag="mCG_7458"
FT                   /note="gene_id=mCG7458.1"
FT   mRNA            complement(join(1305002..1306814,1309118..1309176,
FT                   1310518..1310653,1312366..1312453,1317814..1318030))
FT                   /gene="Ccdc43"
FT                   /locus_tag="mCG_7458"
FT                   /product="coiled-coil domain containing 43"
FT                   /note="gene_id=mCG7458.1 transcript_id=mCT6543.2 created on
FT                   18-JUL-2002"
FT   CDS             complement(join(1306627..1306814,1309118..1309176,
FT                   1310518..1310653,1312366..1312453,1317814..1318011))
FT                   /codon_start=1
FT                   /gene="Ccdc43"
FT                   /locus_tag="mCG_7458"
FT                   /product="coiled-coil domain containing 43"
FT                   /note="gene_id=mCG7458.1 transcript_id=mCT6543.2
FT                   protein_id=mCP1161.1"
FT                   /protein_id="EDL34147.1"
FT                   /translation="MAAPSEVAAAVLGEGDGGAFGSWLDGRLEALGVDRAVYAAYILGV
FT                   LQEEEEEEKLDALQGILSAFLEEESLLDICKEIVERWSETRDVTTKVKKEDEVQAIATL
FT                   IEKQAQIVVKPRVVSEEEKQRKAALLAQYADVTDEEDEADKKDDAGASTANVSSDRTLF
FT                   RNTNVEDVLNARKLERDSLRDESQRKKEQDKLQREKDKLAKQERKEKEKKRTQKGERKR
FT                   "
FT   assembly_gap    1314190..1314209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1320136..1321533)
FT                   /locus_tag="mCG_1042069"
FT                   /note="gene_id=mCG1042069.1"
FT   mRNA            complement(1320136..1321533)
FT                   /locus_tag="mCG_1042069"
FT                   /product="mCG1042069"
FT                   /note="gene_id=mCG1042069.1 transcript_id=mCT159773.1
FT                   created on 05-SEP-2002"
FT   CDS             complement(1320503..1320820)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042069"
FT                   /product="mCG1042069"
FT                   /note="gene_id=mCG1042069.1 transcript_id=mCT159773.1
FT                   protein_id=mCP75442.1"
FT                   /protein_id="EDL34148.1"
FT                   /translation="MPYSFLPFLLPVCLSLSFLLFLSLFFFLSLSLSLSLSFFLFFLFL
FT                   FFETGSHYVALAVLELTISLCRLGWPRTQKSTCLCLPNAGIKFMHNYTWIQCHSLSIQK
FT                   P"
FT   assembly_gap    1339405..1339682
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    1341265..1341422
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    1351175..1351326
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    1354279..1354311
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    1365837..1366160
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    1369996..1370459
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   assembly_gap    1374148..1374500
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    1381850..1382349
FT                   /estimated_length=500
FT                   /gap_type="unknown"
FT   gene            1382386..1399799
FT                   /gene="Adam11"
FT                   /locus_tag="mCG_7457"
FT                   /note="gene_id=mCG7457.1"
FT   mRNA            join(1382386..1382464,1382924..1383108,1390643..1390719,
FT                   1390870..1390936,1391983..1392068,1392183..1392258,
FT                   1392663..1392729,1392793..1392860,1393203..1393277,
FT                   1393360..1393431,1393583..1393749,1394145..1394229,
FT                   1394328..1394418,1394526..1394577,1395017..1395116,
FT                   1395193..1395264,1395383..1395475,1395782..1395862,
FT                   1396405..1396455,1396548..1396611,1396821..1396920,
FT                   1397071..1397190,1397284..1397452,1397544..1397658,
FT                   1397743..1397833,1398866..1399799)
FT                   /gene="Adam11"
FT                   /locus_tag="mCG_7457"
FT                   /product="a disintegrin and metallopeptidase domain 11,
FT                   transcript variant mCT6546"
FT                   /note="gene_id=mCG7457.1 transcript_id=mCT6546.2 created on
FT                   18-JUL-2002"
FT   mRNA            join(1382386..1382464,1382924..1383108,1390643..1390719,
FT                   1390870..1390936,1391983..1392068,1392183..1392258,
FT                   1392663..1392729,1392793..1392860,1393203..1393277,
FT                   1393360..1393431,1393583..1393749,1394145..1394229,
FT                   1394328..1394418,1394526..1394577,1395017..1395116,
FT                   1395193..1395264,1395383..1395475,1395782..1395862,
FT                   1396405..1396455,1396548..1396611,1396821..1396920,
FT                   1397071..1397190,1397284..1397452,1397544..1397658,
FT                   1397743..1397833,1398386..1398451)
FT                   /gene="Adam11"
FT                   /locus_tag="mCG_7457"
FT                   /product="a disintegrin and metallopeptidase domain 11,
FT                   transcript variant mCT170734"
FT                   /note="gene_id=mCG7457.1 transcript_id=mCT170734.0 created
FT                   on 18-JUL-2002"
FT   CDS             join(1382401..1382464,1382924..1383108,1390643..1390719,
FT                   1390870..1390936,1391983..1392068,1392183..1392258,
FT                   1392663..1392729,1392793..1392860,1393203..1393277,
FT                   1393360..1393431,1393583..1393749,1394145..1394229,
FT                   1394328..1394418,1394526..1394577,1395017..1395116,
FT                   1395193..1395264,1395383..1395475,1395782..1395862,
FT                   1396405..1396455,1396548..1396611,1396821..1396920,
FT                   1397071..1397190,1397284..1397452,1397544..1397658,
FT                   1397743..1397833,1398866..1399058)
FT                   /codon_start=1
FT                   /gene="Adam11"
FT                   /locus_tag="mCG_7457"
FT                   /product="a disintegrin and metallopeptidase domain 11,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7457.1 transcript_id=mCT6546.2
FT                   protein_id=mCP1164.2 isoform=CRA_b"
FT                   /protein_id="EDL34150.1"
FT                   /translation="MRRLRRWAIAALLLLPLLPPPGLGALGPRGALHWRSSAHVGSPES
FT                   PEGSEVTEPSRLVRQSSGGEVRKPQLDTRVRQDPPRGTPVHLAQVSFVIPAFDSNFTLD
FT                   LELNHHLLSSQYVERHFSREGTRQHSTGAGDHCYYHGKLRGNPQSFAALSTCQGLHGVF
FT                   SDGNLTYIVEPKEIAGPWGPPQGPLPHLIYRTPLLPAPLGCREPGCLFAVPAQSALPNW
FT                   PKLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIY
FT                   KEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQ
FT                   STSSGAAYVGGICSLSRGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCP
FT                   DIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEA
FT                   GEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLCCRRCKYEPRGVSCREAVNECDIA
FT                   ETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQALWGHAAADRFCYEKLN
FT                   VEGTERGNCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLGGDISSVTFYHQGKEL
FT                   DCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCPGSGERRICSHHG
FT                   VCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSIAGAVLVAAI
FT                   VLGGTGWGFKCPLSIPGPEGPKCHPAPSEPGTHHLGPEPRGCLHPATEGGTVQMSSGSE
FT                   PFNSWLHRGWGLGL"
FT   CDS             join(1382401..1382464,1382924..1383108,1390643..1390719,
FT                   1390870..1390936,1391983..1392068,1392183..1392258,
FT                   1392663..1392729,1392793..1392860,1393203..1393277,
FT                   1393360..1393431,1393583..1393749,1394145..1394229,
FT                   1394328..1394418,1394526..1394577,1395017..1395116,
FT                   1395193..1395264,1395383..1395475,1395782..1395862,
FT                   1396405..1396455,1396548..1396611,1396821..1396920,
FT                   1397071..1397190,1397284..1397452,1397544..1397658,
FT                   1397743..1397833,1398386..1398434)
FT                   /codon_start=1
FT                   /gene="Adam11"
FT                   /locus_tag="mCG_7457"
FT                   /product="a disintegrin and metallopeptidase domain 11,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7457.1 transcript_id=mCT170734.0
FT                   protein_id=mCP93652.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q7TQG7"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013111"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034027"
FT                   /db_xref="MGI:MGI:1098667"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQG7"
FT                   /protein_id="EDL34149.1"
FT                   /translation="MRRLRRWAIAALLLLPLLPPPGLGALGPRGALHWRSSAHVGSPES
FT                   PEGSEVTEPSRLVRQSSGGEVRKPQLDTRVRQDPPRGTPVHLAQVSFVIPAFDSNFTLD
FT                   LELNHHLLSSQYVERHFSREGTRQHSTGAGDHCYYHGKLRGNPQSFAALSTCQGLHGVF
FT                   SDGNLTYIVEPKEIAGPWGPPQGPLPHLIYRTPLLPAPLGCREPGCLFAVPAQSALPNW
FT                   PKLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIY
FT                   KEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQ
FT                   STSSGAAYVGGICSLSRGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCP
FT                   DIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEA
FT                   GEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLCCRRCKYEPRGVSCREAVNECDIA
FT                   ETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQALWGHAAADRFCYEKLN
FT                   VEGTERGNCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLGGDISSVTFYHQGKEL
FT                   DCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCPGSGERRICSHHG
FT                   VCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSIAGAVLVAAI
FT                   VLGGTGWGFKNIRRGRYDPTQQGAV"
FT   assembly_gap    1386165..1386184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1392108..1392127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1407177..1407196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1408936..1408955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1414526..1414571
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    1416631..1417357
FT                   /estimated_length=727
FT                   /gap_type="unknown"
FT   gene            complement(1421086..>1427252)
FT                   /gene="Gja7"
FT                   /locus_tag="mCG_7456"
FT                   /note="gene_id=mCG7456.3"
FT   mRNA            complement(join(1421086..1422803,1424295..1424370,
FT                   1425739..1426483))
FT                   /gene="Gja7"
FT                   /locus_tag="mCG_7456"
FT                   /product="gap junction membrane channel protein alpha 7,
FT                   transcript variant mCT6550"
FT                   /note="gene_id=mCG7456.3 transcript_id=mCT6550.2 created on
FT                   18-JUL-2002"
FT   CDS             complement(1421593..1422783)
FT                   /codon_start=1
FT                   /gene="Gja7"
FT                   /locus_tag="mCG_7456"
FT                   /product="gap junction membrane channel protein alpha 7,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7456.3 transcript_id=mCT6550.2
FT                   protein_id=mCP1163.2 isoform=CRA_b"
FT                   /protein_id="EDL34152.1"
FT                   /translation="MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYY
FT                   DEQSKFVCNTEQPGCENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEH
FT                   GEADKKAARSKPYAMRWKQHRALEETEEDHEEDPMMYPEMELESEKENKEQSQPKPKHD
FT                   GRRRIREDGLMKIYVLQLLARTVFEVGFLIGQYFLYGFQVHPFYVCSRLPCPHKIDCFI
FT                   SRPTEKTIFLLIMYGVTGLCLLLNIWEMLHLGFGTIRDSLNSKRRELDDPGAYNYPFTW
FT                   NTPSAPPGYNIAVKPDQIQYTELSNAKIAYKQNKANIAQEQQYGSHEEHLPADLETLQR
FT                   EIRMAQERLDLAIQAYHHQNNPHGPREKKAKVGSKSGSNKSSISSKSGDGKTSVWI"
FT   mRNA            complement(join(<1422339..1422803,1424295..>1427252))
FT                   /gene="Gja7"
FT                   /locus_tag="mCG_7456"
FT                   /product="gap junction membrane channel protein alpha 7,
FT                   transcript variant mCT193275"
FT                   /note="gene_id=mCG7456.3 transcript_id=mCT193275.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<1422339..1422803,1424295..>1424298))
FT                   /codon_start=1
FT                   /gene="Gja7"
FT                   /locus_tag="mCG_7456"
FT                   /product="gap junction membrane channel protein alpha 7,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7456.3 transcript_id=mCT193275.0
FT                   protein_id=mCP114249.0 isoform=CRA_a"
FT                   /protein_id="EDL34151.1"
FT                   /translation="TGQTNSTTMSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTA
FT                   VGGESIYYDEQSKFVCNTEQPGCENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAI
FT                   HKIAKMEHGEADKKAARSKPYAMRWKQHRALEETEEDHEEDPMMYPEMELES"
FT   assembly_gap    1440076..1443186
FT                   /estimated_length=3111
FT                   /gap_type="unknown"
FT   assembly_gap    1450832..1450851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1455668..1457094
FT                   /estimated_length=1427
FT                   /gap_type="unknown"
FT   gene            1457493..1459621
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /note="gene_id=mCG7447.2"
FT   mRNA            join(1457493..1457541,1458194..1458343,1458815..1458949,
FT                   1459489..1459621)
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /product="HIG1 domain family, member 1B, transcript variant
FT                   mCT171106"
FT                   /note="gene_id=mCG7447.2 transcript_id=mCT171106.0 created
FT                   on 22-JUL-2002"
FT   mRNA            join(1457877..1458343,1458815..1458949,1459489..1459620)
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /product="HIG1 domain family, member 1B, transcript variant
FT                   mCT6553"
FT                   /note="gene_id=mCG7447.2 transcript_id=mCT6553.2 created on
FT                   22-JUL-2002"
FT   mRNA            join(1458027..1458105,1458194..1458343,1458815..1458949,
FT                   1459489..1459619)
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /product="HIG1 domain family, member 1B, transcript variant
FT                   mCT171105"
FT                   /note="gene_id=mCG7447.2 transcript_id=mCT171105.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(1458244..1458343,1458815..1458949,1459489..1459550)
FT                   /codon_start=1
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /product="HIG1 domain family, member 1B, isoform CRA_a"
FT                   /note="gene_id=mCG7447.2 transcript_id=mCT171105.0
FT                   protein_id=mCP94023.0 isoform=CRA_a"
FT                   /protein_id="EDL34153.1"
FT                   /translation="MSANKGWWVPPEGEDNLSKKFLRKTRESPLVPIGVAGCLVIAAYR
FT                   IYRLKARGSTKLSIHLIHTRVAAQACAVGAIMLGAMYTMYRDYIKRVSEDAEK"
FT   CDS             join(1458244..1458343,1458815..1458949,1459489..1459550)
FT                   /codon_start=1
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /product="HIG1 domain family, member 1B, isoform CRA_a"
FT                   /note="gene_id=mCG7447.2 transcript_id=mCT171106.0
FT                   protein_id=mCP94024.0 isoform=CRA_a"
FT                   /protein_id="EDL34154.1"
FT                   /translation="MSANKGWWVPPEGEDNLSKKFLRKTRESPLVPIGVAGCLVIAAYR
FT                   IYRLKARGSTKLSIHLIHTRVAAQACAVGAIMLGAMYTMYRDYIKRVSEDAEK"
FT   CDS             join(1458244..1458343,1458815..1458949,1459489..1459550)
FT                   /codon_start=1
FT                   /gene="Higd1b"
FT                   /locus_tag="mCG_7447"
FT                   /product="HIG1 domain family, member 1B, isoform CRA_a"
FT                   /note="gene_id=mCG7447.2 transcript_id=mCT6553.2
FT                   protein_id=mCP1166.1 isoform=CRA_a"
FT                   /protein_id="EDL34155.1"
FT                   /translation="MSANKGWWVPPEGEDNLSKKFLRKTRESPLVPIGVAGCLVIAAYR
FT                   IYRLKARGSTKLSIHLIHTRVAAQACAVGAIMLGAMYTMYRDYIKRVSEDAEK"
FT   gene            complement(<1460382..1501875)
FT                   /gene="Eftud2"
FT                   /locus_tag="mCG_49887"
FT                   /note="gene_id=mCG49887.2"
FT   mRNA            complement(join(<1460382..1460477,1460731..1460838,
FT                   1461001..1461154,1461605..1461699,1461845..1461963,
FT                   1462750..1462837,1462981..1463107,1463262..1463348,
FT                   1464934..1465016,1465724..1465825,1467678..1467818,
FT                   1468167..1468278,1469594..1469787,1470821..1470948,
FT                   1473394..1473529,1476424..1476514,1476869..1476932,
FT                   1481648..1481772,1484256..1484422,1486353..1486435,
FT                   1487215..1487305,1489691..1489726,1490432..1490497,
FT                   1490940..1491015,1492013..1492091,1492865..1493030,
FT                   1498524..1498632,1501804..1501875))
FT                   /gene="Eftud2"
FT                   /locus_tag="mCG_49887"
FT                   /product="elongation factor Tu GTP binding domain
FT                   containing 2"
FT                   /note="gene_id=mCG49887.2 transcript_id=mCT50070.2 created
FT                   on 18-JUL-2002"
FT   CDS             complement(join(1460382..1460477,1460731..1460838,
FT                   1461001..1461154,1461605..1461699,1461845..1461963,
FT                   1462750..1462837,1462981..1463107,1463262..1463348,
FT                   1464934..1465016,1465724..1465825,1467678..1467818,
FT                   1468167..1468278,1469594..1469787,1470821..1470948,
FT                   1473394..1473529,1476424..1476514,1476869..1476932,
FT                   1481648..1481772,1484256..1484422,1486353..1486435,
FT                   1487215..1487305,1489691..1489726,1490432..1490497,
FT                   1490940..1491015,1492013..1492091,1492865..1493030,
FT                   1498524..1498628))
FT                   /codon_start=1
FT                   /gene="Eftud2"
FT                   /locus_tag="mCG_49887"
FT                   /product="elongation factor Tu GTP binding domain
FT                   containing 2"
FT                   /note="gene_id=mCG49887.2 transcript_id=mCT50070.2
FT                   protein_id=mCP24049.1"
FT                   /db_xref="GOA:A2AH85"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031950"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035655"
FT                   /db_xref="MGI:MGI:1336880"
FT                   /db_xref="UniProtKB/TrEMBL:A2AH85"
FT                   /protein_id="EDL34156.1"
FT                   /translation="MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDEDEDEDDV
FT                   GEHEDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTL
FT                   MEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQ
FT                   DLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRIS
FT                   DGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHI
FT                   VDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFA
FT                   KRLWGDIYFNPKTRKFTKKAPSSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDEL
FT                   GIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVD
FT                   SDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLE
FT                   DEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQI
FT                   FRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGEL
FT                   YLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEK
FT                   GLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSE
FT                   VDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTA
FT                   RRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTI
FT                   KAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLA
FT                   REFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM"
FT   assembly_gap    1488726..1488944
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   gene            1502144..1505259
FT                   /gene="Ccdc103"
FT                   /locus_tag="mCG_7446"
FT                   /note="gene_id=mCG7446.1"
FT   mRNA            join(1502144..1502224,1503265..1503340,1503454..1503605,
FT                   1503983..1504115,1504756..1505259)
FT                   /gene="Ccdc103"
FT                   /locus_tag="mCG_7446"
FT                   /product="coiled-coil domain containing 103, transcript
FT                   variant mCT6552"
FT                   /note="gene_id=mCG7446.1 transcript_id=mCT6552.2 created on
FT                   04-APR-2003"
FT   mRNA            join(1502155..1502224,1503261..1503340,1503454..1503605,
FT                   1503983..1504115,1504756..1505249)
FT                   /gene="Ccdc103"
FT                   /locus_tag="mCG_7446"
FT                   /product="coiled-coil domain containing 103, transcript
FT                   variant mCT181706"
FT                   /note="gene_id=mCG7446.1 transcript_id=mCT181706.0 created
FT                   on 04-APR-2003"
FT   CDS             join(1503463..1503605,1503983..1504115,1504756..1505193)
FT                   /codon_start=1
FT                   /gene="Ccdc103"
FT                   /locus_tag="mCG_7446"
FT                   /product="coiled-coil domain containing 103, isoform CRA_a"
FT                   /note="gene_id=mCG7446.1 transcript_id=mCT181706.0
FT                   protein_id=mCP104628.0 isoform=CRA_a"
FT                   /protein_id="EDL34157.1"
FT                   /translation="MEKNDVINFKALEKELQAALAADEKYKRENAAKLRAVEQRVPSYE
FT                   EFRGIVLASHLKPLEQKDKMGGKRFVPWNCHTTRERTSQDVVTEIPQEKSPFQPTTSAE
FT                   FYRDWRRHLRSGPERYQALLQLGGPKLGHLFQMDVGFGLLGELLVALAEHTRLSDRTAV
FT                   LGILHSLANTGRFNLNLSLLSHAERESCQRLFQKLQAMSTTRPMQEGLTVEEPSAGLQG
FT                   EEGLLQELLELYGVH"
FT   CDS             join(1503463..1503605,1503983..1504115,1504756..1505193)
FT                   /codon_start=1
FT                   /gene="Ccdc103"
FT                   /locus_tag="mCG_7446"
FT                   /product="coiled-coil domain containing 103, isoform CRA_a"
FT                   /note="gene_id=mCG7446.1 transcript_id=mCT6552.2
FT                   protein_id=mCP1165.1 isoform=CRA_a"
FT                   /protein_id="EDL34158.1"
FT                   /translation="MEKNDVINFKALEKELQAALAADEKYKRENAAKLRAVEQRVPSYE
FT                   EFRGIVLASHLKPLEQKDKMGGKRFVPWNCHTTRERTSQDVVTEIPQEKSPFQPTTSAE
FT                   FYRDWRRHLRSGPERYQALLQLGGPKLGHLFQMDVGFGLLGELLVALAEHTRLSDRTAV
FT                   LGILHSLANTGRFNLNLSLLSHAERESCQRLFQKLQAMSTTRPMQEGLTVEEPSAGLQG
FT                   EEGLLQELLELYGVH"
FT   gene            1505456..1507630
FT                   /gene="4933439F11Rik"
FT                   /locus_tag="mCG_7452"
FT                   /note="gene_id=mCG7452.1"
FT   mRNA            1505456..1507630
FT                   /gene="4933439F11Rik"
FT                   /locus_tag="mCG_7452"
FT                   /product="RIKEN cDNA 4933439F11"
FT                   /note="gene_id=mCG7452.1 transcript_id=mCT6547.1 created on
FT                   18-JUL-2002"
FT   CDS             1506271..1507524
FT                   /codon_start=1
FT                   /gene="4933439F11Rik"
FT                   /locus_tag="mCG_7452"
FT                   /product="RIKEN cDNA 4933439F11"
FT                   /note="gene_id=mCG7452.1 transcript_id=mCT6547.1
FT                   protein_id=mCP1171.1"
FT                   /protein_id="EDL34159.1"
FT                   /translation="MSLAHTTVLLWAWGSLQAFEIVEKESVFQRTPCPAFLVFDNAAYL
FT                   ADMSFELPCHCKPEDVSAVVWYYQKHLGSKRTTVLTDFDGRLLTEAAHVRVGSSMLVRF
FT                   SIRMFSLLVFRAQPEDTGLYFCGTREGDYFYAYDVDIQSNKEIVASFKDMAQEPLPDEY
FT                   YGALHVFTTFWEWTPCDRCGVRGEQWRFGLCYLQYPDLSPRYIKTRSDVVSCGSGAVPW
FT                   KLHLQTKYHTPELQFQSCLVSCQKRNKTRKGVLAIYSYVSKLGSRPWVPQVPIQFHQQR
FT                   LGHGLIISCPGARPEHAVAWDKDNQPLYRAQYLKGVNRSMRVFIDHGNHLHIRFTQLSD
FT                   RGIYYCWLQGLKIAGFRLGVITRGRYPASLSDPETRTAIELTLMGYLLITIFFITIHLC
FT                   RCCCQSRCCPNFSAQTLL"
FT   gene            complement(1508233..>1517997)
FT                   /gene="Gfap"
FT                   /locus_tag="mCG_7451"
FT                   /note="gene_id=mCG7451.1"
FT   mRNA            complement(join(1508233..1509605,1510328..1510413,
FT                   1512790..1512833,1513911..1514133,1514332..1514457,
FT                   1515249..1515410,1516357..1516452,1516635..1516695,
FT                   1517546..>1517997))
FT                   /gene="Gfap"
FT                   /locus_tag="mCG_7451"
FT                   /product="glial fibrillary acidic protein"
FT                   /note="gene_id=mCG7451.1 transcript_id=mCT6551.2 created on
FT                   05-SEP-2002"
FT   CDS             complement(join(1513972..1514133,1514332..1514457,
FT                   1515249..1515410,1516357..1516452,1516635..1516695,
FT                   1517546..1517997))
FT                   /codon_start=1
FT                   /gene="Gfap"
FT                   /locus_tag="mCG_7451"
FT                   /product="glial fibrillary acidic protein"
FT                   /note="gene_id=mCG7451.1 transcript_id=mCT6551.2
FT                   protein_id=mCP1160.2"
FT                   /protein_id="EDL34160.1"
FT                   /translation="MERRRITSARRSYASETVVRGLGPSRQLGTMPRFSLSRMTPPLPA
FT                   RVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAK
FT                   EPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLGTLRQKLQDETNLRLEAE
FT                   NNLAAYRQEADEATLARVDLERKVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMD
FT                   VAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEAND
FT                   YRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLGGGGPKPQGGDG
FT                   PPPAGVPGSTQR"
FT   assembly_gap    1518475..1518494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1526895..1546516)
FT                   /gene="3000004C01Rik"
FT                   /locus_tag="mCG_7449"
FT                   /note="gene_id=mCG7449.1"
FT   mRNA            complement(join(1526895..1527598,1527818..1527903,
FT                   1528318..1528398,1529435..1529960,1530209..1530414,
FT                   1533674..1533789,1534243..1534411,1534773..1534873,
FT                   1535007..1535081,1535573..1535785,1535862..1536059,
FT                   1536138..1536248,1536455..1536577,1536866..1537023,
FT                   1537512..1537838,1546410..1546516))
FT                   /gene="3000004C01Rik"
FT                   /locus_tag="mCG_7449"
FT                   /product="RIKEN cDNA 3000004C01"
FT                   /note="gene_id=mCG7449.1 transcript_id=mCT6555.2 created on
FT                   05-SEP-2002"
FT   CDS             complement(join(1527522..1527598,1527818..1527903,
FT                   1528318..1528398,1529435..1529960,1530209..1530414,
FT                   1533674..1533789,1534243..1534411,1534773..1534873,
FT                   1535007..1535081,1535573..1535785,1535862..1536059,
FT                   1536138..1536248,1536455..1536577,1536866..1537023,
FT                   1537512..1537830))
FT                   /codon_start=1
FT                   /gene="3000004C01Rik"
FT                   /locus_tag="mCG_7449"
FT                   /product="RIKEN cDNA 3000004C01"
FT                   /note="gene_id=mCG7449.1 transcript_id=mCT6555.2
FT                   protein_id=mCP1169.2"
FT                   /protein_id="EDL34161.1"
FT                   /translation="MVMAVEDSVVRVVVRVRPPTPKELESQRRPVIQVVDERMLVFDPE
FT                   ECDGGFPGLKWSGSHNGPKKKGKDLTFVFDRVFGEMATQEDVFQHTTHNILDSFLQGYN
FT                   CSVFAYGATGAGKTHTMLGREGEPGIMYLTTMELYRRLEARQEEKQFEVLISYLEVYNE
FT                   QIHDLLEPKGPLTIREDPDKGVVVPGLSFHQVFAGPQPASAEQLLEMLTRGNCSRTQHP
FT                   TDANATSSRSHAIFQIFVKQQDRVPGLTQALRVAKMSLIDLAGSERASSTHAKGERLRE
FT                   GANINRSLLALINVLNALADAKGNLTQLRTYCRQGRKSHVPYRDSKLTRLLKDSIGGNC
FT                   RTVMIAAISPSSLTYEDTYNTLKYADRAKEIRLTLKSNVISVDHHISQYATICQQLQAE
FT                   VAFLREKLQMYEAGAQALQQQCSPQPPTLSIPQSLSSSSLQPGPSSQSSTLECHAKNET
FT                   LQEESLGSDAQGQEIVEESASEQEQCPQDKQCPTQKPEPNLPGSPSPSVQAKPGTGQHS
FT                   PQKQDADHSKQLALQVLRLAQRQYSLLQAANLLTPDMISEFETLQQLVLEESVDHRAES
FT                   PRSPALARGDPLAQALCSESKSSGYCGPVTRTMAKQLNGLTHTLGALLAPDCTSDKTFQ
FT                   KPTKEKKRKLTPEEPGSLPAPNLEMKRQRQSFLPCLRRGSLPKAQPCSEPRTPKRERAS
FT                   SPSPSSRVCPATVIKSRVPLGPSALQNCSTPLALPTRDLNTTFNVSEESPSKPSFQEFV
FT                   DWEKVSPELNSTDQPFLPSAPVFIFTKGRKPSLPAVTASKKRRTMRPSVSRGRSCIARL
FT                   HSSTLKKPNRPFTVPEPPLSPHCLDDQRTPKGLTGVTESY"
FT   gene            complement(1560720..>1567915)
FT                   /gene="C1ql1"
FT                   /locus_tag="mCG_7450"
FT                   /note="gene_id=mCG7450.2"
FT   mRNA            complement(join(1560720..1561366,1567319..>1567915))
FT                   /gene="C1ql1"
FT                   /locus_tag="mCG_7450"
FT                   /product="complement component 1, q subcomponent-like 1"
FT                   /note="gene_id=mCG7450.2 transcript_id=mCT6556.1 created on
FT                   22-JUL-2002"
FT   CDS             complement(join(1561187..1561366,1567319..1567915))
FT                   /codon_start=1
FT                   /gene="C1ql1"
FT                   /locus_tag="mCG_7450"
FT                   /product="complement component 1, q subcomponent-like 1"
FT                   /note="gene_id=mCG7450.2 transcript_id=mCT6556.1
FT                   protein_id=mCP1170.0"
FT                   /db_xref="GOA:O88992"
FT                   /db_xref="InterPro:IPR001073"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="MGI:MGI:1344400"
FT                   /db_xref="PDB:4D7Y"
FT                   /db_xref="PDB:4QQ2"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88992"
FT                   /protein_id="EDL34162.1"
FT                   /translation="MLLVLVVLIPVLVSSGGPDGHYEMLGTCRMVCDPYPARGPGAGAR
FT                   SDGGDALSEQSGAPPPSTLVQGPQGKPGRTGKPGPPGPPGDRGPPGPVGPPGEKGEPGK
FT                   PGPPGLPGSGGSGAISTATYTTVPRVAFYAGLKNPHEGYEVLKFDDVVTNLGNNYDAAS
FT                   GKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVIL
FT                   HLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD"
FT   assembly_gap    1571224..1571324
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   gene            complement(1579778..1585625)
FT                   /locus_tag="mCG_1042027"
FT                   /note="gene_id=mCG1042027.0"
FT   mRNA            complement(join(1579778..1580369,1583281..1583500,
FT                   1585493..1585625))
FT                   /locus_tag="mCG_1042027"
FT                   /product="mCG1042027"
FT                   /note="gene_id=mCG1042027.0 transcript_id=mCT159731.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(1580205..1580369,1583281..1583376))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042027"
FT                   /product="mCG1042027"
FT                   /note="gene_id=mCG1042027.0 transcript_id=mCT159731.0
FT                   protein_id=mCP75009.1"
FT                   /protein_id="EDL34163.1"
FT                   /translation="MMEVDQMAGMMELNPEGFLVVVGTICSTILLQCLYYRQSTLHLAF
FT                   GSFSSLQLEEQDVQVSKLCLMTLPLDPRGVALLCGLLIFNF"
FT   assembly_gap    1592723..1592742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1598579..1598755
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    1607536..1607915
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    1613286..1613564
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   gene            complement(1616418..1646001)
FT                   /gene="Dcakd"
FT                   /locus_tag="mCG_7448"
FT                   /note="gene_id=mCG7448.2"
FT   mRNA            complement(join(1616418..1617543,1619724..1619811,
FT                   1622016..1622219,1622522..1622728,1645902..1646001))
FT                   /gene="Dcakd"
FT                   /locus_tag="mCG_7448"
FT                   /product="dephospho-CoA kinase domain containing,
FT                   transcript variant mCT171104"
FT                   /note="gene_id=mCG7448.2 transcript_id=mCT171104.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(1616420..1617543,1619724..>1619921))
FT                   /gene="Dcakd"
FT                   /locus_tag="mCG_7448"
FT                   /product="dephospho-CoA kinase domain containing,
FT                   transcript variant mCT6554"
FT                   /note="gene_id=mCG7448.2 transcript_id=mCT6554.1 created on
FT                   23-JUL-2002"
FT   CDS             complement(join(1617252..1617543,1619724..1619811,
FT                   1622016..1622219,1622522..1622633))
FT                   /codon_start=1
FT                   /gene="Dcakd"
FT                   /locus_tag="mCG_7448"
FT                   /product="dephospho-CoA kinase domain containing, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG7448.2 transcript_id=mCT171104.0
FT                   protein_id=mCP94022.0 isoform=CRA_a"
FT                   /protein_id="EDL34164.1"
FT                   /translation="MFLVGLTGGIASGKSSVIQVFQQLGCAVIDVDVIARHVVQPGYPA
FT                   HRRIVEAFGTEVLLENGDIDRKVLGDLIFNQPDRRQLLNSITHPEIRKEMMKETFKYFL
FT                   RGYRYVILDIPLLFETKKLLKYMKHTVVVYCDRDTQLARLMKRNNLNREDAEARINAQL
FT                   PLKDKARMANHVLDNSGEWSLTRRQAILLHAKLERSMEYLPLRLGFLTGLAGIASLLYL
FT                   LTRYLLPSP"
FT   CDS             complement(join(1617252..1617543,1619724..>1619845))
FT                   /codon_start=1
FT                   /gene="Dcakd"
FT                   /locus_tag="mCG_7448"
FT                   /product="dephospho-CoA kinase domain containing, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG7448.2 transcript_id=mCT6554.1
FT                   protein_id=mCP1168.0 isoform=CRA_b"
FT                   /protein_id="EDL34165.1"
FT                   /translation="PWEFCILSLSPGYRYVILDIPLLFETKKLLKYMKHTVVVYCDRDT
FT                   QLARLMKRNNLNREDAEARINAQLPLKDKARMANHVLDNSGEWSLTRRQAILLHAKLER
FT                   SMEYLPLRLGFLTGLAGIASLLYLLTRYLLPSP"
FT   gene            1621481..1623023
FT                   /locus_tag="mCG_148156"
FT                   /note="gene_id=mCG148156.0"
FT   mRNA            1621481..1623023
FT                   /locus_tag="mCG_148156"
FT                   /product="mCG148156"
FT                   /note="gene_id=mCG148156.0 transcript_id=mCT188419.0
FT                   created on 13-JAN-2004"
FT   CDS             1622419..1622664
FT                   /codon_start=1
FT                   /locus_tag="mCG_148156"
FT                   /product="mCG148156"
FT                   /note="gene_id=mCG148156.0 transcript_id=mCT188419.0
FT                   protein_id=mCP109334.0"
FT                   /protein_id="EDL34166.1"
FT                   /translation="MKNKQKNLQGKRRPGHSKKTESNDGSTGDAAVHSPCRAMTSTSIT
FT                   AQPSCWNTWMTELLPEAMPPVSPTRNIFPGERRQAR"
FT   assembly_gap    1629736..1629755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1630776..1630795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1635861..1635880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1637433..1637452
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1641193..1643340
FT                   /estimated_length=2148
FT                   /gap_type="unknown"
FT   assembly_gap    1645266..1645390
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   gene            complement(1650803..>1657239)
FT                   /locus_tag="mCG_1042073"
FT                   /note="gene_id=mCG1042073.0"
FT   mRNA            complement(join(1650803..1650841,1651162..1651205,
FT                   1654233..1654357,1654434..1654464,1656267..1656428,
FT                   1657156..>1657239))
FT                   /locus_tag="mCG_1042073"
FT                   /product="mCG1042073"
FT                   /note="gene_id=mCG1042073.0 transcript_id=mCT159777.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(1650816..1650841,1651162..1651205,
FT                   1654233..1654357,1654434..1654464,1656267..>1656367))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042073"
FT                   /product="mCG1042073"
FT                   /note="gene_id=mCG1042073.0 transcript_id=mCT159777.0
FT                   protein_id=mCP75467.0"
FT                   /protein_id="EDL34167.1"
FT                   /translation="ICIYLLCALCKASPSHQSHCWIQATSKDESVIARSPAEGVAQIKS
FT                   PERCVLSCLDLSFLWPLCLKISMPRSRSECCVFQPQEGDHRASFEWKYICSDERPKPRG
FT                   QLCF"
FT   assembly_gap    1650846..1651145
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    1652874..1652955
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    1653449..1653657
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   gene            1657352..1694267
FT                   /gene="Nmt1"
FT                   /locus_tag="mCG_19151"
FT                   /note="gene_id=mCG19151.2"
FT   mRNA            join(1657352..1657709,1672139..1672247,1675350..1675494,
FT                   1680561..1680679,1683551..1683642,1684736..1684852,
FT                   1685718..1685888,1686558..1686666,1688431..1688601,
FT                   1692438..1692467,1693222..1693359,1694212..1694267)
FT                   /gene="Nmt1"
FT                   /locus_tag="mCG_19151"
FT                   /product="N-myristoyltransferase 1"
FT                   /note="gene_id=mCG19151.2 transcript_id=mCT17742.2 created
FT                   on 23-JUL-2002"
FT   CDS             join(1657579..1657709,1672139..1672247,1675350..1675494,
FT                   1680561..1680679,1683551..1683642,1684736..1684852,
FT                   1685718..1685888,1686558..1686666,1688431..1688601,
FT                   1692438..1692467,1693222..1693359,1694212..1694232)
FT                   /codon_start=1
FT                   /gene="Nmt1"
FT                   /locus_tag="mCG_19151"
FT                   /product="N-myristoyltransferase 1"
FT                   /note="gene_id=mCG19151.2 transcript_id=mCT17742.2
FT                   protein_id=mCP14660.1"
FT                   /protein_id="EDL34168.1"
FT                   /translation="MADESETAVKLPAPSLPLMMEGNGNGHEHCSDCENEEDNSHNRSG
FT                   LSPANDTGAKKKKKKQKKKKEKGSDMESTQDQPVKMTSLPAERIQEIQKAIELFSVGQG
FT                   PAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDL
FT                   GDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKL
FT                   VGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVY
FT                   TAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRP
FT                   MEKKDIPVVHQLLSRYLKQFHLTPVMNQEEVEHWFYPQENIIDTFVVEMSDALVLAKMK
FT                   GFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ"
FT   assembly_gap    1660086..1660105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1662089..1662668
FT                   /estimated_length=580
FT                   /gap_type="unknown"
FT   assembly_gap    1692149..1692436
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   gene            complement(1698768..1720947)
FT                   /gene="Plcd3"
FT                   /locus_tag="mCG_19166"
FT                   /note="gene_id=mCG19166.2"
FT   mRNA            complement(join(1698768..1699393,1699474..1699623,
FT                   1699719..1699854,1700105..1700271,1702193..1702309,
FT                   1703024..1703174,1703322..1703468,1705179..1705331,
FT                   1705947..1706091,1706226..1706427,1706704..1706932,
FT                   1708005..1708134,1708657..1708885,1708975..1709137,
FT                   1720720..1720947))
FT                   /gene="Plcd3"
FT                   /locus_tag="mCG_19166"
FT                   /product="phospholipase C, delta 3"
FT                   /note="gene_id=mCG19166.2 transcript_id=mCT17870.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(1699305..1699393,1699474..1699623,
FT                   1699719..1699854,1700105..1700271,1702193..1702309,
FT                   1703024..1703174,1703322..1703468,1705179..1705331,
FT                   1705947..1706091,1706226..1706427,1706704..1706932,
FT                   1708005..1708134,1708657..1708885,1708975..1709125))
FT                   /codon_start=1
FT                   /gene="Plcd3"
FT                   /locus_tag="mCG_19166"
FT                   /product="phospholipase C, delta 3"
FT                   /note="gene_id=mCG19166.2 transcript_id=mCT17870.2
FT                   protein_id=mCP14643.2"
FT                   /protein_id="EDL34169.1"
FT                   /translation="MRMSKPCCGAPDSSRSAHARGTRQRLYRLQEDGLSVWFQRRIPRA
FT                   ASKHIFFVQHIEAVREGHQSEGLRRFGGAFAPACCLTIAFKGRRKNLDLAAPTAEEAQR
FT                   WVRGLAKLRARLDAMSQRERLDHWIHSYLHRADSDQDSKMSFKEIKSLLRMVNVDMNDM
FT                   YAYRLFKECDHSNNERLEGAEIEAFLRRLLKRPELEEIFRRYSGEDRVLSASELLEFLE
FT                   DQGEDGATLACAQQLIQTYELNETAKQHELMTLDGFMMYLLSPEGAALNVAHTCVFQDM
FT                   GQPLAHYFISSSHNTYLTDSQIGGTSSTEAYIRAFAQGCRCVELDCWEGPGGEPVIYHG
FT                   HTLTSKILFRDVIQAVRDHAFTSSPYPVILSLENHCGLEQQAVMARHLRSILGDMLVTQ
FT                   ALDSQNPEELPSPEQLKGRILVKGKKLPAARSEDGRILSDREEEEEEEEEAEEALEAAE
FT                   QRSRAKQISPELSALAVYCCATRLRTLDPSPGPPQSCTVGSLSERKARKFTREAGTSFV
FT                   RHNTQQLTRVYPLGLRMNSANYNPQEMWNSGCQLVALNFQTPGYEMDLNTGRFLINGQC
FT                   GYVLKPAYLRQLNTTFDPECPGPPRTTLAIQVLTAQQLPKLNAEKPSSIVDPLVRVEIH
FT                   GVPEDCAQKETDYVLNNGFNPCWEQTLQFRLRAPELVLVRFVVEDYDTTSPNDFVGQST
FT                   LPLSSLKQGYRHIHLLSKDGASLAPATLFVHIRIQNS"
FT   assembly_gap    1709245..1709409
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   gene            <1721033..1731542
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /note="gene_id=mCG19167.3"
FT   mRNA            join(<1721033..1721129,1722023..1722437,1722867..1723003,
FT                   1723459..1723518,1723779..1723899,1724149..1724235,
FT                   1724591..1724824,1725441..1725580,1730885..1731542)
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   transcript variant mCT193198"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT193198.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1721050..1721129,1722023..1722437,1722576..1722710,
FT                   1722867..1722985,1723241..1723361,1723434..1723518,
FT                   1723779..1723899,1724149..1724235,1724591..1724824,
FT                   1725441..1725580,1730885..1731542)
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   transcript variant mCT17871"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT17871.2 created
FT                   on 05-SEP-2002"
FT   mRNA            join(<1722023..1722437,1722867..1722985,1723241..1723361,
FT                   1723434..1723518,1723779..1723899,1724149..1724235,
FT                   1724591..1724824,1725441..1725580,1730885..1731525)
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   transcript variant mCT193197"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT193197.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1722359..1722437,1722576..1722710,1722867..1722985,
FT                   1723434..1723518,1723779..1723899,1724149..1724235,
FT                   1724591..1724824,1725441..1725580,1730885..1731542)
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   transcript variant mCT172763"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT172763.0 created
FT                   on 05-SEP-2002"
FT   CDS             join(<1722380..1722437,1722867..1723003,1723459..1723518,
FT                   1723779..1723899,1724149..1724235,1724591..1724824,
FT                   1725441..1725580,1730885..1731004)
FT                   /codon_start=1
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT193198.0
FT                   protein_id=mCP114154.0 isoform=CRA_c"
FT                   /protein_id="EDL34172.1"
FT                   /translation="LCIPPYPCPSGTRGQSEASESLQSRAPELEAAWVPRRKSPTVKNS
FT                   SRQQSASFRTCLRMVSLYRSMSREEAMSAYISEMKLVAQKVIDTVPLGEVAEDMFGYFE
FT                   PLYQVIPDMPRPPETFLRRATGWKEPLVQREDQAAPEPSCVPKEPVPPSPESRPPRDLD
FT                   LEVFCDSVEQLEPELVRLPVLSPVAAEPELCHLPPGIWDSSAQQVWAEQKEAAGRELTT
FT                   RSSPESTGEKEGLGGGLIGPQELDTWLVGTVRAMQESMKDVHRRLQSLESKPQPLKQRS
FT                   PRTRPWPLGLSVPTLLFFILWPFVVQWLFRQFRTQKR"
FT   CDS             join(<1722883..1722985,1723241..1723361,1723434..1723518,
FT                   1723779..1723899,1724149..1724235,1724591..1724824,
FT                   1725441..1725580,1730885..1731004)
FT                   /codon_start=1
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT193197.0
FT                   protein_id=mCP114153.0 isoform=CRA_b"
FT                   /protein_id="EDL34171.1"
FT                   /translation="GSRARSSMGTEKEEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEML
FT                   RFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNRLGKMSREEAMSAYISEMKLVAQKV
FT                   IDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRATGWKEPLVQREDQAAPEPSCV
FT                   PKEPVPPSPESRPPRDLDLEVFCDSVEQLEPELVRLPVLSPVAAEPELCHLPPGIWDSS
FT                   AQQVWAEQKEAAGRELTTRSSPESTGEKEGLGGGLIGPQELDTWLVGTVRAMQESMKDV
FT                   HRRLQSLESKPQPLKQRSPRTRPWPLGLSVPTLLFFILWPFVVQWLFRQFRTQKR"
FT   CDS             join(1722904..1722985,1723241..1723361,1723434..1723518,
FT                   1723779..1723899,1724149..1724235,1724591..1724824,
FT                   1725441..1725580,1730885..1731004)
FT                   /codon_start=1
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT17871.2
FT                   protein_id=mCP14667.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q80X94"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR022408"
FT                   /db_xref="MGI:MGI:1914381"
FT                   /db_xref="UniProtKB/TrEMBL:Q80X94"
FT                   /protein_id="EDL34170.1"
FT                   /translation="MGTEKEEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYK
FT                   QATMGPCLVPRPGFWDPIGRYKWDAWNRLGKMSREEAMSAYISEMKLVAQKVIDTVPLG
FT                   EVAEDMFGYFEPLYQVIPDMPRPPETFLRRATGWKEPLVQREDQAAPEPSCVPKEPVPP
FT                   SPESRPPRDLDLEVFCDSVEQLEPELVRLPVLSPVAAEPELCHLPPGIWDSSAQQVWAE
FT                   QKEAAGRELTTRSSPESTGEKEGLGGGLIGPQELDTWLVGTVRAMQESMKDVHRRLQSL
FT                   ESKPQPLKQRSPRTRPWPLGLSVPTLLFFILWPFVVQWLFRQFRTQKR"
FT   CDS             join(1723459..1723518,1723779..1723899,1724149..1724235,
FT                   1724591..1724824,1725441..1725580,1730885..1731004)
FT                   /codon_start=1
FT                   /gene="Acbd4"
FT                   /locus_tag="mCG_19167"
FT                   /product="acyl-Coenzyme A binding domain containing 4,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG19167.3 transcript_id=mCT172763.0
FT                   protein_id=mCP95682.0 isoform=CRA_d"
FT                   /protein_id="EDL34173.1"
FT                   /translation="MSREEAMSAYISEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI
FT                   PDMPRPPETFLRRATGWKEPLVQREDQAAPEPSCVPKEPVPPSPESRPPRDLDLEVFCD
FT                   SVEQLEPELVRLPVLSPVAAEPELCHLPPGIWDSSAQQVWAEQKEAAGRELTTRSSPES
FT                   TGEKEGLGGGLIGPQELDTWLVGTVRAMQESMKDVHRRLQSLESKPQPLKQRSPRTRPW
FT                   PLGLSVPTLLFFILWPFVVQWLFRQFRTQKR"
FT   gene            1735595..1739064
FT                   /gene="Hexim1"
FT                   /locus_tag="mCG_19165"
FT                   /note="gene_id=mCG19165.2"
FT   mRNA            1735595..1739064
FT                   /gene="Hexim1"
FT                   /locus_tag="mCG_19165"
FT                   /product="hexamethylene bis-acetamide inducible 1,
FT                   transcript variant mCT17869"
FT                   /note="gene_id=mCG19165.2 transcript_id=mCT17869.2 created
FT                   on 23-JUL-2002"
FT   mRNA            join(1735595..1737490,1737537..1739064)
FT                   /gene="Hexim1"
FT                   /locus_tag="mCG_19165"
FT                   /product="hexamethylene bis-acetamide inducible 1,
FT                   transcript variant mCT171084"
FT                   /note="gene_id=mCG19165.2 transcript_id=mCT171084.0 created
FT                   on 23-JUL-2002"
FT   CDS             1736265..1737335
FT                   /codon_start=1
FT                   /gene="Hexim1"
FT                   /locus_tag="mCG_19165"
FT                   /product="hexamethylene bis-acetamide inducible 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19165.2 transcript_id=mCT17869.2
FT                   protein_id=mCP14653.1 isoform=CRA_a"
FT                   /protein_id="EDL34174.1"
FT                   /translation="MAEPLLTEHQHQPQTSNCTGAAVVHEEHTSERPPSAEERVPKEDS
FT                   RWQSRASLQSGSRPGQEGEGGLKHQLPPLQTNACPELSSLEKGEKGQNGEDLSTGGASP
FT                   SAEGEPMSESLVQPGHDSEATKQEAPAAGGEEPWGQQQRQLGKKKHRRRPSKKKRHWKP
FT                   YYKLTWEEKKKFDEKQSLRASRVRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLY
FT                   PKRAAAKSDDTSDEDFVEEAGEEDGGSDGMGGDGSEFLQRDFSETYERYHAESLQNMSK
FT                   QELIKEYLELEKCLSRKEDENNRLRLESKRLGGVDARVRELELELDRLRAENLQLLTEN
FT                   ELHRQQERAPLSKFGD"
FT   CDS             1736265..1737335
FT                   /codon_start=1
FT                   /gene="Hexim1"
FT                   /locus_tag="mCG_19165"
FT                   /product="hexamethylene bis-acetamide inducible 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19165.2 transcript_id=mCT171084.0
FT                   protein_id=mCP94002.0 isoform=CRA_a"
FT                   /protein_id="EDL34175.1"
FT                   /translation="MAEPLLTEHQHQPQTSNCTGAAVVHEEHTSERPPSAEERVPKEDS
FT                   RWQSRASLQSGSRPGQEGEGGLKHQLPPLQTNACPELSSLEKGEKGQNGEDLSTGGASP
FT                   SAEGEPMSESLVQPGHDSEATKQEAPAAGGEEPWGQQQRQLGKKKHRRRPSKKKRHWKP
FT                   YYKLTWEEKKKFDEKQSLRASRVRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLY
FT                   PKRAAAKSDDTSDEDFVEEAGEEDGGSDGMGGDGSEFLQRDFSETYERYHAESLQNMSK
FT                   QELIKEYLELEKCLSRKEDENNRLRLESKRLGGVDARVRELELELDRLRAENLQLLTEN
FT                   ELHRQQERAPLSKFGD"
FT   assembly_gap    1752436..1755200
FT                   /estimated_length=2765
FT                   /gap_type="unknown"
FT   assembly_gap    1756335..1756548
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   gene            <1757645..1759355
FT                   /locus_tag="mCG_19152"
FT                   /note="gene_id=mCG19152.2"
FT   mRNA            <1757645..1759355
FT                   /locus_tag="mCG_19152"
FT                   /product="mCG19152"
FT                   /note="gene_id=mCG19152.2 transcript_id=mCT17743.2 created
FT                   on 06-SEP-2002"
FT   CDS             <1757645..1758523
FT                   /codon_start=1
FT                   /locus_tag="mCG_19152"
FT                   /product="mCG19152"
FT                   /note="gene_id=mCG19152.2 transcript_id=mCT17743.2
FT                   protein_id=mCP14670.2"
FT                   /protein_id="EDL34176.1"
FT                   /translation="TSGGLRSPQIAHEPHDFGGSQLLPSGQEIQSEDEGTVPAGDGSSC
FT                   NIRGSRTQSPGGCSVEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASR
FT                   VREEMFAKGQPLAPYNTTQFLMNDRDLEEPNLDVLHGPSHSGSGGENEAGDSDGQGRAH
FT                   GEFQQRDFSEAYERYHTESLQGRSKQELVRDYLDLERRLSQAEQETRRLRQLQGCSSRQ
FT                   PCQQVEELAAEVERLRTENQRLRQENEMWNREGGYCDQEKPASEGTPWPKGEAPFQTHT
FT                   GQLGHREAGDR"
FT   assembly_gap    1760838..1763033
FT                   /estimated_length=2196
FT                   /gap_type="unknown"
FT   assembly_gap    1765337..1765356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1782396..1782677
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    1783624..1784758
FT                   /estimated_length=1135
FT                   /gap_type="unknown"
FT   assembly_gap    1790562..1790707
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   gene            1790708..1821416
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /note="gene_id=mCG19154.2"
FT   mRNA            join(1790708..1790989,1799067..1799150,1800433..1800546,
FT                   1801259..1801332,1801636..1801719,1802192..1802317,
FT                   1805170..1805278,1805960..1806036,1806694..1806787,
FT                   1812500..1812574,1812870..1812980,1814600..1814749,
FT                   1815264..1815365,1815535..1815787,1815981..1816268,
FT                   1816461..1816585,1817158..1817360,1817791..1818025,
FT                   1818142..1818210,1818793..1818873,1818948..1819077,
FT                   1819217..1819380,1819610..1819711,1819847..1819927,
FT                   1820190..1820310,1821004..1821416)
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /product="formin-like 1, transcript variant mCT171079"
FT                   /note="gene_id=mCG19154.2 transcript_id=mCT171079.0 created
FT                   on 23-JUL-2002"
FT   mRNA            join(1790708..1790989,1799067..1799150,1800433..1800546,
FT                   1801259..1801332,1801636..1801719,1802192..1802317,
FT                   1805170..1805278,1805960..1806036,1806694..1806787,
FT                   1812500..1812574,1812870..1812980,1814600..1814749,
FT                   1815264..1815365,1815535..1815787,1815981..1816268,
FT                   1816461..1816585,1817158..1817360,1817791..1818025,
FT                   1818142..1818210,1818793..1818873,1818948..1819077,
FT                   1819217..1819380,1819610..1819711,1819847..1819927,
FT                   1820190..1820310,1820655..>1820746)
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /product="formin-like 1, transcript variant mCT17746"
FT                   /note="gene_id=mCG19154.2 transcript_id=mCT17746.2 created
FT                   on 23-JUL-2002"
FT   CDS             join(1790861..1790989,1799067..1799150,1800433..1800546,
FT                   1801259..1801332,1801636..1801719,1802192..1802317,
FT                   1805170..1805278,1805960..1806036,1806694..1806787,
FT                   1812500..1812574,1812870..1812980,1814600..1814749,
FT                   1815264..1815365,1815535..1815787,1815981..1816268,
FT                   1816461..1816585,1817158..1817360,1817791..1818025,
FT                   1818142..1818210,1818793..1818873,1818948..1819077,
FT                   1819217..1819380,1819610..1819711,1819847..1819927,
FT                   1820190..1820310,1821004..1821107)
FT                   /codon_start=1
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /product="formin-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG19154.2 transcript_id=mCT171079.0
FT                   protein_id=mCP93997.0 isoform=CRA_b"
FT                   /protein_id="EDL34178.1"
FT                   /translation="MGNAAGSAEQPAGPTASPPKQPAVPKQPMPAAGELEERFTRVLNC
FT                   MNLPPDKVQLLSQYDNEKKWELICDQERFQVKNPPAAYIQKLKSYLDTGGVSRKVASDW
FT                   MSNLGFKRRVQESTQVLRELETSLRTNHIGWVQEFLNEENRGLDVLLEYLAFAQCSVAY
FT                   DMESTDSVASGAEKSKPLDQSVEDLSKAPPSSVPKSRLTIKLTPAHSRKALRNSRIVSQ
FT                   KDDVHVCIMCLRAIMNYQSGFSLVMNHPACVNEIALSLNNKSPRTKALVLELLAAVCLV
FT                   RGGHDIILAAFDNFKEVCGEQHRFEKLMEYFRHEDSNIDFMVACMQFINIVVHSVENMN
FT                   FRVFLQYEFTHLGLDLYLERLRLTESDKLQVQIQAYLDNVFDVGTLLEETETKNAVLEH
FT                   MEELQEQVATLTERLRDTENDSMAKIAELEKQLSQARKELETLRERFSESTPMGTSRRI
FT                   PEPEKVPVPTVVRPSALELKVEELEEKGLIRILRGPGDVVSIEILPGAAATPSGDDAQA
FT                   PRVSTDSPSTAESIPEAASPPPPPPPPPPPLPNLQSQQEAPPSAPPLAPPLPGCAEPPP
FT                   APPLPGDLPPPPPPPPLGTDGPVPPPPPPPPGGPPDILGGQGPDIGPGVKAKKPIQTKF
FT                   RMPLLNWVALKPSQITGTVFTELNDEKVLQELDMNDFEEHFKTKSQGPCLDISALKGKA
FT                   SQKAPTKTILIEANRAKNLAITLRKGNLGADRICQAIETYDLQTLSLDFLELLTRFLPT
FT                   DYERSLIARFEKEQRPMEELSEEDRFMLRFSRIQRLPERMNTLTFLGNFPDTAQLLMPQ
FT                   LNAIIAASMSIKSSDKLRQILEIVLAFGNYMNSSKRGAAYGFRLQSLDALLEMKSTDRK
FT                   QTLLHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDSVLGDVRSLQRGLELTQREFVR
FT                   QDDCLVLKEFLRANSPTMDKLLADSKTAQEAYESVVEYFGENPKTTSPSMFFSLFSRFT
FT                   KAYKKAEQEVEQWKKEAAADTSGREEPPTPKSPPKARRQQMDLISELKRKQQKEPLIYE
FT                   SDRDGAIEDIITDLRNQPYIRADTGRRSARRRPPGPPLPVTTDLAL"
FT   CDS             join(1790861..1790989,1799067..1799150,1800433..1800546,
FT                   1801259..1801332,1801636..1801719,1802192..1802317,
FT                   1805170..1805278,1805960..1806036,1806694..1806787,
FT                   1812500..1812574,1812870..1812980,1814600..1814749,
FT                   1815264..1815365,1815535..1815787,1815981..1816268,
FT                   1816461..1816585,1817158..1817360,1817791..1818025,
FT                   1818142..1818210,1818793..1818873,1818948..1819077,
FT                   1819217..1819380,1819610..1819711,1819847..1819927,
FT                   1820190..1820310,1820655..1820746)
FT                   /codon_start=1
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /product="formin-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG19154.2 transcript_id=mCT17746.2
FT                   protein_id=mCP14678.2 isoform=CRA_c"
FT                   /db_xref="GOA:A2AB60"
FT                   /db_xref="InterPro:IPR010472"
FT                   /db_xref="InterPro:IPR010473"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014767"
FT                   /db_xref="InterPro:IPR014768"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027657"
FT                   /db_xref="MGI:MGI:1888994"
FT                   /db_xref="UniProtKB/TrEMBL:A2AB60"
FT                   /protein_id="EDL34179.1"
FT                   /translation="MGNAAGSAEQPAGPTASPPKQPAVPKQPMPAAGELEERFTRVLNC
FT                   MNLPPDKVQLLSQYDNEKKWELICDQERFQVKNPPAAYIQKLKSYLDTGGVSRKVASDW
FT                   MSNLGFKRRVQESTQVLRELETSLRTNHIGWVQEFLNEENRGLDVLLEYLAFAQCSVAY
FT                   DMESTDSVASGAEKSKPLDQSVEDLSKAPPSSVPKSRLTIKLTPAHSRKALRNSRIVSQ
FT                   KDDVHVCIMCLRAIMNYQSGFSLVMNHPACVNEIALSLNNKSPRTKALVLELLAAVCLV
FT                   RGGHDIILAAFDNFKEVCGEQHRFEKLMEYFRHEDSNIDFMVACMQFINIVVHSVENMN
FT                   FRVFLQYEFTHLGLDLYLERLRLTESDKLQVQIQAYLDNVFDVGTLLEETETKNAVLEH
FT                   MEELQEQVATLTERLRDTENDSMAKIAELEKQLSQARKELETLRERFSESTPMGTSRRI
FT                   PEPEKVPVPTVVRPSALELKVEELEEKGLIRILRGPGDVVSIEILPGAAATPSGDDAQA
FT                   PRVSTDSPSTAESIPEAASPPPPPPPPPPPLPNLQSQQEAPPSAPPLAPPLPGCAEPPP
FT                   APPLPGDLPPPPPPPPLGTDGPVPPPPPPPPGGPPDILGGQGPDIGPGVKAKKPIQTKF
FT                   RMPLLNWVALKPSQITGTVFTELNDEKVLQELDMNDFEEHFKTKSQGPCLDISALKGKA
FT                   SQKAPTKTILIEANRAKNLAITLRKGNLGADRICQAIETYDLQTLSLDFLELLTRFLPT
FT                   DYERSLIARFEKEQRPMEELSEEDRFMLRFSRIQRLPERMNTLTFLGNFPDTAQLLMPQ
FT                   LNAIIAASMSIKSSDKLRQILEIVLAFGNYMNSSKRGAAYGFRLQSLDALLEMKSTDRK
FT                   QTLLHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDSVLGDVRSLQRGLELTQREFVR
FT                   QDDCLVLKEFLRANSPTMDKLLADSKTAQEAYESVVEYFGENPKTTSPSMFFSLFSRFT
FT                   KAYKKAEQEVEQWKKEAAADTSGREEPPTPKSPPKARRQQMDLISELKRKQQKEPLIYE
FT                   SDRDGAIEDIITVLKTVPFTARTGKRTSRLLCEASLGEEMTL"
FT   assembly_gap    1806236..1806255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1807371..1807390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1808807..1808826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<1808982..1809063,1809189..1809282,1812500..1812574,
FT                   1812870..1813232)
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /product="formin-like 1, transcript variant mCT132879"
FT                   /note="gene_id=mCG19154.2 transcript_id=mCT132879.1 created
FT                   on 23-JUL-2002"
FT   CDS             join(<1808984..1809063,1809189..1809282,1812500..1812574,
FT                   1812870..1813004)
FT                   /codon_start=1
FT                   /gene="Fmnl1"
FT                   /locus_tag="mCG_19154"
FT                   /product="formin-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG19154.2 transcript_id=mCT132879.1
FT                   protein_id=mCP75504.1 isoform=CRA_a"
FT                   /protein_id="EDL34177.1"
FT                   /translation="QSGFSLVMNHPACVNEIALSLNNKSPRTKALVLELLAAVCLVRGG
FT                   HDIILAAFDNFKEVCGEQHRFEKLMEYFRHEDSNIDFMVACMQFINIVVHSVENMNFRV
FT                   FLQYEFTHLGLDLYLEVSLVPHP"
FT   assembly_gap    1815839..1815858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1821240..1824282)
FT                   /locus_tag="mCG_141021"
FT                   /note="gene_id=mCG141021.1"
FT   mRNA            complement(join(1821240..1821639,1821839..1821991,
FT                   1822168..1822343,1822584..1822704,1822789..1822860,
FT                   1823311..1823454,1823616..1823695,1823784..1823998,
FT                   1824237..1824282))
FT                   /locus_tag="mCG_141021"
FT                   /product="mCG141021, transcript variant mCT172748"
FT                   /note="gene_id=mCG141021.1 transcript_id=mCT172748.1
FT                   created on 04-APR-2003"
FT   CDS             complement(join(1821482..1821639,1821839..1821991,
FT                   1822168..1822343,1822584..1822704,1822789..1822860,
FT                   1823311..1823454,1823616..1823695,1823784..1823854))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141021"
FT                   /product="mCG141021, isoform CRA_b"
FT                   /note="gene_id=mCG141021.1 transcript_id=mCT172748.1
FT                   protein_id=mCP95667.1 isoform=CRA_b"
FT                   /protein_id="EDL34181.1"
FT                   /translation="MRDLKNPSEANQPYWSGPDDRSQRYYMSNFFLRSSSADDSLLPLT
FT                   PRQLAAFQDIFKLFSCSPTGTVDMQSMKIALRNAGIQLGPQEMCEALRLADLDGDGIVS
FT                   FKDFLGVLTDNHRLAQCMGQMKGNRVGEPPGLQTLFLEVLFKLLSQGFVPPKSRQEVTS
FT                   YYFKKQQALRMSLCARNRARQGRPARAHTGLTFFCQAARLNGLSSSQLARSLHTLCRAG
FT                   GRSPYTQIPNLAGRPRPERKARVPGSDVRLPKPQQPGRPKLPPNLGPLSKGPLRPPAGL
FT                   TSQPLEQMRPSKLASSPPTLVQKHPSSPSPACFQRCAMKSLYK"
FT   mRNA            complement(join(<1822811..1822860,1823311..1823454,
FT                   1823616..1823662,1823784..1824008,1824237..1824282))
FT                   /locus_tag="mCG_141021"
FT                   /product="mCG141021, transcript variant mCT181663"
FT                   /note="gene_id=mCG141021.1 transcript_id=mCT181663.0
FT                   created on 04-APR-2003"
FT   CDS             complement(join(<1822811..1822860,1823311..1823454,
FT                   1823616..1823662,1823784..1823854))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141021"
FT                   /product="mCG141021, isoform CRA_a"
FT                   /note="gene_id=mCG141021.1 transcript_id=mCT181663.0
FT                   protein_id=mCP104585.0 isoform=CRA_a"
FT                   /protein_id="EDL34180.1"
FT                   /translation="MRDLKNPSEANQPYWSGPDDRSQSSADDSLLPLTPRQLAAFQDIF
FT                   KLFSCSPTGTVDMQSMKIALRNAGIQLGPQEMCEALRLADLDGDGIVSFKDFLGVLTDN
FT                   "
FT   assembly_gap    1826344..1826363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1829593..1829612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1831708..1842018)
FT                   /gene="4933400C05Rik"
FT                   /locus_tag="mCG_141022"
FT                   /note="gene_id=mCG141022.0"
FT   mRNA            complement(join(1831708..1831824,1832342..1833126,
FT                   1833389..1833452,1834319..1834373,1841927..1842018))
FT                   /gene="4933400C05Rik"
FT                   /locus_tag="mCG_141022"
FT                   /product="RIKEN cDNA 4933400C05"
FT                   /note="gene_id=mCG141022.0 transcript_id=mCT172749.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(1831737..1831824,1832342..1833126,
FT                   1833389..1833452,1834319..1834373,1841927..1841939))
FT                   /codon_start=1
FT                   /gene="4933400C05Rik"
FT                   /locus_tag="mCG_141022"
FT                   /product="RIKEN cDNA 4933400C05"
FT                   /note="gene_id=mCG141022.0 transcript_id=mCT172749.0
FT                   protein_id=mCP95668.0"
FT                   /db_xref="GOA:Q8C5V0"
FT                   /db_xref="InterPro:IPR029297"
FT                   /db_xref="MGI:MGI:3045340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C5V0"
FT                   /protein_id="EDL34182.1"
FT                   /translation="MGVTGISTFPCCGKDSVDIVERQSDHHRHHHHHTHEENEDEDTEV
FT                   EAELPRTEPPPKVDPELGPVPQLEEMEPELPSKTTPETEGDSYTESPEQQNYRMESLKP
FT