spacer

EBI Dbfetch

ID   CH466557; SV 1; linear; genomic DNA; CON; MUS; 20962262 BP.
XX
AC   CH466557;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 181000113601716 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-20962262
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-20962262
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 4fe08075d9ad49a4ae6a7f89e38eb084.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000226.
DR   Ensembl-Gn; ENSMUSG00000005871; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005873; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014504; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019143; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024304; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024313; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024331; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024346; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024349; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024359; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024370; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024383; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024485; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024486; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035984; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037236; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037815; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038128; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038299; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041915; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041923; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042514; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042660; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042680; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042834; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044201; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044322; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044719; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049357; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051439; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051469; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056124; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059898; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061808; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061928; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062742; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063281; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073599; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091449; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091896; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019287; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025166; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025204; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025217; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025363; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038710; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042345; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042868; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049105; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049260; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049323; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051087; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060710; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061829; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066497; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072576; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074298; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074941; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075214; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075312; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079287; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079362; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081864; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082235; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096575; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115682; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115728; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115848; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119329; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122333; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153337; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164893; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165229; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166214; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166793; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167406; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168890; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171533; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..20962262
FT                   /organism="Mus musculus"
FT                   /chromosome="18"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(11437..12662)
FT                   /pseudo
FT                   /locus_tag="mCG_113259"
FT                   /note="gene_id=mCG113259.1"
FT   mRNA            complement(11437..12662)
FT                   /pseudo
FT                   /locus_tag="mCG_113259"
FT                   /note="gene_id=mCG113259.1 transcript_id=mCT114337.1
FT                   created on 29-MAY-2002"
FT   gap             55187..55206
FT                   /estimated_length=20
FT   gap             72933..72998
FT                   /estimated_length=66
FT   gap             116070..116089
FT                   /estimated_length=20
FT   gap             145057..145086
FT                   /estimated_length=30
FT   gap             150011..150324
FT                   /estimated_length=314
FT   gap             152348..152367
FT                   /estimated_length=20
FT   gap             190161..190180
FT                   /estimated_length=20
FT   gene            complement(<221665..222013)
FT                   /locus_tag="mCG_1031571"
FT                   /note="gene_id=mCG1031571.1"
FT   mRNA            complement(<221665..222013)
FT                   /locus_tag="mCG_1031571"
FT                   /product="mCG1031571"
FT                   /note="gene_id=mCG1031571.1 transcript_id=mCT149275.1
FT                   created on 29-MAY-2002"
FT   CDS             complement(221665..221961)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031571"
FT                   /product="mCG1031571"
FT                   /note="gene_id=mCG1031571.1 transcript_id=mCT149275.1
FT                   protein_id=mCP69005.1"
FT                   /protein_id="EDK96929.1"
FT                   /translation="MPTETERCIESLIAVFQKYSGKDGNNTQLSKTEFLSFMNTELAAF
FT                   TKNQKDPDVLDRMMKKLDLNCDGQLDFQEFLNLIGGLAIACHDSFIQTSQKRI"
FT   gap             230509..230528
FT                   /estimated_length=20
FT   gap             231722..231741
FT                   /estimated_length=20
FT   gap             232819..232838
FT                   /estimated_length=20
FT   gap             310834..310853
FT                   /estimated_length=20
FT   gap             346666..346810
FT                   /estimated_length=145
FT   gap             348922..349377
FT                   /estimated_length=456
FT   gap             375101..375146
FT                   /estimated_length=46
FT   gap             378928..378947
FT                   /estimated_length=20
FT   gap             395133..395333
FT                   /estimated_length=201
FT   gap             405113..405132
FT                   /estimated_length=20
FT   gap             435842..437118
FT                   /estimated_length=1277
FT   gap             443516..443598
FT                   /estimated_length=83
FT   gap             448719..448738
FT                   /estimated_length=20
FT   gene            complement(452550..452923)
FT                   /pseudo
FT                   /locus_tag="mCG_1031637"
FT                   /note="gene_id=mCG1031637.1"
FT   mRNA            complement(join(452550..452703,452738..452923))
FT                   /pseudo
FT                   /locus_tag="mCG_1031637"
FT                   /note="gene_id=mCG1031637.1 transcript_id=mCT149341.1
FT                   created on 29-MAY-2002"
FT   gap             462936..463036
FT                   /estimated_length=101
FT   gap             466306..466422
FT                   /estimated_length=117
FT   gap             487945..487964
FT                   /estimated_length=20
FT   gap             504771..504790
FT                   /estimated_length=20
FT   gap             513594..513613
FT                   /estimated_length=20
FT   gap             523686..525580
FT                   /estimated_length=1895
FT   gap             526578..526597
FT                   /estimated_length=20
FT   gap             527828..528537
FT                   /estimated_length=710
FT   gap             531738..531757
FT                   /estimated_length=20
FT   gap             533102..533121
FT                   /estimated_length=20
FT   gap             535623..535642
FT                   /estimated_length=20
FT   gap             540060..540079
FT                   /estimated_length=20
FT   gene            complement(540080..759991)
FT                   /gene="Cdh2"
FT                   /locus_tag="mCG_141325"
FT                   /note="gene_id=mCG141325.0"
FT   mRNA            complement(join(540080..541853,553073..553237,
FT                   573378..573517,575402..575635,575971..576204,
FT                   578819..578961,580710..580963,583455..583640,
FT                   584259..584396,591684..591856,595311..595455,
FT                   597853..598008,599868..600014,601653..601879,
FT                   725597..725708,759595..759991))
FT                   /gene="Cdh2"
FT                   /locus_tag="mCG_141325"
FT                   /product="cadherin 2"
FT                   /note="gene_id=mCG141325.0 transcript_id=mCT174619.0
FT                   created on 12-NOV-2002"
FT   gap             541539..541558
FT                   /estimated_length=20
FT   CDS             complement(join(541647..541853,553073..553237,
FT                   573378..573517,575402..575635,575971..576204,
FT                   578819..578961,580710..580963,583455..583640,
FT                   584259..584396,591684..591856,595311..595455,
FT                   597853..598008,599868..600014,601653..601879,
FT                   725597..725708,759595..759654))
FT                   /codon_start=1
FT                   /gene="Cdh2"
FT                   /locus_tag="mCG_141325"
FT                   /product="cadherin 2"
FT                   /note="gene_id=mCG141325.0 transcript_id=mCT174619.0
FT                   protein_id=mCP97538.0 partial"
FT                   /db_xref="GOA:P15116"
FT                   /db_xref="InterPro:IPR000233"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR009124"
FT                   /db_xref="InterPro:IPR014868"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR027397"
FT                   /db_xref="MGI:MGI:88355"
FT                   /db_xref="PDB:1NCG"
FT                   /db_xref="PDB:1NCH"
FT                   /db_xref="PDB:1NCI"
FT                   /db_xref="PDB:1NCJ"
FT                   /db_xref="PDB:1OP4"
FT                   /db_xref="PDB:2QVI"
FT                   /db_xref="PDB:3Q2W"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15116"
FT                   /protein_id="EDK96930.1"
FT                   /translation="MCRIAGAPRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVL
FT                   PKDVHEGQPLLNVKFSNCNRKRKVQYESSEPADFKVDEDGTVYAVRSFPLTAEQAKFLI
FT                   YAQDKETQEKWQVAVNLSREPTLTEEPMKEPHEIEEIVFPRQLAKHSGALQRQKRDWVI
FT                   PPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVT
FT                   KPLDRELIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSK
FT                   PGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDRE
FT                   KVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDVI
FT                   VANLTVTDKDQPHTPAWNAAYRISGGDPTGRFAILTDPNSNDGLVTVVKPIDFETNRMF
FT                   VLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLT
FT                   TLTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFL
FT                   ASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPEPNSINITALDYDIDPNAG
FT                   PFAFDLPLSPVTIKRNWTINRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNIS
FT                   ILRVKVCQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKER
FT                   QAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRLDER
FT                   PIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLS
FT                   SLNSSSSGGDQDYDYLNDWGPRFKKLADMYGGGDD"
FT   gap             571529..572036
FT                   /estimated_length=508
FT   gap             573121..573246
FT                   /estimated_length=126
FT   gap             586334..586467
FT                   /estimated_length=134
FT   gap             594406..594527
FT                   /estimated_length=122
FT   gap             672691..673884
FT                   /estimated_length=1194
FT   gap             722936..722955
FT                   /estimated_length=20
FT   gap             740574..741073
FT                   /estimated_length=500
FT   gap             760066..760640
FT                   /estimated_length=575
FT   gene            <767701..774078
FT                   /locus_tag="mCG_144789"
FT                   /note="gene_id=mCG144789.0"
FT   mRNA            join(<767701..767784,768291..768365,771260..774078)
FT                   /locus_tag="mCG_144789"
FT                   /product="mCG144789"
FT                   /note="gene_id=mCG144789.0 transcript_id=mCT184213.0
FT                   created on 05-JUN-2003"
FT   CDS             <772687..773061
FT                   /codon_start=1
FT                   /locus_tag="mCG_144789"
FT                   /product="mCG144789"
FT                   /note="gene_id=mCG144789.0 transcript_id=mCT184213.0
FT                   protein_id=mCP105283.0"
FT                   /protein_id="EDK96931.1"
FT                   /translation="EKNMYLGKKSFLVILCQSKIERTDVNGYGAGVFRESLGLCLSLSH
FT                   RRAIYDLNMLPTGHSHLSPGRFTTMCCRYIETGNYLFYSQHILFATTRLNLDSLARCGH
FT                   IRRKDKAPLPFLWLLKQLLG"
FT   gap             774455..774594
FT                   /estimated_length=140
FT   gap             775040..775073
FT                   /estimated_length=34
FT   gene            complement(790592..791202)
FT                   /pseudo
FT                   /locus_tag="mCG_113270"
FT                   /note="gene_id=mCG113270.1"
FT   mRNA            complement(790592..791202)
FT                   /pseudo
FT                   /locus_tag="mCG_113270"
FT                   /note="gene_id=mCG113270.1 transcript_id=mCT114348.1
FT                   created on 13-NOV-2002"
FT   gap             881678..882352
FT                   /estimated_length=675
FT   gap             898063..898082
FT                   /estimated_length=20
FT   gap             901659..901678
FT                   /estimated_length=20
FT   gap             917130..920030
FT                   /estimated_length=2901
FT   gap             940403..943263
FT                   /estimated_length=2861
FT   gap             962279..962298
FT                   /estimated_length=20
FT   gene            970146..998618
FT                   /locus_tag="mCG_145681"
FT                   /note="gene_id=mCG145681.0"
FT   mRNA            join(970146..970234,983496..983685,987262..987360,
FT                   989632..989721,996420..996559,998299..998618)
FT                   /locus_tag="mCG_145681"
FT                   /product="mCG145681"
FT                   /note="gene_id=mCG145681.0 transcript_id=mCT185108.0
FT                   created on 06-JUN-2003"
FT   CDS             join(987336..987360,989632..989721,996420..996559,
FT                   998299..998304)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145681"
FT                   /product="mCG145681"
FT                   /note="gene_id=mCG145681.0 transcript_id=mCT185108.0
FT                   protein_id=mCP106366.0"
FT                   /protein_id="EDK96932.1"
FT                   /translation="MTVDEGVSVSVSMESPWAQSQWTCPRSLEDSPHDLRTTGLKPSWD
FT                   FDHFNMLIKWFTLTMENRQVNSFGDQKTTSSGPEPHINFIN"
FT   gap             995163..995182
FT                   /estimated_length=20
FT   gap             1004974..1004993
FT                   /estimated_length=20
FT   gap             1065648..1065667
FT                   /estimated_length=20
FT   gap             1095247..1095453
FT                   /estimated_length=207
FT   gap             1114905..1114924
FT                   /estimated_length=20
FT   gap             1122984..1123003
FT                   /estimated_length=20
FT   gap             1171571..1171717
FT                   /estimated_length=147
FT   gene            complement(1185726..1271143)
FT                   /locus_tag="mCG_113271"
FT                   /note="gene_id=mCG113271.1"
FT   mRNA            complement(join(1185726..1186937,1207933..1208045,
FT                   1215910..1216041,1246195..1246291,1271040..1271143))
FT                   /locus_tag="mCG_113271"
FT                   /product="mCG113271, transcript variant mCT181585"
FT                   /note="gene_id=mCG113271.1 transcript_id=mCT181585.0
FT                   created on 25-MAR-2003"
FT   mRNA            complement(join(1185726..1186937,1207933..1208045,
FT                   1215910..1216041,1246195..1246291,1265107..1265129,
FT                   1271040..1271143))
FT                   /locus_tag="mCG_113271"
FT                   /product="mCG113271, transcript variant mCT114349"
FT                   /note="gene_id=mCG113271.1 transcript_id=mCT114349.1
FT                   created on 25-MAR-2003"
FT   CDS             complement(1185882..1186097)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113271"
FT                   /product="mCG113271, isoform CRA_a"
FT                   /note="gene_id=mCG113271.1 transcript_id=mCT114349.1
FT                   protein_id=mCP69022.1 isoform=CRA_a"
FT                   /protein_id="EDK96933.1"
FT                   /translation="MAIRNAPWSIGVTKAGIHARTVREKIFSKHVAHVLNDETQRKYIQ
FT                   GLKRLMTICQKHFLTDPLKCMEYNAV"
FT   CDS             complement(1185882..1186097)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113271"
FT                   /product="mCG113271, isoform CRA_a"
FT                   /note="gene_id=mCG113271.1 transcript_id=mCT181585.0
FT                   protein_id=mCP104507.0 isoform=CRA_a"
FT                   /protein_id="EDK96934.1"
FT                   /translation="MAIRNAPWSIGVTKAGIHARTVREKIFSKHVAHVLNDETQRKYIQ
FT                   GLKRLMTICQKHFLTDPLKCMEYNAV"
FT   gap             1297622..1297641
FT                   /estimated_length=20
FT   gap             1302767..1302991
FT                   /estimated_length=225
FT   gap             1318418..1318533
FT                   /estimated_length=116
FT   gap             1340348..1340367
FT                   /estimated_length=20
FT   gap             1369586..1369605
FT                   /estimated_length=20
FT   gap             1371704..1376615
FT                   /estimated_length=4912
FT   gap             1378320..1405789
FT                   /estimated_length=27470
FT   gap             1406929..1406948
FT                   /estimated_length=20
FT   gap             1407971..1407990
FT                   /estimated_length=20
FT   gap             1412013..1412032
FT                   /estimated_length=20
FT   gap             1413429..1416440
FT                   /estimated_length=3012
FT   gap             1425542..1426224
FT                   /estimated_length=683
FT   gap             1427715..1428390
FT                   /estimated_length=676
FT   gap             1459860..1461088
FT                   /estimated_length=1229
FT   gap             1464317..1464405
FT                   /estimated_length=89
FT   gap             1480541..1480570
FT                   /estimated_length=30
FT   gap             1487763..1496067
FT                   /estimated_length=8305
FT   gap             1497184..1497203
FT                   /estimated_length=20
FT   gap             1500341..1500950
FT                   /estimated_length=610
FT   gap             1503909..1504511
FT                   /estimated_length=603
FT   gap             1508537..1509341
FT                   /estimated_length=805
FT   gene            complement(<1518934..1531304)
FT                   /locus_tag="mCG_144793"
FT                   /note="gene_id=mCG144793.0"
FT   mRNA            complement(join(<1518934..1519353,1520689..1520989,
FT                   1531163..1531304))
FT                   /locus_tag="mCG_144793"
FT                   /product="mCG144793"
FT                   /note="gene_id=mCG144793.0 transcript_id=mCT184217.0
FT                   created on 30-JUN-2003"
FT   CDS             complement(<1518934..1519035)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144793"
FT                   /product="mCG144793"
FT                   /note="gene_id=mCG144793.0 transcript_id=mCT184217.0
FT                   protein_id=mCP105285.0"
FT                   /protein_id="EDK96935.1"
FT                   /translation="MAFHQSCEFNNITPLCQIVNFASDFLLLIKEGKL"
FT   gap             1522636..1522944
FT                   /estimated_length=309
FT   gap             1532665..1532684
FT                   /estimated_length=20
FT   gap             1584344..1584435
FT                   /estimated_length=92
FT   gap             1586571..1586590
FT                   /estimated_length=20
FT   gap             1587812..1587831
FT                   /estimated_length=20
FT   gap             1607921..1607956
FT                   /estimated_length=36
FT   gap             1609660..1609679
FT                   /estimated_length=20
FT   gap             1611262..1612873
FT                   /estimated_length=1612
FT   gap             1640918..1644516
FT                   /estimated_length=3599
FT   gap             1647306..1647348
FT                   /estimated_length=43
FT   gap             1661182..1661206
FT                   /estimated_length=25
FT   gap             1662736..1662755
FT                   /estimated_length=20
FT   gap             1760427..1760446
FT                   /estimated_length=20
FT   gap             1767711..1767730
FT                   /estimated_length=20
FT   gap             1772049..1779304
FT                   /estimated_length=7256
FT   gap             1827351..1827503
FT                   /estimated_length=153
FT   gap             1833986..1834005
FT                   /estimated_length=20
FT   gap             1837751..1837770
FT                   /estimated_length=20
FT   gap             1853234..1853553
FT                   /estimated_length=320
FT   gap             1855825..1855870
FT                   /estimated_length=46
FT   gap             1881964..1881983
FT                   /estimated_length=20
FT   gap             1892698..1895022
FT                   /estimated_length=2325
FT   gap             1900763..1901770
FT                   /estimated_length=1008
FT   gap             1913327..1913346
FT                   /estimated_length=20
FT   gap             1929171..1929190
FT                   /estimated_length=20
FT   gap             1974008..1974027
FT                   /estimated_length=20
FT   gap             2039981..2040000
FT                   /estimated_length=20
FT   gap             2070459..2070757
FT                   /estimated_length=299
FT   gap             2074092..2074111
FT                   /estimated_length=20
FT   gap             2123328..2125546
FT                   /estimated_length=2219
FT   gap             2126238..2126552
FT                   /estimated_length=315
FT   gap             2129062..2129233
FT                   /estimated_length=172
FT   gap             2140835..2141051
FT                   /estimated_length=217
FT   gap             2147460..2147479
FT                   /estimated_length=20
FT   gap             2173672..2173912
FT                   /estimated_length=241
FT   gap             2203761..2204264
FT                   /estimated_length=504
FT   gap             2206248..2210339
FT                   /estimated_length=4092
FT   gap             2251980..2252407
FT                   /estimated_length=428
FT   gap             2296926..2296945
FT                   /estimated_length=20
FT   gap             2335274..2335293
FT                   /estimated_length=20
FT   gap             2348832..2348851
FT                   /estimated_length=20
FT   gap             2361144..2361163
FT                   /estimated_length=20
FT   gap             2362181..2362200
FT                   /estimated_length=20
FT   gap             2363770..2363789
FT                   /estimated_length=20
FT   gap             2523636..2523729
FT                   /estimated_length=94
FT   gap             2537018..2537037
FT                   /estimated_length=20
FT   gap             2541291..2541310
FT                   /estimated_length=20
FT   gap             2567482..2567501
FT                   /estimated_length=20
FT   gap             2568857..2568876
FT                   /estimated_length=20
FT   gap             2573670..2573689
FT                   /estimated_length=20
FT   gap             2617336..2617800
FT                   /estimated_length=465
FT   gap             2619467..2624058
FT                   /estimated_length=4592
FT   gap             2762310..2762329
FT                   /estimated_length=20
FT   gap             2773271..2773951
FT                   /estimated_length=681
FT   gap             2782287..2782342
FT                   /estimated_length=56
FT   gap             2783664..2786152
FT                   /estimated_length=2489
FT   gap             2791260..2791279
FT                   /estimated_length=20
FT   gap             2892055..2892270
FT                   /estimated_length=216
FT   gap             2915227..2915446
FT                   /estimated_length=220
FT   gap             2920036..2920055
FT                   /estimated_length=20
FT   gap             2924021..2924270
FT                   /estimated_length=250
FT   gap             2926288..2927167
FT                   /estimated_length=880
FT   gap             2930901..2931200
FT                   /estimated_length=300
FT   gap             2935146..2936960
FT                   /estimated_length=1815
FT   gap             2944257..2944276
FT                   /estimated_length=20
FT   gap             2980210..2980773
FT                   /estimated_length=564
FT   gap             2982198..2982705
FT                   /estimated_length=508
FT   gap             2995426..2995445
FT                   /estimated_length=20
FT   gap             3033910..3033929
FT                   /estimated_length=20
FT   gap             3062998..3063601
FT                   /estimated_length=604
FT   gap             3080753..3080772
FT                   /estimated_length=20
FT   gap             3091850..3091869
FT                   /estimated_length=20
FT   gap             3096045..3096658
FT                   /estimated_length=614
FT   gap             3101261..3101280
FT                   /estimated_length=20
FT   gap             3126699..3126718
FT                   /estimated_length=20
FT   gap             3130183..3130289
FT                   /estimated_length=107
FT   gap             3134394..3134701
FT                   /estimated_length=308
FT   gap             3150718..3151224
FT                   /estimated_length=507
FT   gap             3156094..3156113
FT                   /estimated_length=20
FT   gap             3189655..3189674
FT                   /estimated_length=20
FT   gap             3208962..3214363
FT                   /estimated_length=5402
FT   gap             3232043..3234666
FT                   /estimated_length=2624
FT   gap             3292295..3295824
FT                   /estimated_length=3530
FT   gap             3368309..3368349
FT                   /estimated_length=41
FT   gap             3437094..3437113
FT                   /estimated_length=20
FT   gap             3451894..3451988
FT                   /estimated_length=95
FT   gap             3454888..3455087
FT                   /estimated_length=200
FT   gap             3466470..3466489
FT                   /estimated_length=20
FT   gap             3470944..3471005
FT                   /estimated_length=62
FT   gap             3479908..3480245
FT                   /estimated_length=338
FT   gap             3481186..3482111
FT                   /estimated_length=926
FT   gene            complement(3496335..3496847)
FT                   /pseudo
FT                   /locus_tag="mCG_1031598"
FT                   /note="gene_id=mCG1031598.1"
FT   mRNA            complement(3496335..3496847)
FT                   /pseudo
FT                   /locus_tag="mCG_1031598"
FT                   /note="gene_id=mCG1031598.1 transcript_id=mCT149302.1
FT                   created on 14-NOV-2002"
FT   gap             3502004..3507335
FT                   /estimated_length=5332
FT   gap             3509864..3509883
FT                   /estimated_length=20
FT   gap             3557364..3563188
FT                   /estimated_length=5825
FT   gap             3571262..3571629
FT                   /estimated_length=368
FT   gap             3591521..3591540
FT                   /estimated_length=20
FT   gap             3601979..3601998
FT                   /estimated_length=20
FT   gap             3651950..3653561
FT                   /estimated_length=1612
FT   gap             3657092..3657122
FT                   /estimated_length=31
FT   gap             3660330..3660488
FT                   /estimated_length=159
FT   gap             3664313..3664409
FT                   /estimated_length=97
FT   gap             3668247..3668447
FT                   /estimated_length=201
FT   gap             3710511..3710530
FT                   /estimated_length=20
FT   gap             3712858..3713257
FT                   /estimated_length=400
FT   gap             3729387..3729406
FT                   /estimated_length=20
FT   gap             3731816..3731835
FT                   /estimated_length=20
FT   gap             3736028..3736120
FT                   /estimated_length=93
FT   gap             3750340..3750359
FT                   /estimated_length=20
FT   gap             3768977..3768996
FT                   /estimated_length=20
FT   gap             3776217..3776770
FT                   /estimated_length=554
FT   gap             3798464..3798483
FT                   /estimated_length=20
FT   gap             3801827..3801846
FT                   /estimated_length=20
FT   gap             3803094..3803113
FT                   /estimated_length=20
FT   gap             3828725..3829728
FT                   /estimated_length=1004
FT   gap             3837150..3837230
FT                   /estimated_length=81
FT   gap             3847873..3848005
FT                   /estimated_length=133
FT   gap             3876965..3876984
FT                   /estimated_length=20
FT   gap             3888512..3888954
FT                   /estimated_length=443
FT   gap             3890307..3891053
FT                   /estimated_length=747
FT   gene            complement(<3897552..>3936260)
FT                   /gene="Dsc3"
FT                   /locus_tag="mCG_121830"
FT                   /note="gene_id=mCG121830.1"
FT   mRNA            complement(join(<3897552..3897749,3899808..3900062,
FT                   3900400..3900521,3902400..3902624,3905559..3905783,
FT                   3907965..3908107,3908221..3908480,3914570..3914755,
FT                   3915088..3915222,3917506..3917672,3919601..3919745,
FT                   3920940..3921095,3922243..3922362,3923482..3923681,
FT                   3925485..3925569,3936018..3936260))
FT                   /gene="Dsc3"
FT                   /locus_tag="mCG_121830"
FT                   /product="desmocollin 3, transcript variant mCT123042"
FT                   /note="gene_id=mCG121830.1 transcript_id=mCT123042.0
FT                   created on 15-OCT-2002"
FT   mRNA            complement(join(3897552..3897749,3897829..3897871,
FT                   3899808..3900062,3900400..3900521,3902400..3902624,
FT                   3905559..3905783,3907965..3908107,3908221..3908480,
FT                   3914570..3914755,3915088..3915222,3917506..3917672,
FT                   3919601..3919745,3920940..3921095,3922243..3922362,
FT                   3923482..3923681,3925485..3925569,3936018..>3936260))
FT                   /gene="Dsc3"
FT                   /locus_tag="mCG_121830"
FT                   /product="desmocollin 3, transcript variant mCT188851"
FT                   /note="gene_id=mCG121830.1 transcript_id=mCT188851.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(3897552..3897749,3899808..3900062,
FT                   3900400..3900521,3902400..3902624,3905559..3905783,
FT                   3907965..3908107,3908221..3908480,3914570..3914755,
FT                   3915088..3915222,3917506..3917672,3919601..3919745,
FT                   3920940..3921095,3922243..3922362,3923482..3923681,
FT                   3925485..3925569,3936018..3936086))
FT                   /codon_start=1
FT                   /gene="Dsc3"
FT                   /locus_tag="mCG_121830"
FT                   /product="desmocollin 3, isoform CRA_b"
FT                   /note="gene_id=mCG121830.1 transcript_id=mCT123042.0
FT                   protein_id=mCP69268.1 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8S6"
FT                   /db_xref="InterPro:IPR000233"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR009122"
FT                   /db_xref="InterPro:IPR009124"
FT                   /db_xref="InterPro:IPR014868"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR027397"
FT                   /db_xref="MGI:MGI:1194993"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8S6"
FT                   /protein_id="EDK96937.1"
FT                   /translation="MVVPEFRSPQCRALCTKLLLTLWVFSFVGEACKKVTFHVPSTLEA
FT                   DKIIGRVSLKECLSSADGIMPSDPDFRVLDDGSVYPTRAVVLSDEKRSFTIQLSDSKMQ
FT                   TQKEIPVILEHKKKVLKKRHTKETVLRRSKRRWAPIPCSMQENSLGPFPLFLQQVQSDA
FT                   AQNYTVFYSISGRGADQEPLNWFFIERDTGNLYCTRPVDREEYDVFDLIAYASTADGYS
FT                   ADLPLPLPIKIEDENDNYPLFTEAIYAFEVPEGSRLGTVVGTVCATDKDEPDTMHTRLK
FT                   YSILEQTPPSPGLFSVHPDTGVITTVSHYMDREVVDKYKLIMKVQDMNGQFFGLISTST
FT                   CIITVQDSNDNAPTFRQNTYETAVEENTYNVEILRIPVDDKDMINTANWKANFTILKGN
FT                   ENGWFKITTDPVTNEGVLCVVKPLDYEENRQVTLEIGVNNEAPFIKDVANRIPTMNRAM
FT                   VTVHVKDQNEGPECKPPEQYVRIKENSAVGSKINGYKAYDPETKNSNGLRYKKLQDPKD
FT                   WVSIEEVSGLLTISKTLDREIMAPRNDMYNITVMAIDQEGKSCTGTLAVNIEDVNDNAP
FT                   EIIQDYIVICKPKMGYTDISAVDPDEPIHGPPFQFNLANTSPEVNRIWTLNQVNDTAAR
FT                   LSYQKTADVQIYNVPVTVKDRAGQSATKILRVNLCDCTHPSQCPLRSRSAGITLGKWAI
FT                   LAILLGIALLFSVLLTLVCGVVTARKGKHFPEDLAQQNLIISNTEAPGDDRVCSANGFT
FT                   THTANNSSQGFCGTMGSGMRNGGQETIEMMKGHQTLDSCRVAGHHHTLDSGRGGHMDTD
FT                   NCRYTYSEWHSFTQPRLGEKLHVCNQNEDHIPSQDYVLTYNYEGRGSPAGSVGCCSEKQ
FT                   EEEGLDFLNNLEPKFLTLAETCTKR"
FT   CDS             complement(join(3897845..3897871,3899808..3900062,
FT                   3900400..3900521,3902400..3902624,3905559..3905783,
FT                   3907965..3908107,3908221..3908480,3914570..3914755,
FT                   3915088..3915222,3917506..3917672,3919601..3919745,
FT                   3920940..3921095,3922243..3922362,3923482..3923681,
FT                   3925485..3925569,3936018..>3936134))
FT                   /codon_start=1
FT                   /gene="Dsc3"
FT                   /locus_tag="mCG_121830"
FT                   /product="desmocollin 3, isoform CRA_a"
FT                   /note="gene_id=mCG121830.1 transcript_id=mCT188851.0
FT                   protein_id=mCP109832.0 isoform=CRA_a"
FT                   /protein_id="EDK96936.1"
FT                   /translation="SPCLAPACVLLRLHCAMVVPEFRSPQCRALCTKLLLTLWVFSFVG
FT                   EACKKVTFHVPSTLEADKIIGRVSLKECLSSADGIMPSDPDFRVLDDGSVYPTRAVVLS
FT                   DEKRSFTIQLSDSKMQTQKEIPVILEHKKKVLKKRHTKETVLRRSKRRWAPIPCSMQEN
FT                   SLGPFPLFLQQVQSDAAQNYTVFYSISGRGADQEPLNWFFIERDTGNLYCTRPVDREEY
FT                   DVFDLIAYASTADGYSADLPLPLPIKIEDENDNYPLFTEAIYAFEVPEGSRLGTVVGTV
FT                   CATDKDEPDTMHTRLKYSILEQTPPSPGLFSVHPDTGVITTVSHYMDREVVDKYKLIMK
FT                   VQDMNGQFFGLISTSTCIITVQDSNDNAPTFRQNTYETAVEENTYNVEILRIPVDDKDM
FT                   INTANWKANFTILKGNENGWFKITTDPVTNEGVLCVVKPLDYEENRQVTLEIGVNNEAP
FT                   FIKDVANRIPTMNRAMVTVHVKDQNEGPECKPPEQYVRIKENSAVGSKINGYKAYDPET
FT                   KNSNGLRYKKLQDPKDWVSIEEVSGLLTISKTLDREIMAPRNDMYNITVMAIDQEGKSC
FT                   TGTLAVNIEDVNDNAPEIIQDYIVICKPKMGYTDISAVDPDEPIHGPPFQFNLANTSPE
FT                   VNRIWTLNQVNDTAARLSYQKTADVQIYNVPVTVKDRAGQSATKILRVNLCDCTHPSQC
FT                   PLRSRSAGITLGKWAILAILLGIALLFSVLLTLVCGVVTARKGKHFPEDLAQQNLIISN
FT                   TEAPGDDRVCSANGFTTHTANNSSQGFCGTMGSGMRNGGQETIEMMKGHQTLDSCRVAG
FT                   HHHTLDSGRGGHMDTDNCRYTYSEWHSFTQPRLGEDSIRGHTG"
FT   gap             3912056..3912652
FT                   /estimated_length=597
FT   gap             3931066..3931651
FT                   /estimated_length=586
FT   gene            complement(3965481..>3993655)
FT                   /gene="Dsc2"
FT                   /locus_tag="mCG_121828"
FT                   /note="gene_id=mCG121828.3"
FT   mRNA            complement(join(3965481..3966557,3967216..3967476,
FT                   3968739..3968863,3969430..>3969498))
FT                   /gene="Dsc2"
FT                   /locus_tag="mCG_121828"
FT                   /product="desmocollin 2, transcript variant mCT185116"
FT                   /note="gene_id=mCG121828.3 transcript_id=mCT185116.0
FT                   created on 06-JUN-2003"
FT   mRNA            complement(join(3965633..3966557,3966644..3966689,
FT                   3967216..3967476,3968739..3968863,3969430..3969666,
FT                   3972196..3972420,3975578..3975720,3975840..3976096,
FT                   3977869..3978054,3978284..3978418,3979547..3979713,
FT                   3980378..3980522,3981208..3981363,3982418..3982537,
FT                   3982926..3982960,3984151..3984350,3985321..3985405,
FT                   3993329..>3993655))
FT                   /gene="Dsc2"
FT                   /locus_tag="mCG_121828"
FT                   /product="desmocollin 2, transcript variant mCT188857"
FT                   /note="gene_id=mCG121828.3 transcript_id=mCT188857.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(3966172..3966557,3966644..3966689,
FT                   3967216..3967476,3968739..3968863,3969430..3969666,
FT                   3972196..3972420,3975578..3975720,3975840..3976096,
FT                   3977869..3978054,3978284..3978418,3979547..3979713,
FT                   3980378..3980522,3981208..3981363,3982418..3982537,
FT                   3984151..3984350,3985321..3985405,3993329..>3993451))
FT                   /gene="Dsc2"
FT                   /locus_tag="mCG_121828"
FT                   /product="desmocollin 2, transcript variant mCT123040"
FT                   /note="gene_id=mCG121828.3 transcript_id=mCT123040.0
FT                   created on 06-JUN-2003"
FT   CDS             complement(join(3966360..3966557,3967216..3967476,
FT                   3968739..3968863,3969430..>3969496))
FT                   /codon_start=1
FT                   /gene="Dsc2"
FT                   /locus_tag="mCG_121828"
FT                   /product="desmocollin 2, isoform CRA_c"
FT                   /note="gene_id=mCG121828.3 transcript_id=mCT185116.0
FT                   protein_id=mCP106374.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8C5C8"
FT                   /db_xref="InterPro:IPR000233"
FT                   /db_xref="InterPro:IPR009122"
FT                   /db_xref="InterPro:IPR009124"
FT                   /db_xref="InterPro:IPR027397"
FT                   /db_xref="MGI:MGI:103221"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C5C8"
FT                   /protein_id="EDK96940.1"
FT                   /translation="YADVRLGPWAILAILLGIALLFCILFTLVCSVSRASKQQKILPDD
FT                   LAQQNLIVSNTEAPGDDKVYSTNGLTTQTMGASGQTAFTTMGTGVKSGGQETIEMVKGG
FT                   QQTLDSRRGAGYHHHTLDPCRGGHVEVDNYRHTYSEWYNFIQPRLGDKVQFCHTDDNQK
FT                   LAQDYVLTYNYEGKGSAAGSVGCCSDLQEEDGLEFLDHLEPKFRTLAEVCAKR"
FT   CDS             complement(join(3966654..3966689,3967216..3967476,
FT                   3968739..3968863,3969430..3969666,3972196..3972420,
FT                   3975578..3975720,3975840..3976096,3977869..3978054,
FT                   3978284..3978418,3979547..3979713,3980378..3980522,
FT                   3981208..3981363,3982418..3982537,3984151..3984350,
FT                   3985321..3985405,3993329..>3993451))
FT                   /codon_start=1
FT                   /gene="Dsc2"
FT                   /locus_tag="mCG_121828"
FT                   /product="desmocollin 2, isoform CRA_a"
FT                   /note="gene_id=mCG121828.3 transcript_id=mCT123040.0
FT                   protein_id=mCP69243.0 isoform=CRA_a"
FT                   /protein_id="EDK96938.1"
FT                   /translation="RSTSAQRVRGGDLSLELAMAAVGSMRSGSPAFGLGHLLTLAILAL
FT                   ASDACKEVVLQVPSELPAEKFVGRVNLMDCLKSADIVHLSDPDFQVLEDGSVYTTSSVV
FT                   LSSGQRSFTIWLFSTDSQEEREISVHLEGPVEVLNKRPHTEKVLSRAKRRWAPIPCSML
FT                   ENSLGPFPLFLQQIQSDTAQNYTIYYSIRGPGVDKEPLNLFYVERDTGNLYCTGRVDRE
FT                   QYESFELTAFATTPDGYTPEYPLPLLIKIEDENDNYPIFTQKLYSFTVQENSRIGSIVG
FT                   EVCATDLDEPDTMHTRLRYSILEQSPSPPMLFTMHPSTGVITTTSAQLDRELIDKYQLL
FT                   IKVQDMDGQYFGLHTTAKCIITIEDVNDNLPTFTRTTYVTSVEENTVNVEILRLTVQDK
FT                   DLVNSPNWRANYTILKGNENGNFKIVTDPKTNEGILCVIKPLDYEERQQVTLQIGVVNE
FT                   APYTREASSKSPMSTATVTVTVTNQDEGPECIPPMQTVRIQENVPVGTRNDGYKAYDPE
FT                   TRSSSGIRYRKLSDPRGWVTVNEDSGSITIFRALDREAETVRNGIYNITVLALDADGRS
FT                   CTGTLGIILEDVNDNGPFIPKQTVVICKATMSSAEIVAVDLDDPVNGPPFDFSLESSDS
FT                   EVQRMWRLTRINDTAARLSYQNDPSFGSYAVPIRVTDRLGLSSVTTLNVLVCDCITESD
FT                   CTLRSGERTGYADVRLGPWAILAILLGIALLFCILFTLVCSVSRASKQQKILPDDLAQQ
FT                   NLIVSNTEAPGDDKVYSTNGLTTQTMGASGQTAFTTMGTGVKSGGQETIEMVKGGQQTL
FT                   DSRRGAGYHHHTLDPCRGGHVEVDNYRHTYSEWYNFIQPRLGDETIRGHTLIKN"
FT   CDS             complement(join(3966654..3966689,3967216..3967476,
FT                   3968739..3968863,3969430..3969666,3972196..3972420,
FT                   3975578..3975720,3975840..3976096,3977869..3978054,
FT                   3978284..3978418,3979547..3979713,3980378..3980522,
FT                   3981208..3981363,3982418..3982537,3982926..>3982931))
FT                   /codon_start=1
FT                   /gene="Dsc2"
FT                   /locus_tag="mCG_121828"
FT                   /product="desmocollin 2, isoform CRA_b"
FT                   /note="gene_id=mCG121828.3 transcript_id=mCT188857.0
FT                   protein_id=mCP109830.0 isoform=CRA_b"
FT                   /protein_id="EDK96939.1"
FT                   /translation="LLVLNKRPHTEKVLSRAKRRWAPIPCSMLENSLGPFPLFLQQIQS
FT                   DTAQNYTIYYSIRGPGVDKEPLNLFYVERDTGNLYCTGRVDREQYESFELTAFATTPDG
FT                   YTPEYPLPLLIKIEDENDNYPIFTQKLYSFTVQENSRIGSIVGEVCATDLDEPDTMHTR
FT                   LRYSILEQSPSPPMLFTMHPSTGVITTTSAQLDRELIDKYQLLIKVQDMDGQYFGLHTT
FT                   AKCIITIEDVNDNLPTFTRTTYVTSVEENTVNVEILRLTVQDKDLVNSPNWRANYTILK
FT                   GNENGNFKIVTDPKTNEGILCVIKPLDYEERQQVTLQIGVVNEAPYTREASSKSPMSTA
FT                   TVTVTVTNQDEGPECIPPMQTVRIQENVPVGTRNDGYKAYDPETRSSSGIRYRKLSDPR
FT                   GWVTVNEDSGSITIFRALDREAETVRNGIYNITVLALDADGRSCTGTLGIILEDVNDNG
FT                   PFIPKQTVVICKATMSSAEIVAVDLDDPVNGPPFDFSLESSDSEVQRMWRLTRINDTAA
FT                   RLSYQNDPSFGSYAVPIRVTDRLGLSSVTTLNVLVCDCITESDCTLRSGERTGYADVRL
FT                   GPWAILAILLGIALLFCILFTLVCSVSRASKQQKILPDDLAQQNLIVSNTEAPGDDKVY
FT                   STNGLTTQTMGASGQTAFTTMGTGVKSGGQETIEMVKGGQQTLDSRRGAGYHHHTLDPC
FT                   RGGHVEVDNYRHTYSEWYNFIQPRLGDETIRGHTLIKN"
FT   gene            complement(4019568..4048822)
FT                   /gene="Dsc1"
FT                   /locus_tag="mCG_121829"
FT                   /note="gene_id=mCG121829.1"
FT   mRNA            complement(join(4019568..4019873,4019957..4020002,
FT                   4020771..4020992,4021597..4021721,4022423..4022662,
FT                   4023664..4023876,4028641..4028783,4028902..4029161,
FT                   4030096..4030281,4031297..4031431,4033130..4033296,
FT                   4035951..4036095,4041767..4041922,4042939..4043058,
FT                   4044171..4044373,4046090..4046174,4048623..4048822))
FT                   /gene="Dsc1"
FT                   /locus_tag="mCG_121829"
FT                   /product="desmocollin 1, transcript variant mCT123041"
FT                   /note="gene_id=mCG121829.1 transcript_id=mCT123041.0
FT                   created on 15-OCT-2002"
FT   CDS             complement(join(4019967..4020002,4020771..4020992,
FT                   4021597..4021721,4022423..4022662,4023664..4023876,
FT                   4028641..4028783,4028902..4029161,4030096..4030281,
FT                   4031297..4031431,4033130..4033296,4035951..4036095,
FT                   4041767..4041922,4042939..4043058,4044171..4044373,
FT                   4046090..4046174,4048623..4048685))
FT                   /codon_start=1
FT                   /gene="Dsc1"
FT                   /locus_tag="mCG_121829"
FT                   /product="desmocollin 1, isoform CRA_a"
FT                   /note="gene_id=mCG121829.1 transcript_id=mCT123041.0
FT                   protein_id=mCP69256.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q32ME9"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR009122"
FT                   /db_xref="InterPro:IPR009124"
FT                   /db_xref="InterPro:IPR014868"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:109173"
FT                   /db_xref="UniProtKB/TrEMBL:Q32ME9"
FT                   /protein_id="EDK96941.1"
FT                   /translation="MAVACAAPGSTFSKQLLFFLLVLVLFCDACQKVSLHVPSHLKAET
FT                   PVGKVNLEECLKSPSLILSSDPAFRILEDGTIYTTHDLLLSSEKRGFSILLSDGQGQEQ
FT                   KKLEVVLSAREKKVFRKRHTKEPVHNRSKRRWAPIPCSLMENSLGPFPQHIQQIQSDAA
FT                   QNYTIFYSISGPGVDKEPYNLFYIEKDTGDIYCTRSIDREQYDQFLVYGYATTADGYAP
FT                   DYPLPLLFKVEDDNDNAPYFETKLTVFSVPENCRSGTSVGQVTAIDKDEPGTLHTRLKY
FT                   KILQQIPDQPKHFSIHPDTGVITTTTPLLDREKCDTYKLVMEVRDMGGQPFGLFTTGTI
FT                   TISLEDENDNSPYFTQTSYTTEVEENRIDVEILRMVVHDQDLPNTPHSKAVYTILKGNE
FT                   NGNFKITTDPNTNEGVLCVVKPLNYEVSRQVTLQIGVLNEAQFTNAANAQPPTMCTTTV
FT                   TVKIKDRDEGPECQPPVKVIQSKDGLPAGQELLGYKAVDPETSSGEGLRYEMVGDEDNW
FT                   FEINKITGDLRTVKVLDRESKFVKNNQYNISVVATDTAGRSCTGTLVVLLEDFNDHPPQ
FT                   IDKEVTICQQEKDFAVLEPIDLDGPDNGPPFQFLLDNSSSKLWTLESQDGKRAILRQRH
FT                   NLNYNYYSVPIQIQDRHGFSAKHVLSVRVCDCTTPTECRMAVKEERDAKPNIILGKWAI
FT                   LAMVLGSALLLCILFTCFCVTTTKRTVKKCFPDDVAQQNLIVSNTEGPGEEVTEANIRL
FT                   PTQTANICDTSMSVGTLGGQGIKTQQSFEMVKGGHTLESHKGGVLGAAEPGRYAYTDWQ
FT                   TFTQPRLGEESIRGHTLIKN"
FT   mRNA            complement(join(4021768..4022662,4023664..4023876,
FT                   4028641..4028783,4028902..4029161,4030096..4030281,
FT                   4031297..4031431,4033130..4033296,4035951..4036095,
FT                   4041767..4041922,4042939..4043058,4044171..4044373,
FT                   4046090..4046174,4048623..>4048787))
FT                   /gene="Dsc1"
FT                   /locus_tag="mCG_121829"
FT                   /product="desmocollin 1, transcript variant mCT188863"
FT                   /note="gene_id=mCG121829.1 transcript_id=mCT188863.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(4022379..4022662,4023664..4023876,
FT                   4028641..4028783,4028902..4029161,4030096..4030281,
FT                   4031297..4031431,4033130..4033296,4035951..4036095,
FT                   4041767..4041922,4042939..4043058,4044171..4044373,
FT                   4046090..4046174,4048623..>4048751))
FT                   /codon_start=1
FT                   /gene="Dsc1"
FT                   /locus_tag="mCG_121829"
FT                   /product="desmocollin 1, isoform CRA_b"
FT                   /note="gene_id=mCG121829.1 transcript_id=mCT188863.0
FT                   protein_id=mCP109831.0 isoform=CRA_b"
FT                   /protein_id="EDK96942.1"
FT                   /translation="PPCALQATLSAVHRPWPLGPLQMAVACAAPGSTFSKQLLFFLLVL
FT                   VLFCDACQKVSLHVPSHLKAETPVGKVNLEECLKSPSLILSSDPAFRILEDGTIYTTHD
FT                   LLLSSEKRGFSILLSDGQGQEQKKLEVVLSAREKKVFRKRHTKEPVHNRSKRRWAPIPC
FT                   SLMENSLGPFPQHIQQIQSDAAQNYTIFYSISGPGVDKEPYNLFYIEKDTGDIYCTRSI
FT                   DREQYDQFLVYGYATTADGYAPDYPLPLLFKVEDDNDNAPYFETKLTVFSVPENCRSGT
FT                   SVGQVTAIDKDEPGTLHTRLKYKILQQIPDQPKHFSIHPDTGVITTTTPLLDREKCDTY
FT                   KLVMEVRDMGGQPFGLFTTGTITISLEDENDNSPYFTQTSYTTEVEENRIDVEILRMVV
FT                   HDQDLPNTPHSKAVYTILKGNENGNFKITTDPNTNEGVLCVVKPLNYEVSRQVTLQIGV
FT                   LNEAQFTNAANAQPPTMCTTTVTVKIKDRDEGPECQPPVKVIQSKDGLPAGQELLGYKA
FT                   VDPETSSGEGLRYEMVGDEDNWFEINKITGDLRTVKVLDRESKFVKNNQYNISVVATDT
FT                   AGRSCTGTLVVLLEDFNDHPPQIDKEVTICQQEKDFAVLEPIDLDGPDNGPPFQFLLDN
FT                   SSSKLWTLESQDGKRAILRQRHNLNYNYYSVPIQIQDRHGFSAKHVLSVRVCDCTTPTE
FT                   CRMAVKEERDAKPNIILGKWAILAMVLGSALLLCKYHYLKCCGILTC"
FT   gap             4031480..4031526
FT                   /estimated_length=47
FT   gap             4111232..4111826
FT                   /estimated_length=595
FT   gap             4134642..4135892
FT                   /estimated_length=1251
FT   gene            <4182833..>4219475
FT                   /locus_tag="mCG_140888"
FT                   /note="gene_id=mCG140888.1"
FT   mRNA            join(<4182833..4182980,4199778..4199813,4200314..4200445,
FT                   4201542..4201697,4203299..4203443,4205788..4205954,
FT                   4207410..4207544,4207836..4208021,4210089..4210357,
FT                   4210655..4210794,4212376..4212561,4214698..4214825,
FT                   4215137..4215209,4217328..4217536,4218533..4219402)
FT                   /locus_tag="mCG_140888"
FT                   /product="mCG140888, transcript variant mCT188847"
FT                   /note="gene_id=mCG140888.1 transcript_id=mCT188847.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<4182915..4182980,4199778..4199813,4200314..4200445,
FT                   4201542..4201697,4203299..4203443,4205788..4205954,
FT                   4207410..4207544,4207836..4208021,4210089..4210357,
FT                   4210655..4210794,4212376..4212561,4214698..4214825,
FT                   4215137..4215209,4217328..4217536,4218533..4219258)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140888"
FT                   /product="mCG140888, isoform CRA_c"
FT                   /note="gene_id=mCG140888.1 transcript_id=mCT188847.0
FT                   protein_id=mCP109865.0 isoform=CRA_c"
FT                   /protein_id="EDK96945.1"
FT                   /translation="QKPAAAMDWHSFRIAALLLTSLVVLEVNSEFQIQVRDHNAKNGTI
FT                   KWHSIRRQKREWIKFAAACREGEDNSKRNPIAKIHSDCAANQPVTYRISGVGIDQPPYG
FT                   IFIINQKTGEINITSIVDREVTPFFIIYCRALNAQGQDLENPLELRVRVMDINDNPPVF
FT                   SMTTFLGQIEENSNANTLVMKLNATDADEPNNLNSMIAFKIIRQEPSDSPMFTINRKTG
FT                   EIRTMNNFLDREQYSQYSLVVRGSDRDGGADGMSAESECSITILDVNDNIPYLEQSSYD
FT                   ITIEENTLHSQLLQIRVIDLDEEFSDNWKAIIFFISGNEGNWFEIEMNERTNVGTLKVV
FT                   KPLDYEAVKNLQLCIGVRNVAEFHQSIISQYRLTVTLITVTVLNVVKGCVFQPGSKTFI
FT                   VDSRMEANHTVGEFLATDCETGQATNKFKNVRYRYVMGNNPENLLVVDSGIITLRNRVT
FT                   MEQYERLNKRYEGTVLSIHDSLQRTCTGTIIMVLCGFWTTTEHPTTSTEKPVTLSITPN
FT                   VDNVHFGPAGIGLLIMGFLVLGLVPFLLISCDCGGAPGGGAGFEPVPECSDGAIHTWAV
FT                   EGPQPGGITTICVPQMPPGNANVIEYIDNSGVYTNEYCGREMQDLGGGERTTGFELMDG
FT                   VKTSAAPEICQEYSGTLRRNSMRECRDGGLNMNFMESYFCQKAYAYADEDEGRPSNDCL
FT                   LIYDIEGVGSPAGSVGCCSFIEDLDESFLDTLGPKFKKLADISLGKEIDSYPDPDPSWP
FT                   PQSTEPICPQHMEQLASGHPSISPHFGKTTVISENAYPSGPGVQHPMLIPDPLGYGNIT
FT                   VRESYTTSGTLKPSVHFHDNQQASNVVVTERVVGPISGADLHGMLEIPALRDGTNVIVT
FT                   ERVIAPGSSLPNSLTIPNPRETSNVVVTERVIQPTSGMIGNLSIPP"
FT   mRNA            join(<4182933..4182980,4199778..4199813,4200314..4200445,
FT                   4201542..4201697,4203299..4203443,4205788..4205954,
FT                   4207410..4207544,4207836..4208021,4210089..4210357,
FT                   4210655..4210794,4212376..4212561,4214698..4214825,
FT                   4215137..4215209,4217328..4217536,4218533..4219123,
FT                   4219260..>4219475)
FT                   /locus_tag="mCG_140888"
FT                   /product="mCG140888, transcript variant mCT171991"
FT                   /note="gene_id=mCG140888.1 transcript_id=mCT171991.0
FT                   created on 06-SEP-2002"
FT   CDS             join(4182933..4182980,4199778..4199813,4200314..4200445,
FT                   4201542..4201697,4203299..4203443,4205788..4205954,
FT                   4207410..4207544,4207836..4208021,4210089..4210357,
FT                   4210655..4210794,4212376..4212561,4214698..4214825,
FT                   4215137..4215209,4217328..4217536,4218533..4219123,
FT                   4219260..4219475)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140888"
FT                   /product="mCG140888, isoform CRA_a"
FT                   /note="gene_id=mCG140888.1 transcript_id=mCT171991.0
FT                   protein_id=mCP94907.0 isoform=CRA_a"
FT                   /protein_id="EDK96943.1"
FT                   /translation="MDWHSFRIAALLLTSLVVLEVNSEFQIQVRDHNAKNGTIKWHSIR
FT                   RQKREWIKFAAACREGEDNSKRNPIAKIHSDCAANQPVTYRISGVGIDQPPYGIFIINQ
FT                   KTGEINITSIVDREVTPFFIIYCRALNAQGQDLENPLELRVRVMDINDNPPVFSMTTFL
FT                   GQIEENSNANTLVMKLNATDADEPNNLNSMIAFKIIRQEPSDSPMFTINRKTGEIRTMN
FT                   NFLDREQYSQYSLVVRGSDRDGGADGMSAESECSITILDVNDNIPYLEQSSYDITIEEN
FT                   TLHSQLLQIRVIDLDEEFSDNWKAIIFFISGNEGNWFEIEMNERTNVGTLKVVKPLDYE
FT                   AVKNLQLCIGVRNVAEFHQSIISQYRLTVTLITVTVLNVVKGCVFQPGSKTFIVDSRME
FT                   ANHTVGEFLATDCETGQATNKFKNVRYRYVMGNNPENLLVVDSGIITLRNRVTMEQYER
FT                   LNKRYEGTVLSIHDSLQRTCTGTIIMVLCGFWTTTEHPTTSTEKPVTLSITPNVDNVHF
FT                   GPAGIGLLIMGFLVLGLVPFLLISCDCGGAPGGGAGFEPVPECSDGAIHTWAVEGPQPG
FT                   GITTICVPQMPPGNANVIEYIDNSGVYTNEYCGREMQDLGGGERTTGFELMDGVKTSAA
FT                   PEICQEYSGTLRRNSMRECRDGGLNMNFMESYFCQKAYAYADEDEGRPSNDCLLIYDIE
FT                   GVGSPAGSVGCCSFIEDLDESFLDTLGPKFKKLADISLGKEIDSYPDPDPSWPPQSTEP
FT                   ICPQHMEQLASGHPSISPHFGKTTVISENAYPSGPGVQHPMLIPDPLGYGNITVRESYT
FT                   TSGTLKPSVHFHDNQQASNVVVTERVVGPISGADLHGMLEIPALRDGTNVIVTERLSSA
FT                   HNVIVTERVVSGAGMSGIAGTAELGGVGGIGSSGIVSTTMGVGGTGLSMGGTATIGHMR
FT                   SASDHHFS"
FT   mRNA            join(<4182933..4182980,4199778..4199813,4200314..4200445,
FT                   4201542..4201697,4203299..4203443,4205788..4205954,
FT                   4207410..4207544,4207836..4208021,4210089..4210357,
FT                   4210661..4210794,4212376..4212561,4214698..4214825,
FT                   4215137..4215209,4217328..4217536,4218533..>4219258)
FT                   /locus_tag="mCG_140888"
FT                   /product="mCG140888, transcript variant mCT188846"
FT                   /note="gene_id=mCG140888.1 transcript_id=mCT188846.0
FT                   created on 08-MAR-2004"
FT   CDS             join(4182933..4182980,4199778..4199813,4200314..4200445,
FT                   4201542..4201697,4203299..4203443,4205788..4205954,
FT                   4207410..4207544,4207836..4208021,4210089..4210357,
FT                   4210661..4210794,4212376..4212561,4214698..4214825,
FT                   4215137..4215209,4217328..4217536,4218533..4219258)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140888"
FT                   /product="mCG140888, isoform CRA_b"
FT                   /note="gene_id=mCG140888.1 transcript_id=mCT188846.0
FT                   protein_id=mCP109864.0 isoform=CRA_b"
FT                   /protein_id="EDK96944.1"
FT                   /translation="MDWHSFRIAALLLTSLVVLEVNSEFQIQVRDHNAKNGTIKWHSIR
FT                   RQKREWIKFAAACREGEDNSKRNPIAKIHSDCAANQPVTYRISGVGIDQPPYGIFIINQ
FT                   KTGEINITSIVDREVTPFFIIYCRALNAQGQDLENPLELRVRVMDINDNPPVFSMTTFL
FT                   GQIEENSNANTLVMKLNATDADEPNNLNSMIAFKIIRQEPSDSPMFTINRKTGEIRTMN
FT                   NFLDREQYSQYSLVVRGSDRDGGADGMSAESECSITILDVNDNIPYLEQSSYDITIEEN
FT                   TLHSQLLQIRVIDLDEEFSDNWKAIIFFISGNEGNWFEIEMNERTNVGTLKVVKPLDYE
FT                   AVKNLQLCIGVRNVAEFHQSIISQYRLTVTLITVTVLNVVKGCVFQPGSKTFIVDSRME
FT                   ANHTVGEFLATDCETGQATNKFKNVRYVMGNNPENLLVVDSGIITLRNRVTMEQYERLN
FT                   KRYEGTVLSIHDSLQRTCTGTIIMVLCGFWTTTEHPTTSTEKPVTLSITPNVDNVHFGP
FT                   AGIGLLIMGFLVLGLVPFLLISCDCGGAPGGGAGFEPVPECSDGAIHTWAVEGPQPGGI
FT                   TTICVPQMPPGNANVIEYIDNSGVYTNEYCGREMQDLGGGERTTGFELMDGVKTSAAPE
FT                   ICQEYSGTLRRNSMRECRDGGLNMNFMESYFCQKAYAYADEDEGRPSNDCLLIYDIEGV
FT                   GSPAGSVGCCSFIEDLDESFLDTLGPKFKKLADISLGKEIDSYPDPDPSWPPQSTEPIC
FT                   PQHMEQLASGHPSISPHFGKTTVISENAYPSGPGVQHPMLIPDPLGYGNITVRESYTTS
FT                   GTLKPSVHFHDNQQASNVVVTERVVGPISGADLHGMLEIPALRDGTNVIVTERVIAPGS
FT                   SLPNSLTIPNPRETSNVVVTERVIQPTSGMIGNLSIPP"
FT   gap             4221945..4221964
FT                   /estimated_length=20
FT   gap             4238208..4239523
FT                   /estimated_length=1316
FT   gene            4247229..4281713
FT                   /locus_tag="mCG_140885"
FT                   /note="gene_id=mCG140885.1"
FT   mRNA            join(4247229..4247390,4256973..4257008,4257363..4257494,
FT                   4258636..4258791,4260383..4260527,4263060..4263226,
FT                   4264675..4264809,4265101..4265286,4267893..4268152,
FT                   4268457..4268596,4269918..4270247,4272340..4272476,
FT                   4273229..4273301,4275076..4275284,4276464..4277730,
FT                   4281053..4281713)
FT                   /locus_tag="mCG_140885"
FT                   /product="mCG140885"
FT                   /note="gene_id=mCG140885.1 transcript_id=mCT171990.1
FT                   created on 06-JUN-2003"
FT   CDS             join(4247343..4247390,4256973..4257008,4257363..4257494,
FT                   4258636..4258791,4260383..4260527,4263060..4263226,
FT                   4264675..4264809,4265101..4265286,4267893..4268152,
FT                   4268457..4268596,4269918..4270247,4272340..4272476,
FT                   4273229..4273301,4275076..4275284,4276464..4277483)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140885"
FT                   /product="mCG140885"
FT                   /note="gene_id=mCG140885.1 transcript_id=mCT171990.1
FT                   protein_id=mCP94908.0"
FT                   /protein_id="EDK96946.1"
FT                   /translation="MDWHSFRIAALLLTSLVVLEVNSEFQIQVRDHNAKNGTIKWHSIR
FT                   RQKREWIKFAAACREGEDNSKRNPIAKIHSDCAANQPVTYRISGVGIDQPPYGIFIINQ
FT                   KTGEINITSIVDREVTPFFIIYCRALNAQGQDLENPLELRVRVMDINDNPPVFSMTTFL
FT                   GQIEENSNANTLVMKLNATDADEPNNLNSMIAFKIIRQEPSDSPMFIINRKTGEIRTMN
FT                   NFLDREQYSQYSLVVRGSDRDGGADGMSAESECSITILDVNDNIPYLEQSSYDITIEEN
FT                   ALHSQLVQIRVIDLDEEFSDNWKAIIFFISGNEGNWFEIEMNERTNVGTLKVVKPLDYE
FT                   AMKNLQLSIGVRNVAEFHQSIISQYRLTATMVTVTVLNVIEGSVFRPGSKTFVVDSRME
FT                   ANHRVGEFVATDLDTGRASTNVRYEMGNNPENLLVVDSRTGIITLRNRVTMEQYQRLNG
FT                   EYKGTVLSIDDSLQRTCTGTIVIELSGTGWVTGSESGGSSSGSGDDRDRVTNGYQGTSS
FT                   TENPQRVTGSWGGSGIDGTRPNTNPFQGDPDETLETPLYGDNVHFGPAGIGLLIMGFLV
FT                   LGLVPFLLICCDCGGAPGGGAGFEPVPECSDGAIHTWAVEGPQPEPHEGITTICVPQMP
FT                   PGNANVIEYIDNSGVYTNEYCGREMQDLGGGERTTGFELMDGVKTSAAPEICQEYSGTL
FT                   RRNSMRECRDGGLNMNFMESYFCQKAYAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGC
FT                   CSFIGEDLDESFLDTLGPKFKKLADISLGKEIDSYPDSDPSWPPQSTEPMCPQHTEPLG
FT                   SGHPPISPHFGTTTVISENAYHSGPGVQHPVPIPDPLGYGNVTVRESYTTSGTLKPSVH
FT                   FHDNQQASNVVVTERVVGPISGADLHGMLEIPDLRGGANVIVTERVIAPGSSLPTSLTI
FT                   PNPQETSNVVVTERVIQPTSGMIGNLSMTPELSSAHNVIVTERVVSGAGMSEIAGTAGL
FT                   GGVGGIGSSGLVSTTMGASGTGLNMGGTATIGHMRSSSDHHFSQTVGSASPSMARSRIT
FT                   KYNTVQYSK"
FT   gap             4251760..4252190
FT                   /estimated_length=431
FT   gap             4253847..4255121
FT                   /estimated_length=1275
FT   gap             4257202..4257221
FT                   /estimated_length=20
FT   gap             4282753..4282808
FT                   /estimated_length=56
FT   gene            4313019..4348568
FT                   /locus_tag="mCG_140886"
FT                   /note="gene_id=mCG140886.1"
FT   mRNA            join(4313019..4313274,4324505..4324540,4325243..4325374,
FT                   4326518..4326673,4328265..4328409,4330715..4330881,
FT                   4332277..4332411,4332703..4332888,4333679..4333938,
FT                   4334243..4334382,4335692..4336030,4341159..4341295,
FT                   4341606..4341678,4343783..4343991,4344987..4348568)
FT                   /locus_tag="mCG_140886"
FT                   /product="mCG140886"
FT                   /note="gene_id=mCG140886.1 transcript_id=mCT171989.1
FT                   created on 11-JUN-2003"
FT   CDS             join(4313227..4313274,4324505..4324540,4325243..4325374,
FT                   4326518..4326673,4328265..4328409,4330715..4330881,
FT                   4332277..4332411,4332703..4332888,4333679..4333938,
FT                   4334243..4334382,4335692..4336030,4341159..4341295,
FT                   4341606..4341678,4343783..4343991,4344987..4346006)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140886"
FT                   /product="mCG140886"
FT                   /note="gene_id=mCG140886.1 transcript_id=mCT171989.1
FT                   protein_id=mCP94909.0"
FT                   /db_xref="GOA:B2RQH0"
FT                   /db_xref="InterPro:IPR000233"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR009122"
FT                   /db_xref="InterPro:IPR009123"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR027397"
FT                   /db_xref="MGI:MGI:2664357"
FT                   /db_xref="UniProtKB/TrEMBL:B2RQH0"
FT                   /protein_id="EDK96947.1"
FT                   /translation="MDWHSFRIAALLLTSLVVLEVNSEFQIQVRDHNAKNGTIKWHSIR
FT                   RQKREWIKFAAACREGEDNSKRNPIAKIHSDCAANQPVTYRISGVGIDQPPYGIFIINQ
FT                   KTGEINITSIVDREVTPFFIIYCRALNAQGQDLENPLELRVRVMDINDNPPVFSMTTFL
FT                   GQIEENSNANTLVMKLNATDADEPNNLNSMIAFKIIRQEPSDSPMFIINRKTGEIRTMN
FT                   NFLDREQYSQYSLVVRGSDRDGGADGMSAESECSITILDVNDNIPYLEQSSYDIEIEEN
FT                   ALHSQLVQIRVIDLDEEFSDNWKAIIFFISGNEGNWFEIEMNERTNVGTLKVVKPLDYE
FT                   AMKNLQLSIGVRNVAEFHQSIISQYRLTATMVTVTVLNVIEGSVFRPGSKTFVVDSRME
FT                   ANHRVGEFVATDLDTGRASTNVRYEMGNNPENLLVVDSRTGIITLRNRVTMEQYQRLNG
FT                   EYKGTVLSIDDSLQRTCTGTIVIELSGTGWVPGSDGGGSSSGSGGNRDPVTNGYQGTST
FT                   VGPQRVTGSGGVTSSGGGSGVNNTPGRQNPLDEPEPEPFDITEDNVHFGPAGIGLLIMG
FT                   FLVLGLVPFLLICCDCGGAPGGGAGFEPVPECSDGAIHTWAIEGPQPEPHDGITTICVP
FT                   QMPPGNANVIEYIDNSGVYTNEYCGREMQDLGGGERTTGFELMDGVKTSAAPEICQEYS
FT                   GTLRRNSMRECRDGGLNMNFMESYFCQKAYAYADEDEGRPSNDCLLIYDIEGVGSPAGS
FT                   VGCCSFIGEDLDESFLDTLGPKFKKLADISLGKEIDSYPDPDSSWPPQSTEPMCPQSTE
FT                   PLGSGYPPISPHFGTTTVISENAYPSGPGVQHPLPIPDPLGYGNVTVRESYATSGTLKP
FT                   SVHFHDNQQASNVVVTERVVGPVPGADLHGMLEIPDLRDGTNVIVTERVIAPGSSLPTS
FT                   LTIPNPRETSNVVVTERVIQPTSGMIGNLSMTPELSSAQNVIVTERVVSGAGMSGIAGT
FT                   AGLGGVGGIGSSGLVSTTMGAAGTGLNMGGTATIGHMRSSSDHHFSQTIGSASPNMARS
FT                   RITKYSTVQYSK"
FT   gap             4321008..4321084
FT                   /estimated_length=77
FT   gap             4324755..4324774
FT                   /estimated_length=20
FT   gap             4372739..4373100
FT                   /estimated_length=362
FT   gene            <4383584..>4408409
FT                   /gene="Dsg4"
FT                   /locus_tag="mCG_140887"
FT                   /note="gene_id=mCG140887.0"
FT   mRNA            join(<4383584..4383715,4385975..4386130,4386439..4386583,
FT                   4388518..4388684,4389709..4389843,4391437..4391622,
FT                   4393610..4393881,4395293..4395432,4398043..4398261,
FT                   4399188..4399262,4401627..4401766,4401919..4401982,
FT                   4403285..4403493,4407643..>4408409)
FT                   /gene="Dsg4"
FT                   /locus_tag="mCG_140887"
FT                   /product="desmoglein 4"
FT                   /note="gene_id=mCG140887.0 transcript_id=mCT171988.0
FT                   created on 13-AUG-2002"
FT   CDS             join(<4383584..4383715,4385975..4386130,4386439..4386583,
FT                   4388518..4388684,4389709..4389843,4391437..4391622,
FT                   4393610..4393881,4395293..4395432,4398043..4398261,
FT                   4399188..4399262,4401627..4401766,4401919..4401982,
FT                   4403285..4403493,4407643..>4408409)
FT                   /codon_start=1
FT                   /gene="Dsg4"
FT                   /locus_tag="mCG_140887"
FT                   /product="desmoglein 4"
FT                   /note="gene_id=mCG140887.0 transcript_id=mCT171988.0
FT                   protein_id=mCP94910.0"
FT                   /protein_id="EDK96948.1"
FT                   /translation="VKELDIENGTTTWQTVRRQKREWIKFAAACREGEDNSKRNPIARI
FT                   RSDCEVSQRITYRISGAGIDRPPYGVFTINPRTGEINITSVVDREITPLFLIHCRALNS
FT                   RGEDLERPLELRVKVMDVNDNPPVFTQNVYTANIEENSDANALVVKLSATDADEDNHLN
FT                   SKIAYKIISQEPAGAPMFMVNRYTGEVRTMSNFLDREQHSMYNLLVRGSDRDGATDGLS
FT                   SECDCRIKILDVNDNFPILEKTSYSASIEENCLSSELIRLQAIDLDEEGTDNWLAQYSI
FT                   LSGNDGNWFEIQTDPKTNEGILKVVKMLDYEQEPNIYLSIGVRNQAEFHHSVASQFQMH
FT                   STPVRIQVVNVREGPTFSPSSMTFSLRGGMRGASLMNYVLGTYTAIDMDTGNPATNVRY
FT                   VIGHDAGSWLKVDSRTGEIQFSREFDMKSKYITDGIYAAQILAIDDGSGRTATGTICIE
FT                   IPDANDYCPVIYAESRSVCTHASSVRIYVNDHSFGSPFTFCVVDESPDIANIWDIRSIN
FT                   GTSAILMTEQTLSPGPYQIPILVKDMSPLLLLMCCCKRRQPEGLGTRFAPVPEGGEGVM
FT                   QPWRIEGAHPEDRDVSNICVPMTASNTQDRIDSSEIYTNTYAGGGTVEGGVSGVELNTG
FT                   VGTATGMVAAGATGTLRKRSSTIGTLREYQDTGMNMAFLDSYFSEKAYAYADEDEGRPA
FT                   NDCLLIYDHEGAGSPVGSIGCCSWIVDDLDESYIETLDPKFRTLAEICLDTEIEPFPSH
FT                   QACIPISTDLPLLGPNYFVNESSGMTLSEAEFQAEMAAASEPMIHGDIIVTETYTTSDP
FT                   CVQPTTIVFDSQIPPNVVVTETVMAPVYDVQGNICVPAEIANTHNVYYAERVVASPGIP
FT                   DMGNSNISDACIGPVMSGGILVGPEIQVTQMMSPDIHISQTTGSTSPMTSQHRVTRYSN
FT                   MHYSR"
FT   gap             4387096..4387115
FT                   /estimated_length=20
FT   gap             4393404..4393423
FT                   /estimated_length=20
FT   gene            4436127..4437435
FT                   /pseudo
FT                   /locus_tag="mCG_1031599"
FT                   /note="gene_id=mCG1031599.1"
FT   mRNA            4436127..4437435
FT                   /pseudo
FT                   /locus_tag="mCG_1031599"
FT                   /note="gene_id=mCG1031599.1 transcript_id=mCT149303.1
FT                   created on 18-DEC-2002"
FT   gap             4438082..4438101
FT                   /estimated_length=20
FT   gap             4441281..4441302
FT                   /estimated_length=22
FT   gene            4447718..4478948
FT                   /gene="Dsg3"
FT                   /locus_tag="mCG_121832"
FT                   /note="gene_id=mCG121832.2"
FT   mRNA            join(4447718..4447859,4457806..4457841,4458520..4458651,
FT                   4459494..4459649,4460057..4460201,4461596..4461762,
FT                   4462563..4462691,4463151..4463316,4468375..4468517,
FT                   4468795..4468858,4469871..4470091,4471129..4471430,
FT                   4475516..4475556,4476712..4476818,4478331..4478948)
FT                   /gene="Dsg3"
FT                   /locus_tag="mCG_121832"
FT                   /product="desmoglein 3"
FT                   /note="gene_id=mCG121832.2 transcript_id=mCT123044.2
FT                   created on 19-JUN-2003"
FT   CDS             join(4447812..4447859,4457806..4457841,4458520..4458651,
FT                   4459494..4459649,4460057..4460201,4461596..4461762,
FT                   4462563..4462691,4463151..4463316,4468375..4468517,
FT                   4468795..4468858,4469871..4470091,4471129..4471430,
FT                   4475516..4475556,4476712..4476818,4478331..4478348)
FT                   /codon_start=1
FT                   /gene="Dsg3"
FT                   /locus_tag="mCG_121832"
FT                   /product="desmoglein 3"
FT                   /note="gene_id=mCG121832.2 transcript_id=mCT123044.2
FT                   protein_id=mCP69342.2"
FT                   /protein_id="EDK96949.1"
FT                   /translation="MTCLFPRALGSLALLMVVLLVQGELHVKQGGQHREDGTALQLAKR
FT                   RYKREWVKFAKPCREREDNSRRNPIAKITSDFQKNQKITYRISGVGIDQPPFGIFVVDP
FT                   NNGDINITAIVDREETPSFLITCRALNALGQDVERPLILTVKILDVNDNPPIFSQTIFK
FT                   GEIEENSASNSLVMILNATDADEPNHMNSKIAFKIVSQEPAGMSMFLISRNTGEVRTLT
FT                   SSLDREQISSYHLVVSGADNDGTGLSTQCECSIKIKDVNDNFPVLRESQYSARIEENTL
FT                   NAELLRFQVTDWDEEYTDNWLAVYFFTSGNEGNWFEIETDPRTNEVAPLLLLTCDCGSG
FT                   PIGGAATGGFIPVPDGSEGTIHQWGIEGAQPEDKEITNICVPPVTTNGADFMESSEVCT
FT                   NTYAGGTMVEGASGMEMITKLGGATGATAALGPCSLGYSGTMRTRHSTGGTLKDYAAPV
FT                   NMTFLGSYFSQKSLAYAEEEDEREVNDCLLIYDDEGEDAAPHSPTLSSCSIFADDLDDN
FT                   FLDSLGPKFKKLAEICLGIDDEAKQAKPGPKDSGSGADTCARSMEVPQSGSNRQYLFLL
FT                   LPSNEEAGARIHRAPSTNPRLLLLCLVHSEQRSVHSQYGSDAQGMNTL"
FT   gap             4450098..4450117
FT                   /estimated_length=20
FT   gap             4452612..4452631
FT                   /estimated_length=20
FT   gap             4464379..4466964
FT                   /estimated_length=2586
FT   gene            complement(4480087..4480849)
FT                   /pseudo
FT                   /locus_tag="mCG_123163"
FT                   /note="gene_id=mCG123163.1"
FT   mRNA            complement(4480087..4480849)
FT                   /pseudo
FT                   /locus_tag="mCG_123163"
FT                   /note="gene_id=mCG123163.1 transcript_id=mCT124393.1
FT                   created on 18-DEC-2002"
FT   gene            4489571..4538362
FT                   /gene="Dsg2"
FT                   /locus_tag="mCG_123158"
FT                   /note="gene_id=mCG123158.1"
FT   mRNA            join(4489571..4489842,4507554..4507589,4509005..4509139,
FT                   4513070..4513231,4513364..4513508,4514542..4514708,
FT                   4516738..4516875,4516967..4517159,4529795..4529916,
FT                   4532178..4532507,4535152..4538362)
FT                   /gene="Dsg2"
FT                   /locus_tag="mCG_123158"
FT                   /product="desmoglein 2"
FT                   /note="gene_id=mCG123158.1 transcript_id=mCT124388.1
FT                   created on 22-NOV-2002"
FT   CDS             join(4489783..4489842,4507554..4507589,4509005..4509139,
FT                   4513070..4513231,4513364..4513508,4514542..4514708,
FT                   4516738..4516875,4516967..4517159,4529795..4529916,
FT                   4532178..4532507,4535152..4536174)
FT                   /codon_start=1
FT                   /gene="Dsg2"
FT                   /locus_tag="mCG_123158"
FT                   /product="desmoglein 2"
FT                   /note="gene_id=mCG123158.1 transcript_id=mCT124388.1
FT                   protein_id=mCP69133.1"
FT                   /protein_id="EDK96950.1"
FT                   /translation="MARSPGDRCALLLLVQLLAVVCLDFGNGLHLEVFSPRNEGKPFPK
FT                   HTHLVRQKRAWITAPVALREGEDLSRKNPIAKIHSDLAEEKGIKITYKYTGKGITEPPF
FT                   GIFVFDRNTGELNITSILDREETPYFLLTGYALDSRGNNLEKPLELRIKVLDINDNEPV
FT                   FTQEVFVGSIEELSAAHTLVMKITATDADDPETLNAKVSYRIVSQEPANSHMFYLNKDT
FT                   GEIYTTSFTLDREEHSSYSLTVEARDGNGQITDKPVQQAQVQIRILDVNDNIPVVENKM
FT                   YEGTVEENQVNVEVMRIKVTDADEVGSDNWLANFTFASGNEGGYFHIETDTQTNEGIVT
FT                   LVKVSLVPLLLLICHCGGGAKGFTPIPGTIEMLHPWNNEGAPPEDKVVPSLLVADHAES
FT                   SAVRGGVGGAMLKEGMMKGSSSASVTKGQHELSEVDGRWEEHRSLLTAGATHHVRTAGT
FT                   IAANEAVRTRATGSSRDMSGARGAVAVNEEFLRSYFTEKAASYNGEDDLHMAKDCLLVY
FT                   SQEDTASLRGSVGCCSFIEGELDDLFLDDLGLKFKTLAEVCLGRKIDLDVDIEQRQKPV
FT                   REASVSAASGSHYEQAVTSSESAYSSNTGFPAPKPLHEVHTEKVTQEIVTESSVSSRQS
FT                   QKVVPPPDPVASGNIIVTETSYAKGSAVPPSTVLLAPRQPQSLIVTERVYAPTSTLVDQ
FT                   HYANEEKVLVTERVIQPNGGIPKPLEVTQHLKDAQYVMVRERESILAPSSGVQPTLAMP
FT                   SVAAGGQNVTVTERILTPASTLQSSYQIPSETSITARNTVLSSVGSIGPLPNLDLEESD
FT                   RPNSTITTSSTRVTKHSTMQHSYS"
FT   gap             4501715..4501734
FT                   /estimated_length=20
FT   gap             4503721..4503740
FT                   /estimated_length=20
FT   gap             4520680..4521669
FT                   /estimated_length=990
FT   gap             4523848..4523867
FT                   /estimated_length=20
FT   gap             4525154..4525173
FT                   /estimated_length=20
FT   gap             4526461..4529411
FT                   /estimated_length=2951
FT   gene            complement(4531801..>4592544)
FT                   /locus_tag="mCG_145816"
FT                   /note="gene_id=mCG145816.0"
FT   mRNA            complement(join(4531801..4532521,4532750..4532916,
FT                   4591726..>4592544))
FT                   /locus_tag="mCG_145816"
FT                   /product="mCG145816"
FT                   /note="gene_id=mCG145816.0 transcript_id=mCT185924.0
FT                   created on 03-JUL-2003"
FT   gap             4539955..4540039
FT                   /estimated_length=85
FT   gap             4548278..4549723
FT                   /estimated_length=1446
FT   gap             4556934..4557033
FT                   /estimated_length=100
FT   gap             4562977..4562996
FT                   /estimated_length=20
FT   CDS             complement(4592272..>4592532)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145816"
FT                   /product="mCG145816"
FT                   /note="gene_id=mCG145816.0 transcript_id=mCT185924.0
FT                   protein_id=mCP107337.0"
FT                   /protein_id="EDK96951.1"
FT                   /translation="SIGTLALRNVQTDTFGKEGNRPKATMRRYSQSKTTYCPAPLSLTV
FT                   LEALTHPIPDLLLNVLLASGNDFLSQISDHTFVNQKYRISL"
FT   gene            4592696..4601602
FT                   /gene="Ttr"
FT                   /locus_tag="mCG_123157"
FT                   /note="gene_id=mCG123157.1"
FT   mRNA            join(4592696..4592790,4593739..4593869,4597262..4597397,
FT                   4600914..4601602)
FT                   /gene="Ttr"
FT                   /locus_tag="mCG_123157"
FT                   /product="transthyretin"
FT                   /note="gene_id=mCG123157.1 transcript_id=mCT124387.0
FT                   created on 15-OCT-2002"
FT   CDS             join(4592722..4592790,4593739..4593869,4597262..4597397,
FT                   4600914..4601021)
FT                   /codon_start=1
FT                   /gene="Ttr"
FT                   /locus_tag="mCG_123157"
FT                   /product="transthyretin"
FT                   /note="gene_id=mCG123157.1 transcript_id=mCT124387.0
FT                   protein_id=mCP69120.1"
FT                   /db_xref="GOA:Q5M9K1"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023418"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="MGI:MGI:98865"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M9K1"
FT                   /protein_id="EDK96952.1"
FT                   /translation="MASLRLFLLCLAGLVFVSEAGPAGAGESKCPLMVKVLDAVRGSPA
FT                   VDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGI
FT                   SPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN"
FT   gene            complement(4609834..4610279)
FT                   /locus_tag="mCG_123152"
FT                   /note="gene_id=mCG123152.1"
FT   mRNA            complement(4609834..4610279)
FT                   /locus_tag="mCG_123152"
FT                   /product="mCG123152"
FT                   /note="gene_id=mCG123152.1 transcript_id=mCT124382.0
FT                   created on 18-DEC-2002"
FT   CDS             complement(4609869..4610240)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123152"
FT                   /product="mCG123152"
FT                   /note="gene_id=mCG123152.1 transcript_id=mCT124382.0
FT                   protein_id=mCP69379.1"
FT                   /db_xref="GOA:G3UWD7"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="MGI:MGI:3642381"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWD7"
FT                   /protein_id="EDK96953.1"
FT                   /translation="MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLS
FT                   KKRVVRKSIARVLTVINHTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLTKHEEKLKT
FT                   KKQHRKERLYPLRKYAVKA"
FT   gene            complement(4613280..4673620)
FT                   /gene="B4galt6"
FT                   /locus_tag="mCG_123155"
FT                   /note="gene_id=mCG123155.1"
FT   mRNA            complement(join(4613280..4615745,4616212..4616313,
FT                   4616498..4616620,4619625..4619812,4627972..4628088,
FT                   4633638..4633762,4647263..4647376,4655196..4655312,
FT                   4672468..4673162,4673419..4673620))
FT                   /gene="B4galt6"
FT                   /locus_tag="mCG_123155"
FT                   /product="UDP-Gal:betaGlcNAc beta
FT                   1,4-galactosyltransferase, polypeptide 6"
FT                   /note="gene_id=mCG123155.1 transcript_id=mCT124385.0
FT                   created on 15-OCT-2002"
FT   CDS             complement(join(4615598..4615745,4616212..4616313,
FT                   4616498..4616620,4619625..4619812,4627972..4628088,
FT                   4633638..4633762,4647263..4647376,4655196..4655312,
FT                   4672468..4672582))
FT                   /codon_start=1
FT                   /gene="B4galt6"
FT                   /locus_tag="mCG_123155"
FT                   /product="UDP-Gal:betaGlcNAc beta
FT                   1,4-galactosyltransferase, polypeptide 6"
FT                   /note="gene_id=mCG123155.1 transcript_id=mCT124385.0
FT                   protein_id=mCP69103.1"
FT                   /db_xref="GOA:Q3UUA9"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR027995"
FT                   /db_xref="MGI:MGI:1928380"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UUA9"
FT                   /protein_id="EDK96954.1"
FT                   /translation="MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFM
FT                   VQARGIMLRENVKTIGHMIRLYTNKNTTLNGTDYPEGNNTSDYLVQTTTYLPQNFTYLP
FT                   HLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSEIGPGGHWRPKDCKPRWKVAVLIP
FT                   FRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDRAWD
FT                   CVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKIN
FT                   GFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRY
FT                   SKERQYIDGLNNLLYTPKILVDRLYTNISVNLMPELAPIEDY"
FT   gap             4619158..4619177
FT                   /estimated_length=20
FT   gap             4662486..4662516
FT                   /estimated_length=31
FT   gap             4669062..4670051
FT                   /estimated_length=990
FT   gap             4673163..4673418
FT                   /estimated_length=256
FT   gap             4683123..4683351
FT                   /estimated_length=229
FT   gap             4690112..4690588
FT                   /estimated_length=477
FT   gap             4702781..4702800
FT                   /estimated_length=20
FT   gap             4709244..4709263
FT                   /estimated_length=20
FT   gap             4710675..4710694
FT                   /estimated_length=20
FT   gap             4712175..4712194
FT                   /estimated_length=20
FT   gap             4714527..4714546
FT                   /estimated_length=20
FT   gap             4725264..4726481
FT                   /estimated_length=1218
FT   gap             4727821..4727840
FT                   /estimated_length=20
FT   gene            complement(4745706..4824572)
FT                   /gene="D030074E01Rik"
FT                   /locus_tag="mCG_123159"
FT                   /note="gene_id=mCG123159.1"
FT   mRNA            complement(join(4745706..4746791,4747704..4747793,
FT                   4749368..4749513,4753455..4753556,4756930..4757136,
FT                   4759940..4759998,4760100..4760168,4761441..4761537,
FT                   4763436..4763583,4765237..4765679,4770015..4770169,
FT                   4772613..4772739,4774075..4774149,4774946..4775076,
FT                   4775615..4775809,4779398..4779506,4781130..4781354,
FT                   4783445..4783576,4788938..4789043,4791400..4791500,
FT                   4791973..4792123,4793532..4793647,4794455..4794708,
FT                   4796265..4796358,4799104..4799257,4802394..4802568,
FT                   4803126..4803215,4813561..4813755,4824392..4824572))
FT                   /gene="D030074E01Rik"
FT                   /locus_tag="mCG_123159"
FT                   /product="RIKEN cDNA D030074E01"
FT                   /note="gene_id=mCG123159.1 transcript_id=mCT124389.1
FT                   created on 18-DEC-2002"
FT   CDS             complement(join(4746557..4746791,4747704..4747793,
FT                   4749368..4749513,4753455..4753556,4756930..4757136,
FT                   4759940..4759998,4760100..4760168,4761441..4761537,
FT                   4763436..4763583,4765237..4765679,4770015..4770169,
FT                   4772613..4772739,4774075..4774149,4774946..4775076,
FT                   4775615..4775809,4779398..4779506,4781130..4781354,
FT                   4783445..4783576,4788938..4789043,4791400..4791500,
FT                   4791973..4792123,4793532..4793647,4794455..4794708,
FT                   4796265..4796358,4799104..4799257,4802394..4802568,
FT                   4803126..4803215,4813561..4813755,4824392..4824548))
FT                   /codon_start=1
FT                   /gene="D030074E01Rik"
FT                   /locus_tag="mCG_123159"
FT                   /product="RIKEN cDNA D030074E01"
FT                   /note="gene_id=mCG123159.1 transcript_id=mCT124389.1
FT                   protein_id=mCP69143.1"
FT                   /protein_id="EDK96955.1"
FT                   /translation="MAQCVQSVQELIPDSFVPCVAALCSDEAERLTRLNHLSFSELLKP
FT                   FSRLTSEVHMRDPNNQLHIIKNLKIAVSNIVTQPPQPGAIGKLLNDVVSGSQPAEGLVA
FT                   NVITAGDYDLNISATTPWFESYRETFLQSMPASDHEFLNHYLACMLVASSGEAEPMEQF
FT                   SKLSQEQHRIQHNNDYSYPKWFIPNTLKYYVLLHDVTSGDEQRAESIYEEMKQKYGTQG
FT                   CYLLKINSRAPNRASDEQIPDPWSQYLQKNSIQNQESYEDGPCTMTSSKNSDSNLLSLD
FT                   GLDNEVKDGLPNNFRIHPLQIDQCGDPPNNTDGSESKSASSVHETKKASTAVIRGACLT
FT                   LTDHDRIRQFIQEFTFRGLLPHIEKTIRQLNDQLISRKGLSRSLFSATKKWFSGSKVPE
FT                   KSINELKNTSGLLYPPEAPELQIRKMADLCFLVQHYDLAYSCYHTAKKDFLNDQAMLYA
FT                   AGALEMAAVSAFLQPGAPRPYPAHYMDTAIQTYRDICKNMVLAERCVLLSAEILKSQSK
FT                   YSEAAALLIRLTSEDSDLRSALLLEQAAHCFINMKSPMVRKYAFHMILAGHRFSKAGQK
FT                   KHALRCYCQAMQVYKGKGWSLAEDHINFTIGRQSYTLRQLDNAVSAFRHILINESKQSA
FT                   AQQGAFLREYLYVYKNVNQLSPDGPLPQLPLPYINSSATRVFFGHDRRPADGEKQAATH
FT                   ISLDQEYDSESSQQWRELEEHVVAVANKGVIPSSFYPTQYCLNSYSDNSRFPLAVVEEP
FT                   ITVEVAFRNPLKVPLLLSDLSLLWKFQPKDASGKDIEKVKERVTGEPEMIGTEVISEFL
FT                   INSEESKVARLKLFPHHIGELHILGVVYNLGTIQGSGTVDGIGALPGCHTGKHSLSMSV
FT                   RGRQDLEIQGPRLNNTKEEKTSVKYGPDRRLDPIVTEEMPLLEVFFIHFPTGLLCGEIR
FT                   KAYVEFVNVSKCPLTGLKVVSKRPEFFTFGGNTAALTPLSPSTSENCSAYKTVVTASPS
FT                   LGTALVSTASSMDFGTGTGQQLEAIPVPLPDSVLLPGASIQLPMWLRGPDEEGVHEINF
FT                   LFYYESVKKQPKKRHRILRHTAVICTSRSLNVRATVCRSNSLEDEEGRGGNMLVFVDVE
FT                   NTNTSEAGVKEFHMVQVSSSSKHWQLHKSVNISENKDAKLASREKGKFCFKAVRCKQKE
FT                   GGIQSSEKYTFADIIFGNEQIISSASPCADFFYRSLSSELKKTQDQLSAYPEKHREATE
FT                   GAVRLVEKCSEVDLSIVILWKVVHCGQQASAYVVEDNKQLILEGQHHVVVRTVGKEAFS
FT                   HSQKEEPPEMELLKFFRPENTTVSTRPSVEQLSNLIKTSLHYPESFHHPFHQKSLCLVP
FT                   VTLLLSNCSKADVDVIVDLRHKTTSPEALETHGSFTWLGQTQYKLQLKSQEMHSLQLKA
FT                   CFVHTGVYNLGTPRVFAKLSDHVTVFETSQQNSMPALIIINNA"
FT   gap             4831583..4833326
FT                   /estimated_length=1744
FT   gap             4843913..4843932
FT                   /estimated_length=20
FT   gap             4864972..4865322
FT                   /estimated_length=351
FT   gap             4871661..4871803
FT                   /estimated_length=143
FT   gene            4889045..4911585
FT                   /locus_tag="mCG_123160"
FT                   /note="gene_id=mCG123160.1"
FT   mRNA            join(4889045..4889377,4901885..4902041,4905315..4905409,
FT                   4906637..4906727,4908757..4908864,4910685..4911585)
FT                   /locus_tag="mCG_123160"
FT                   /product="mCG123160"
FT                   /note="gene_id=mCG123160.1 transcript_id=mCT124390.1
FT                   created on 18-DEC-2002"
FT   CDS             join(4889214..4889377,4901885..4902041,4905315..4905409,
FT                   4906637..4906727,4908757..4908864,4910685..4910771)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123160"
FT                   /product="mCG123160"
FT                   /note="gene_id=mCG123160.1 transcript_id=mCT124390.1
FT                   protein_id=mCP69157.1"
FT                   /protein_id="EDK96956.1"
FT                   /translation="MGSLLSSDSSKSAPASATPRTLERSGDSELPITSFDCSVCLEVLH
FT                   QPVRTRCGHVFCRSCIATSIKNNNKWTCPYCRAYLPSEGVPATDIAKRMKSEYQNCAEC
FT                   GTLVCLSDMRAHIRTCEKYIDKYGPLLELGDTTARCVCPFCQRELDEDCLLDHCIIHHR
FT                   SERRPVFCPLCHSRPDESPSTFNGSLIRHLQVSHTLFYDDFIDFDIIEEAIIRRVLDRS
FT                   LLEYVNQSNTT"
FT   gap             4916530..4916549
FT                   /estimated_length=20
FT   gap             4920747..4920766
FT                   /estimated_length=20
FT   gene            <4928868..4955972
FT                   /gene="Rnf138"
FT                   /locus_tag="mCG_123156"
FT                   /note="gene_id=mCG123156.2"
FT   mRNA            join(4928868..4929067,4929484..4929696,4936254..4936419,
FT                   4938206..4938321,4945505..4945561,4948574..4948685,
FT                   4952095..4952202,4953772..4955968)
FT                   /gene="Rnf138"
FT                   /locus_tag="mCG_123156"
FT                   /product="ring finger protein 138, transcript variant
FT                   mCT124386"
FT                   /note="gene_id=mCG123156.2 transcript_id=mCT124386.2
FT                   created on 09-JUN-2003"
FT   mRNA            join(<4928868..4929067,4929484..4929696,4936254..4936419,
FT                   4938180..4938321,4945505..4945561,4948574..4948685,
FT                   4953772..4953959)
FT                   /gene="Rnf138"
FT                   /locus_tag="mCG_123156"
FT                   /product="ring finger protein 138, transcript variant
FT                   mCT188849"
FT                   /note="gene_id=mCG123156.2 transcript_id=mCT188849.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<4928868..4929067,4929484..4929696,4936254..4936419,
FT                   4938206..4938321,4945505..4945561,4948574..4948685,
FT                   4953772..4953959)
FT                   /gene="Rnf138"
FT                   /locus_tag="mCG_123156"
FT                   /product="ring finger protein 138, transcript variant
FT                   mCT188848"
FT                   /note="gene_id=mCG123156.2 transcript_id=mCT188848.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(4928869..4929067,4929484..4929696,4936254..4936419,
FT                   4938206..4938321,4948574..4948685,4953772..4955972)
FT                   /gene="Rnf138"
FT                   /locus_tag="mCG_123156"
FT                   /product="ring finger protein 138, transcript variant
FT                   mCT174627"
FT                   /note="gene_id=mCG123156.2 transcript_id=mCT174627.1
FT                   created on 09-JUN-2003"
FT   CDS             join(<4928961..4929067,4929484..4929696,4936254..4936419,
FT                   4938206..4938321,4945505..4945561,4948574..4948685,
FT                   4953772..4953840)
FT                   /codon_start=1
FT                   /gene="Rnf138"
FT                   /locus_tag="mCG_123156"
FT                   /product="ring finger protein 138, isoform CRA_c"
FT                   /note="gene_id=mCG123156.2 transcript_id=mCT188848.0
FT                   protein_id=mCP109840.0 isoform=CRA_c"
FT                   /protein_id="EDK96959.1"
FT                   /translation="GLRTPALKPRDGAGPPLFRPVTETEREARRGSGHLRALSGRRAQG
FT                   RHHHHYYHHHLGSCRRRRLSRPPLAMSEELSAATSYTEDDFYCPVCQEVLKTPVRTAAC
FT                   QHVFCRKCFLTAMRESGIHCPLCRGSVTRRERACPERALDLENIMRRFSGSCRCCSKKI
FT                   KFYRMRHHYKSCKKYQDEYGVSSVIPNFKISQDSVRSSNRSETSASDNTETYQEDTSSS
FT                   GHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVNLQLDEETQYQTAVEESFQVNM"
FT   CDS             join(<4928961..4929067,4929484..4929696,4936254..4936419,
FT                   4938180..4938191)
FT                   /codon_start=1
FT                   /gene="Rnf138"
FT                   /locus_tag="mCG_123156"
FT                   /product="ring finger protein 138, isoform CRA_d"
FT                   /note="gene_id=mCG123156.2 transcript_id=mCT188849.0
FT                   protein_id=mCP109841.0 isoform=CRA_d"
FT                   /protein_id="EDK96960.1"
FT                   /translation="GLRTPALKPRDGAGPPLFRPVTETEREARRGSGHLRALSGRRAQG
FT                   RHHHHYYHHHLGSCRRRRLSRPPLAMSEELSAATSYTEDDFYCPVCQEVLKTPVRTAAC
FT                   QHVFCRKCFLTAMRESGIHCPLCRGSVTRRERACPERALDLENIMRRFSGSCRCCSKKI
FT                   IF"
FT   CDS             join(4929587..4929696,4936254..4936419,4938206..4938321,
FT                   4945505..4945561,4948574..4948685,4952095..4952202,
FT                   4953772..4953840)
FT                   /codon_start=1
FT                   /gene="Rnf138"
FT                   /locus_tag="mCG_123156"
FT                   /product="ring finger protein 138, isoform CRA_a"
FT                   /note="gene_id=mCG123156.2 transcript_id=mCT124386.2
FT                   protein_id=mCP69112.2 isoform=CRA_a"
FT                   /protein_id="EDK96957.1"
FT                   /translation="MSEELSAATSYTEDDFYCPVCQEVLKTPVRTAACQHVFCRKCFLT
FT                   AMRESGIHCPLCRGSVTRRERACPERALDLENIMRRFSGSCRCCSKKIKFYRMRHHYKS
FT                   CKKYQDEYGVSSVIPNFKISQDSVRSSNRSETSASDNTETYQEDTSSSGHPTFKCPLCQ
FT                   ESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYGEF
FT                   VNLQLDEETQYQTAVEESFQVNM"
FT   CDS             join(4929587..4929696,4936254..4936419,4938206..4938321,
FT                   4948574..4948685,4953772..4953840)
FT                   /codon_start=1
FT                   /gene="Rnf138"
FT                   /locus_tag="mCG_123156"
FT                   /product="ring finger protein 138, isoform CRA_b"
FT                   /note="gene_id=mCG123156.2 transcript_id=mCT174627.1
FT                   protein_id=mCP97546.1 isoform=CRA_b"
FT                   /protein_id="EDK96958.1"
FT                   /translation="MSEELSAATSYTEDDFYCPVCQEVLKTPVRTAACQHVFCRKCFLT
FT                   AMRESGIHCPLCRGSVTRRERACPERALDLENIMRRFSGSCRCCSKKIKFYRMRHHYKS
FT                   CKKYQDEYGVSSVIPNFKISQDSVRSSSSGHPTFKCPLCQESNFTRQRLLDHCNSNHLF
FT                   QIVPVNLQLDEETQYQTAVEESFQVNM"
FT   gap             4942854..4942873
FT                   /estimated_length=20
FT   gap             4944001..4944223
FT                   /estimated_length=223
FT   gap             4956289..4956377
FT                   /estimated_length=89
FT   gap             4965839..4966060
FT                   /estimated_length=222
FT   gene            4989448..>4998497
FT                   /locus_tag="mCG_1031762"
FT                   /note="gene_id=mCG1031762.1"
FT   mRNA            join(4989448..4989585,4994998..4995105,4998323..>4998497)
FT                   /locus_tag="mCG_1031762"
FT                   /product="mCG1031762"
FT                   /note="gene_id=mCG1031762.1 transcript_id=mCT149466.0
FT                   created on 18-DEC-2002"
FT   CDS             4998354..4998497
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031762"
FT                   /product="mCG1031762"
FT                   /note="gene_id=mCG1031762.1 transcript_id=mCT149466.0
FT                   protein_id=mCP69078.1"
FT                   /protein_id="EDK96961.1"
FT                   /translation="MNSTAGPASRSRHSFKCRMKLLKAPRDGMYMMTFGGKLNPSPQVV
FT                   FL"
FT   gene            4999913..5027754
FT                   /gene="Mep1b"
FT                   /locus_tag="mCG_123154"
FT                   /note="gene_id=mCG123154.1"
FT   mRNA            join(4999913..5000005,5002491..5002509,5003220..5003270,
FT                   5003916..5003956,5007999..5008077,5011648..5011765,
FT                   5013731..5013909,5016115..5016333,5016895..5017047,
FT                   5018640..5018855,5020787..5021230,5022490..5022669,
FT                   5023695..5023827,5024853..5025057,5027612..5027754)
FT                   /gene="Mep1b"
FT                   /locus_tag="mCG_123154"
FT                   /product="meprin 1 beta"
FT                   /note="gene_id=mCG123154.1 transcript_id=mCT124384.1
FT                   created on 15-OCT-2002"
FT   CDS             join(4999943..5000005,5002491..5002509,5003220..5003270,
FT                   5003916..5003956,5007999..5008077,5011648..5011765,
FT                   5013731..5013909,5016115..5016333,5016895..5017047,
FT                   5018640..5018855,5020787..5021230,5022490..5022669,
FT                   5023695..5023827,5024853..5025057,5027612..5027626)
FT                   /codon_start=1
FT                   /gene="Mep1b"
FT                   /locus_tag="mCG_123154"
FT                   /product="meprin 1 beta"
FT                   /note="gene_id=mCG123154.1 transcript_id=mCT124384.1
FT                   protein_id=mCP69389.1"
FT                   /db_xref="GOA:Q61847"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR000998"
FT                   /db_xref="InterPro:IPR001506"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR008294"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:96964"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61847"
FT                   /protein_id="EDK96962.1"
FT                   /translation="MDARHQPWFLVFATFLLVSGLPAPEKFVKDIDGGIDQDIFDINQG
FT                   LGLDLFEGDIKLEANGKNSIIGDHKRWPHTIPYVLEDSLEMNAKGVILNAFERYRLKTC
FT                   IDFKPWSGEANYISVFKGSGCWSSVGNIHAGKQELSIGTNCDRIATVQHEFLHALGFWH
FT                   EQSRADRDDYVIIVWDRIQPGKEHNFNIYNDSVSDSLNVPYDYTSVMHYSKTAFQNGTE
FT                   STIVTRISEFEDVIGQRMDFSDYDLLKLNQLYNCTSSLSFMDSCDFELENICGMIQSSG
FT                   DSADWQRVSQVLSGPESDHSKMGQCKDSGFFMHFNTSILNEGATAMLESRLLYPKRGFQ
FT                   CLEFYLYNSGSGNDQLNIYTREYTTGQQGGVLTLQRQIKEVPIGSWQLHYVTLQVTKKF
FT                   RVVFEGLRGPGTSSGGLSIDDINLSETRCPHHIWHIQNFTQILGGQDTSVYSPPFYSSK
FT                   GYAFQIYMDLRSSTNVGIYFHLISGANDDQLQWPCPWQQATMTLLDQNPDIRQRMFNQR
FT                   SITTDPTMTSDNGSYFWDRPSKVGVTDVFPNGTQFSRGIGYGTTVFITRERLKSREFIK
FT                   GDDIYILLTVEDISHLNSTSAVPDPVPTLAVHNACSEVVCQNGGICVVQDGRAECKCPA
FT                   GEDWWYMGKRCEKRGSTRDTVIIAVSSTVTVFAVMLIITLVSVYCTRRKYRKKARANTA
FT                   AMTLENQHAF"
FT   gene            complement(5004200..5004697)
FT                   /locus_tag="mCG_1031573"
FT                   /note="gene_id=mCG1031573.1"
FT   mRNA            complement(5004200..5004697)
FT                   /locus_tag="mCG_1031573"
FT                   /product="mCG1031573"
FT                   /note="gene_id=mCG1031573.1 transcript_id=mCT149277.1
FT                   created on 18-DEC-2002"
FT   CDS             complement(5004236..5004679)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031573"
FT                   /product="mCG1031573"
FT                   /note="gene_id=mCG1031573.1 transcript_id=mCT149277.1
FT                   protein_id=mCP69046.0"
FT                   /protein_id="EDK96963.1"
FT                   /translation="MPPRLGKTRKLRGHVNHGHGRISKNRKHPGGRGNAAGRHHHRVND
FT                   KYHPGYFGKVGMRHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVR
FT                   SGYYKVLGKGKLPKQPVIVKVKLFSRRAEEQIKGVGGACVLVA"
FT   gap             5050209..5050502
FT                   /estimated_length=294
FT   gene            complement(5056090..5228268)
FT                   /locus_tag="mCG_123161"
FT                   /note="gene_id=mCG123161.1"
FT   mRNA            complement(join(5056090..5057626,5058937..5059103,
FT                   5076033..5077205,5097048..5097178,5164248..5164388,
FT                   5227835..5228268))
FT                   /locus_tag="mCG_123161"
FT                   /product="mCG123161"
FT                   /note="gene_id=mCG123161.1 transcript_id=mCT124391.0
FT                   created on 30-MAY-2002"
FT   CDS             complement(join(5056729..5057626,5058937..5059103,
FT                   5076033..5077205,5097048..5097178,5164248..5164388,
FT                   5227835..5227955))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123161"
FT                   /product="mCG123161"
FT                   /note="gene_id=mCG123161.1 transcript_id=mCT124391.0
FT                   protein_id=mCP69164.1"
FT                   /db_xref="GOA:Q3UFT3"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR025946"
FT                   /db_xref="MGI:MGI:2685790"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3UFT3"
FT                   /protein_id="EDK96964.1"
FT                   /translation="MDPAPSLGCSLKDVKWSPVAMPLDLLVSTYRLPQIARLDSGECVE
FT                   GLRENDFLLIHSCRQWTTITAHSLEEGHYVIGPKIEIPVHYAGQFKLLEQDRDIKEPVQ
FT                   YFNSVEEVAKAFPERVYVMEEITFNVKVASGECNEDTEVYNITLCTGDELTLMGQAEIL
FT                   YAKTFKEKSRLNTIFKKIGKLNSISKLGKGKMPCLICMNHRTNESISLPFQCKGRFSTR
FT                   SPLELQMQEGEHTIRNIVEKTRLPVNVTVPSPPPRNPYDLHFIREGHRYKFVNIQTKTV
FT                   VVCCVLRNNKILPMHFPLHLTVPKFSLPEHQVKGDMWPETLVHHWLGICQEQFDIDEYS
FT                   RAVRDVKTDWNEDCKSPKKGRCSGHNHLPNSLSYARDELTQSFHRLSVCVYGNNLHGNS
FT                   EVNLHGCRDLGGEWAPFPHDILPYQDSGDSGSDYLFPEANEESAGIPGKTEVPYEELWL
FT                   EEGKPSRQPLTRSLSEKSRCDTLRGSTRSTCAPSSPPTPATLGATIKSSEIALPPPPVP
FT                   PKSEAVREECRLLNAPPVPPRSAKPLSTSPSIPPRTVKPVRPQTRSPSPTLSYYSSGLH
FT                   NIITQSDTSPPNSAPVSCYPCTRVKSDSVDPKSPFGSPSAEALSSRLSWPNHYSGASEN
FT                   QTRSDFLLDPSRSYSYPRQKTPGTPKRTCPAPFDFEGCELLGSPPSTTSAEFSSSGVPS
FT                   CPKSASYCLENSEDNSFAAGMTKQSVSCPALPPRAPKPVEQKATPETSPLPLKIDGAEE
FT                   DPTAGSLDLSEDQYFVRKGMQDIFSVSYPFSSPLHLQLAPRSCGDGSPWQPPADLSGLS
FT                   IEEVSKSLRFIGLSEDVIAFFVTEKIDGNLLVQLTEEILSEDFKLSKLQVKKILQFING
FT                   WRPKI"
FT   gap             5070448..5070467
FT                   /estimated_length=20
FT   gap             5106708..5106727
FT                   /estimated_length=20
FT   gap             5123153..5123172
FT                   /estimated_length=20
FT   gap             5124305..5124324
FT                   /estimated_length=20
FT   gap             5154451..5154607
FT                   /estimated_length=157
FT   gap             5162319..5162470
FT                   /estimated_length=152
FT   gap             5192722..5196427
FT                   /estimated_length=3706
FT   gap             5234874..5234893
FT                   /estimated_length=20
FT   gap             5240004..5240089
FT                   /estimated_length=86
FT   gap             5240723..5240861
FT                   /estimated_length=139
FT   gene            5245743..5246298
FT                   /pseudo
FT                   /locus_tag="mCG_1031764"
FT                   /note="gene_id=mCG1031764.1"
FT   mRNA            5245743..5246298
FT                   /pseudo
FT                   /locus_tag="mCG_1031764"
FT                   /note="gene_id=mCG1031764.1 transcript_id=mCT149468.1
FT                   created on 30-MAY-2002"
FT   gap             5253756..5253775
FT                   /estimated_length=20
FT   gene            complement(5259953..5260542)
FT                   /pseudo
FT                   /locus_tag="mCG_146370"
FT                   /note="gene_id=mCG146370.0"
FT   mRNA            complement(join(5259953..5260155,5260314..5260542))
FT                   /pseudo
FT                   /locus_tag="mCG_146370"
FT                   /note="gene_id=mCG146370.0 transcript_id=mCT186571.0
FT                   created on 16-JUL-2003"
FT   gap             5338222..5338342
FT                   /estimated_length=121
FT   gap             5340970..5340989
FT                   /estimated_length=20
FT   gap             5362597..5362902
FT                   /estimated_length=306
FT   gene            complement(5364754..5366249)
FT                   /locus_tag="mCG_123153"
FT                   /note="gene_id=mCG123153.1"
FT   mRNA            complement(join(5364754..5365162,5365478..5366249))
FT                   /locus_tag="mCG_123153"
FT                   /product="mCG123153"
FT                   /note="gene_id=mCG123153.1 transcript_id=mCT124383.1
FT                   created on 30-MAY-2002"
FT   CDS             complement(5365768..5366229)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123153"
FT                   /product="mCG123153"
FT                   /note="gene_id=mCG123153.1 transcript_id=mCT124383.1
FT                   protein_id=mCP69380.1"
FT                   /protein_id="EDK96965.1"
FT                   /translation="MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVV
FT                   MRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTV
FT                   KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFCYL"
FT   gap             5398538..5400475
FT                   /estimated_length=1938
FT   gene            complement(5423701..5425125)
FT                   /pseudo
FT                   /locus_tag="mCG_123162"
FT                   /note="gene_id=mCG123162.1"
FT   mRNA            complement(5423701..5425125)
FT                   /pseudo
FT                   /locus_tag="mCG_123162"
FT                   /note="gene_id=mCG123162.1 transcript_id=mCT124392.1
FT                   created on 30-MAY-2002"
FT   gap             5469983..5474065
FT                   /estimated_length=4083
FT   gene            complement(5481923..5586538)
FT                   /locus_tag="mCG_121003"
FT                   /note="gene_id=mCG121003.1"
FT   mRNA            complement(join(5481923..5484186,5486216..5486373,
FT                   5489406..5489564,5489645..5489835,5497086..5497164,
FT                   5504271..5504360,5556622..5556743,5583532..5584527,
FT                   5586510..5586538))
FT                   /locus_tag="mCG_121003"
FT                   /product="mCG121003"
FT                   /note="gene_id=mCG121003.1 transcript_id=mCT122197.1
FT                   created on 30-MAY-2002"
FT   CDS             complement(join(5484046..5484186,5486216..5486373,
FT                   5489406..5489564,5489645..5489835,5497086..5497164,
FT                   5504271..5504360,5556622..5556743,5583532..5584484))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121003"
FT                   /product="mCG121003"
FT                   /note="gene_id=mCG121003.1 transcript_id=mCT122197.1
FT                   protein_id=mCP69008.1"
FT                   /db_xref="GOA:Q69ZK5"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR011705"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR017096"
FT                   /db_xref="MGI:MGI:1921249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q69ZK5"
FT                   /protein_id="EDK96966.1"
FT                   /translation="MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFH
FT                   CHKAVLASCSQYFRSLFSSHPPLGGGVGGQDGLGAPKDQQQQQQPQQQPPQQQQPPPQE
FT                   EPGTPSSSPDDKLLTSPRAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVS
FT                   KILHIPQVTKLCVQFLNDQISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNFEE
FT                   MRALLDSLPPPVESELALFQMSVLWLEHDRETRMQYAPDLMKRLRFALIPAPELVERVQ
FT                   SVDFMRTDPVCQKLLLDAMNYHLMPFRQHCRQSLASRIRSNKKMLLLVGGLPPGPDRLP
FT                   SNLVQYYDDEKKTWKILTIMPYNSAHHCVVEVENFLFVLGGEDQWNPNGKHSTNFVSRY
FT                   DPRFNSWIQLPPMQERRASFYACRLDKHLYVIGGRNETGYLSSVECYNLDTNEWRYVSS
FT                   LPQPLAAHAGAVHNGKIYISGGVHNGEYVPWLYCYDPVMDVWARKQDMNTKRAIHTLAV
FT                   MNDRLYAIGGNHLKGFSHLDVMLVECYDPKGDQWNILQTPILEGRSGPGCAVLDDSIYL
FT                   VGGYSWSMGAYKSSTICYCPEKGTWTELEGDVAEPLAGPACATVILPACVPYNK"
FT   gap             5486089..5486194
FT                   /estimated_length=106
FT   gap             5492654..5492719
FT                   /estimated_length=66
FT   gap             5522340..5522359
FT                   /estimated_length=20
FT   gap             5532204..5532223
FT                   /estimated_length=20
FT   gap             5544563..5544582
FT                   /estimated_length=20
FT   gap             5552233..5552534
FT                   /estimated_length=302
FT   gap             5560861..5560929
FT                   /estimated_length=69
FT   gap             5566002..5566021
FT                   /estimated_length=20
FT   gap             5575324..5575466
FT                   /estimated_length=143
FT   gene            <5583679..5588259
FT                   /locus_tag="mCG_145818"
FT                   /note="gene_id=mCG145818.0"
FT   mRNA            join(<5583679..5583854,5584822..5584977,5585964..5586168,
FT                   5587177..5588259)
FT                   /locus_tag="mCG_145818"
FT                   /product="mCG145818"
FT                   /note="gene_id=mCG145818.0 transcript_id=mCT185926.0
FT                   created on 03-JUL-2003"
FT   CDS             join(<5583833..5583854,5584822..5584977,5585964..5586168,
FT                   5587177..5587201)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145818"
FT                   /product="mCG145818"
FT                   /note="gene_id=mCG145818.0 transcript_id=mCT185926.0
FT                   protein_id=mCP107339.0"
FT                   /protein_id="EDK96967.1"
FT                   /translation="ATAHLPPATAVIAAAAKVEAEAVTPRGLESMPGWMNGKAGSGESG
FT                   GASRAQRRPTAAVPGLNRKGPSCPCPARAPAGTTAAAARLRGTRRTCPFRCGSLCLARR
FT                   GFWIAGFIPTRLGSSPLTFPSCSRLATSLLS"
FT   gap             5585794..5585813
FT                   /estimated_length=20
FT   gap             5630609..5630628
FT                   /estimated_length=20
FT   gap             5669388..5669963
FT                   /estimated_length=576
FT   gap             5689213..5690177
FT                   /estimated_length=965
FT   gap             5690951..5691592
FT                   /estimated_length=642
FT   gap             5694462..5694547
FT                   /estimated_length=86
FT   gap             5695935..5695985
FT                   /estimated_length=51
FT   gap             5701240..5701259
FT                   /estimated_length=20
FT   gap             5718930..5718949
FT                   /estimated_length=20
FT   gap             5724710..5724729
FT                   /estimated_length=20
FT   gap             5743919..5743943
FT                   /estimated_length=25
FT   gap             5756938..5757104
FT                   /estimated_length=167
FT   gap             5770113..5770220
FT                   /estimated_length=108
FT   gap             5779310..5779329
FT                   /estimated_length=20
FT   gap             5834760..5834779
FT                   /estimated_length=20
FT   gap             5899105..5899213
FT                   /estimated_length=109
FT   gap             5951077..5951096
FT                   /estimated_length=20
FT   gene            complement(<5952679..6103175)
FT                   /gene="4921528I01Rik"
FT                   /locus_tag="mCG_121002"
FT                   /note="gene_id=mCG121002.1"
FT   mRNA            complement(join(<5952679..5952731,5954793..5954954,
FT                   5956543..5956605,5965347..5965530,5999161..5999297,
FT                   5999451..5999546,6029366..6029519,6037265..6037407,
FT                   6041404..6041624,6052279..6052479,6061831..6061910,
FT                   6063149..6063171,6066812..6066951,6077184..6077273,
FT                   6078674..6078733,6082141..6082224,6086226..6086348,
FT                   6098184..6098266,6103106..6103175))
FT                   /gene="4921528I01Rik"
FT                   /locus_tag="mCG_121002"
FT                   /product="RIKEN cDNA 4921528I01"
FT                   /note="gene_id=mCG121002.1 transcript_id=mCT122196.1
FT                   created on 30-MAY-2002"
FT   CDS             complement(join(<5952679..5952731,5954793..5954954,
FT                   5956543..5956605,5965347..5965530,5999161..5999297,
FT                   5999451..5999546,6029366..6029519,6037265..6037407,
FT                   6041404..6041624,6052279..6052479,6061831..6061910,
FT                   6063149..6063171,6066812..6066951,6077184..6077273,
FT                   6078674..6078733,6082141..6082201))
FT                   /codon_start=1
FT                   /gene="4921528I01Rik"
FT                   /locus_tag="mCG_121002"
FT                   /product="RIKEN cDNA 4921528I01"
FT                   /note="gene_id=mCG121002.1 transcript_id=mCT122196.1
FT                   protein_id=mCP68999.1"
FT                   /protein_id="EDK96968.1"
FT                   /translation="MPENEKEPAQPTTNEDALDTGKTCLQIKELKDKERALMLAENARM
FT                   QGLSEFFFSRHEDKRLYESKSTNTEDVNKAIYFSYPSRRHSCTLVNIPKPCVNKMISHI
FT                   EDVESKIQEHLTQFEASFEEWTSVTKDKEAGLDVSAPEKQVHPEKGKDEKCPELKKRME
FT                   TLLSEAIHLIKSLETDRAEAEQALKQHKSRKKKISMKIDSWSIWKLQELPLAVQKEHEN
FT                   FSKINAELRSYLEDIALKVEQLQERKEKLEKANAKLQVDIDYMASHSVLLEKKRKQELG
FT                   CLKERYHKKFEVMEKFRAIHEELKESVDKCEGAKARLKNMKVENEREIQEELINATSYE
FT                   KELDKLSVLDAHYTTSIETVNLDIEGDEEAMNEVLRETQSTTNELENLKKTVDDLKRLF
FT                   DQYCWRQRKYENEYLEAFSNFYSLKKTWDIELSNVSKDAKDLTIVYEAQSEENKRIQSE
FT                   IQSITDDIEESIKKTAEMEEEVHTFVEMKMKNNNYLKQLYKQAYQVGAVYHLSRHKTEE
FT                   LEDKLADLKRIFKGREELLKKLTRGDIATGIEIQKRLYAIEETQFIEMQEFIRRQVLYN
FT                   MALLEVEEQLKELEAEAVRIRYLHRQHSKMLHNIRKRKERVKKNVDA"
FT   gap             5990789..5990868
FT                   /estimated_length=80
FT   gap             6025657..6025840
FT                   /estimated_length=184
FT   gap             6047778..6047797
FT                   /estimated_length=20
FT   gap             6119749..6119950
FT                   /estimated_length=202
FT   gap             6148511..6148530
FT                   /estimated_length=20
FT   gap             6168940..6169053
FT                   /estimated_length=114
FT   gap             6223159..6223178
FT                   /estimated_length=20
FT   gap             6230374..6230393
FT                   /estimated_length=20
FT   gap             6233903..6234198
FT                   /estimated_length=296
FT   gene            6251252..6252104
FT                   /pseudo
FT                   /locus_tag="mCG_1031600"
FT                   /note="gene_id=mCG1031600.1"
FT   mRNA            6251252..6252104
FT                   /pseudo
FT                   /locus_tag="mCG_1031600"
FT                   /note="gene_id=mCG1031600.1 transcript_id=mCT149304.1
FT                   created on 30-MAY-2002"
FT   gap             6261038..6261057
FT                   /estimated_length=20
FT   gene            complement(6268229..6270220)
FT                   /locus_tag="mCG_146821"
FT                   /note="gene_id=mCG146821.0"
FT   mRNA            complement(join(6268229..6268295,6268380..6270220))
FT                   /locus_tag="mCG_146821"
FT                   /product="mCG146821"
FT                   /note="gene_id=mCG146821.0 transcript_id=mCT187084.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(6269451..6269666)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146821"
FT                   /product="mCG146821"
FT                   /note="gene_id=mCG146821.0 transcript_id=mCT187084.0
FT                   protein_id=mCP108177.0"
FT                   /protein_id="EDK96969.1"
FT                   /translation="MQKAQVQSDESDNFIFSYNYHSKEHIKHFYQPELSSCCHNLDCAG
FT                   RNTFRLILTCCKLLIFSCQSRVCMCL"
FT   gap             6275869..6276992
FT                   /estimated_length=1124
FT   gene            6276993..>6450806
FT                   /locus_tag="mCG_142752"
FT                   /note="gene_id=mCG142752.0"
FT   mRNA            join(6276993..6277028,6307188..6307762)
FT                   /locus_tag="mCG_142752"
FT                   /product="mCG142752, transcript variant mCT182068"
FT                   /note="gene_id=mCG142752.0 transcript_id=mCT182068.0
FT                   created on 25-APR-2003"
FT   mRNA            join(6277140..6277214,6307188..6307270,6324713..6324925,
FT                   6342026..6342134,6343606..6343714,6366777..6366898,
FT                   6377645..6377762,6378886..6379005,6390681..6390844,
FT                   6434364..6434460,6437305..6437410,6441095..6443048,
FT                   6447024..6449775,6450199..>6450806)
FT                   /locus_tag="mCG_142752"
FT                   /product="mCG142752, transcript variant mCT182069"
FT                   /note="gene_id=mCG142752.0 transcript_id=mCT182069.0
FT                   created on 25-APR-2003"
FT   gap             6279797..6279816
FT                   /estimated_length=20
FT   CDS             6307215..6307445
FT                   /codon_start=1
FT                   /locus_tag="mCG_142752"
FT                   /product="mCG142752, isoform CRA_a"
FT                   /note="gene_id=mCG142752.0 transcript_id=mCT182068.0
FT                   protein_id=mCP104991.0 isoform=CRA_a"
FT                   /protein_id="EDK96970.1"
FT                   /translation="MTAKQILEVIQKEGLKETRLVAIFKSSFCVLALVTSPSGARSISI
FT                   VNTIVDGELTTPKFSDACKTLCDLSFLLSCC"
FT   CDS             join(6324849..6324925,6342026..6342134,6343606..6343714,
FT                   6366777..6366898,6377645..6377762,6378886..6379005,
FT                   6390681..6390844,6434364..6434460,6437305..6437410,
FT                   6441095..6443048,6447024..6449775,6450199..6450806)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142752"
FT                   /product="mCG142752, isoform CRA_b"
FT                   /note="gene_id=mCG142752.0 transcript_id=mCT182069.0
FT                   protein_id=mCP104990.0 isoform=CRA_b"
FT                   /protein_id="EDK96971.1"
FT                   /translation="MLNRMLELAGVAGIAVEWFRSFLPGSGTSPLACLNAMLHTNTRVG
FT                   DGTFFKIPGKSGLYALRKEESSCPVDGTLDLVVDPDLDGAEMAEASANGEENRVCTKQV
FT                   TDEVSSTRDCSLTNTAVQSKLVSSFQQHTKKALKQALRQQQKRRNGVSMMVNKTVPRVV
FT                   LTPLKVSDEQSDSPSGSESKNGEADSSDKEMKHGQKSPTGKQTSQHLKRLKKSGLGHLK
FT                   WTKAEDIDIETPGSILVNTNLRALINKHTFASFPQHFQQYLLLLLPEVDRQMGSDGILR
FT                   LSTSALNNEFFAYAAQGWKQRLAEGEFTPEMQLRIRQEIEKEKKTEPWKEKFFERFYGE
FT                   RSGMSREESIKLTSGPNHEGAEGSSSHGDSGIPGPSAQNALEEQQPKILKSSASLEPDF
FT                   CTTVCPMLEVPVKDVMTESETEDIFIPEESVIQEEVAEEVETSIYECQDEHLKTIPAFS
FT                   EESESPATPCEEPQVAAPEDSLESCVVMNDILHTLPHIEVKIVEKLECPQEEMSVVIDQ
FT                   LEICDSLLPCPSSVTHILDVEQKEQETTIETSAMALREGPSSLESQLPNEGIAVDMELQ
FT                   SDPEEQLSENACISETSFSSESPEGACASLPSPGGETQSTSEESCTPASLETTFCSEVS
FT                   STENTDKYNQRNPTGESLHASLVSEVSPLATSPEISEASLMSNLPLTSEASPVSNLPLT
FT                   SEASPMSDLPPTSETSSESSMPLTSETPFVSSLPIPAETSPISNSSVNERMVHQQRKSP
FT                   SGSEEANSPQKEEPSIPTKPLGESLVSHPKPLSTIPEPINMSSAMVPEALPPEGLHSQT
FT                   LSQEPCNAHVEMEKLYASSIPELPSSEMTKVKNHSVLQRPEKKGLSAPLEVPVFSEETE
FT                   TKGIELPPAKLQDKQYAPSVDKATFLEGSRNKIHKQSSTLNRLETSHTSKVSEPSKSPD
FT                   GIRNDNRESEISKRKTVEHSFGICKEKRARIEDDQSARSLASSSPPEKEQPPREEPRVP
FT                   PLKIQLSKIGPPFIIKSQPVSKAESRASTSTSVSSGRNTGARTLADIKARAQQARAQRE
FT                   AAAAAAVAAAASIVSGAMGSPGEGGKARTLAHIKEQTKAKLFAKHQSRAHLFQTSKETR
FT                   LPSVSTKEDSLNMEASPTPETKMEGSTGVIIINPNCRSPSSKPTHIREITTVLQQPLNP
FT                   PQIPETATDLSVHSSDDNIPVSHLTEKIVSSTSSENSSVPILHNKSPINPIPMSVCSTA
FT                   MSGAIKEHPFVSPVDKSSVLMSVDSANSTISACNISMLKSIQGSDAPCIALVPKCINRT
FT                   PIPAAPEGTGQSNSMDGKALLVPSSKAANVISNQYTSVPAPTIASNLPNHLCTSSVLIP
FT                   PTGINNRFVSEKIAMPGSEEQAAVSIGATMRTALSCGDSVAVTDSLVPRSPIAMFAGNM
FT                   LTANSYNCPPKLSGENLDNNSGPLNRTDNSEKPQQPAGGFVPATINRSIPCKVIVDHST
FT                   TLTSNLSLTVSIESGDSSLDSQTRSVRTDVSIQPVACPQVSVISRPEQATSEGLDHGSV
FT                   FIAAPTAKQDCKTLQATCTSLRELPLTLPDKLNEVTVPTHGFAEQARNSSTFKKEPDTA
FT                   CSNQYNPGNRICWSEDPMRNTAPPVVSHSSSSKQKEHPEQTGLKAVKTEHVSYAHVSDL
FT                   HPRNLITNVSLPVKPEPHEVDKGFRMDTEDFPGPERPPPVTEVTSSASVQPTQTMKPST
FT                   TSPVEEAISLAPDTLKRIPSASSSSCRLSSVEANNPLVTQLLQGNLPLEKVLPQPRLGA
FT                   KLEINRLPLPLQTTSVGKTGLERNMVEMPSSSPNPDGKGYLAGTLAPVQMRKRENHPKK
FT                   RAARTVGDHAQVKCEPGKMVMEPDVKAVPCVISPSMSQLGHNQPFKQERLNKPSMANRI
FT                   MPSPEVKQQKRLLPACSFQPSLFHVNKNEGFHADTEVPSDQKQPPVNMETTKRLSWPQS
FT                   TGICSNIKSEPLSFEESLSSSCELGMKQVPYDQNEVKEQLKAFALKNADFSSYLLSEPQ
FT                   KPFTQLAAQKLPVPQQQPLCGSYPTIHFGSTNFKRAASAIEKSIGILGSGSNPATSTGL
FT                   TGQNTQMPVQNFADNSNADELELKCSCRLKAMIVCKGCGAFCHDDCIGPSKLCVACLVV
FT                   R"
FT   gap             6331130..6331149
FT                   /estimated_length=20
FT   gap             6351940..6353366
FT                   /estimated_length=1427
FT   gap             6373056..6373075
FT                   /estimated_length=20
FT   gap             6375326..6375927
FT                   /estimated_length=602
FT   gap             6421601..6421620
FT                   /estimated_length=20
FT   gap             6450114..6450168
FT                   /estimated_length=55
FT   gap             6479277..6479519
FT                   /estimated_length=243
FT   gap             6481185..6483651
FT                   /estimated_length=2467
FT   gap             6485436..6486839
FT                   /estimated_length=1404
FT   gap             6497645..6497694
FT                   /estimated_length=50
FT   gap             6538968..6540937
FT                   /estimated_length=1970
FT   gap             6542112..6542131
FT                   /estimated_length=20
FT   gap             6552320..6554026
FT                   /estimated_length=1707
FT   gap             6579944..6580017
FT                   /estimated_length=74
FT   gene            complement(6608098..6968097)
FT                   /gene="Nol4"
FT                   /locus_tag="mCG_113049"
FT                   /note="gene_id=mCG113049.2"
FT   mRNA            complement(join(6608098..6610052,6634027..6634204,
FT                   6667107..6667220,6685848..6686027,6750461..6750744,
FT                   6840150..6840282,6848415..6848527,6849446..6849557,
FT                   6879571..6879720,6966216..6968097))
FT                   /gene="Nol4"
FT                   /locus_tag="mCG_113049"
FT                   /product="nucleolar protein 4, transcript variant
FT                   mCT149278"
FT                   /note="gene_id=mCG113049.2 transcript_id=mCT149278.2
FT                   created on 13-JUN-2003"
FT   mRNA            complement(join(6608098..6610052,6634027..6634204,
FT                   6667107..6667220,6684912..6685103,6685848..6686027,
FT                   6750461..6750744,6778312..6778429))
FT                   /gene="Nol4"
FT                   /locus_tag="mCG_113049"
FT                   /product="nucleolar protein 4, transcript variant
FT                   mCT114126"
FT                   /note="gene_id=mCG113049.2 transcript_id=mCT114126.2
FT                   created on 13-JUN-2003"
FT   mRNA            complement(join(6608333..6610052,6634027..6634204,
FT                   6667107..6667220,6684912..6685103,6685848..6686027,
FT                   6750461..6750744,6840150..6840282,6848415..6848527,
FT                   6849446..6849557,6879571..6879720,6964995..>6965093))
FT                   /gene="Nol4"
FT                   /locus_tag="mCG_113049"
FT                   /product="nucleolar protein 4, transcript variant
FT                   mCT188842"
FT                   /note="gene_id=mCG113049.2 transcript_id=mCT188842.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(6608552..6610052,6634118..6634204,
FT                   6667107..6667220,6685848..6686027,6750461..6750744,
FT                   6840150..6840282,6848415..6848527,6849446..6849557,
FT                   6879571..6879720,6966216..>6968091))
FT                   /gene="Nol4"
FT                   /locus_tag="mCG_113049"
FT                   /product="nucleolar protein 4, transcript variant
FT                   mCT188843"
FT                   /note="gene_id=mCG113049.2 transcript_id=mCT188843.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(6609859..6610052,6634027..6634204,
FT                   6667107..6667220,6685848..6686027,6750461..6750744,
FT                   6840150..6840282,6848415..6848527,6849446..6849557,
FT                   6879571..6879720,6966216..6966479))
FT                   /codon_start=1
FT                   /gene="Nol4"
FT                   /locus_tag="mCG_113049"
FT                   /product="nucleolar protein 4, isoform CRA_d"
FT                   /note="gene_id=mCG113049.2 transcript_id=mCT149278.2
FT                   protein_id=mCP69054.2 isoform=CRA_d"
FT                   /db_xref="GOA:G3UW35"
FT                   /db_xref="InterPro:IPR026747"
FT                   /db_xref="MGI:MGI:2441684"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW35"
FT                   /protein_id="EDK96975.1"
FT                   /translation="MESERDMYRQFQDWCLRTYGDSGKTKTVTRKKYERIVQLLNGSES
FT                   SSTDNAKFKFWVKSKGFQLGQPDEVRGGGGGAKQVLFVRVKTTDGVGVDEKLSLRRVAV
FT                   VEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFLMSCSECQK
FT                   RMHLNPDGTDHKDNGKPPTLVTSMIDYNMPITMAYMKHMKLQLLNSQQDEDESSIESDE
FT                   FDMSDSTRMSAVNSDLSSNLEERMQSPQTVHGQQDDDSAAESSNGNETLGHSSAASGGA
FT                   HGREPEDSSSDGKTGLEQEEQPLNLSDSPSSAQLTSEFRIDDQGSDGKNKYKNLLISDL
FT                   KMEREARENGSKSPAHSYSSYDSGKNESVDRGAEDLSLNRGDEDEDEHDEHEDSEKVNE
FT                   TDGVEAERLKAFNSRPIPSHLTSAVAESILASACESESRNAAKRMRLDKAQDEAAPADK
FT                   QCKPEAAQATYSTATVPGSQEVLYINGNGTYSYHSYRGLGGLLSLDDTSSSGPTDLSMK
FT                   RQLATGSGSSSSSTSRPQLSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQN"
FT   CDS             complement(join(6609859..6610052,6634027..6634204,
FT                   6667107..6667220,6684912..6685103,6685848..6686027,
FT                   6750461..6750744,6840150..6840282,6848415..6848527,
FT                   6849446..6849557,6879571..6879720,6964995..>6965051))
FT                   /codon_start=1
FT                   /gene="Nol4"
FT                   /locus_tag="mCG_113049"
FT                   /product="nucleolar protein 4, isoform CRA_a"
FT                   /note="gene_id=mCG113049.2 transcript_id=mCT188842.0
FT                   protein_id=mCP109821.0 isoform=CRA_a"
FT                   /protein_id="EDK96972.1"
FT                   /translation="YWRYMHERLFQAPSGGLSQDGVGVDEKLSLRRVAVVEDFFDIIYS
FT                   MHVETGPNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFLMSCSECQKRMHLNPDGTD
FT                   HKDNGKPPTLVTSMIDYNMPITMAYMKHMKLQLLNSQQDEDESSIESDEFDMSDSTRMS
FT                   AVNSDLSSNLEERMQSPQTVHGQQDDDSAAESSNGNETLGHSSAASGGAHGREPEDSSS
FT                   DGKTGLEQEEQPLNLSDSPSSAQLTSEFRIDDQGSDGKNKYKNLLISDLKMEREARENG
FT                   SKSPAHSYSSYDSGKNESVDRGAEDLSLNRGDEDEDEHDEHEDSEKVNETDGVEAERLK
FT                   AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERARKRIRTYLKSCRR
FT                   MKRSGFEMSRPIPSHLTSAVAESILASACESESRNAAKRMRLDKAQDEAAPADKQCKPE
FT                   AAQATYSTATVPGSQEVLYINGNGTYSYHSYRGLGGLLSLDDTSSSGPTDLSMKRQLAT
FT                   GSGSSSSSTSRPQLSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQN"
FT   CDS             complement(join(6609859..6610052,6634027..6634204,
FT                   6667107..6667220,6684912..6685103,6685848..6686027,
FT                   6750461..6750493))
FT                   /codon_start=1
FT                   /gene="Nol4"
FT                   /locus_tag="mCG_113049"
FT                   /product="nucleolar protein 4, isoform CRA_c"
FT                   /note="gene_id=mCG113049.2 transcript_id=mCT114126.2
FT                   protein_id=mCP69244.2 isoform=CRA_c"
FT                   /protein_id="EDK96974.1"
FT                   /translation="MEREARENGSKSPAHSYSSYDSGKNESVDRGAEDLSLNRGDEDED
FT                   EHDEHEDSEKVNETDGVEAERLKAFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCR
FT                   RQFPEYQERARKRIRTYLKSCRRMKRSGFEMSRPIPSHLTSAVAESILASACESESRNA
FT                   AKRMRLDKAQDEAAPADKQCKPEAAQATYSTATVPGSQEVLYINGNGTYSYHSYRGLGG
FT                   LLSLDDTSSSGPTDLSMKRQLATGSGSSSSSTSRPQLSPTEINAVRQLVAGYRESAAFL
FT                   LRSADELENLILQQN"
FT   CDS             complement(join(6610038..6610052,6634118..6634204,
FT                   6667107..6667220,6685848..6686027,6750461..6750744,
FT                   6840150..6840282,6848415..6848527,6849446..6849557,
FT                   6879571..6879720,6966216..>6966539))
FT                   /codon_start=1
FT                   /gene="Nol4"
FT                   /locus_tag="mCG_113049"
FT                   /product="nucleolar protein 4, isoform CRA_b"
FT                   /note="gene_id=mCG113049.2 transcript_id=mCT188843.0
FT                   protein_id=mCP109822.0 isoform=CRA_b"
FT                   /protein_id="EDK96973.1"
FT                   /translation="DQGEQVRSALGASGPRQRGNMESERDMYRQFQDWCLRTYGDSGKT
FT                   KTVTRKKYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLGQPDEVRGGGGGAKQVLFVR
FT                   VKTTDGVGVDEKLSLRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAISESY
FT                   AFLPREAVTRFLMSCSECQKRMHLNPDGTDHKDNGKPPTLVTSMIDYNMPITMAYMKHM
FT                   KLQLLNSQQDEDESSIESDEFDMSDSTRMSAVNSDLSSNLEERMQSPQTVHGQQDDDSA
FT                   AESSNGNETLGHSSAASGGAHGREPEDSSSDGKTGLEQEEQPLNLSDSPSSAQLTSEFR
FT                   IDDQGSDGKNKYKNLLISDLKMEREARENGSKSPAHSYSSYDSGKNESVDRGAEDLSLN
FT                   RGDEDEDEHDEHEDSEKVNETDGVEAERLKAFNSRPIPSHLTSAVAESILASACESESR
FT                   NAAKRMRLDKAQDEAAPADKQCKPEAAQATYSTATVPGSQEDPQI"
FT   gap             6632076..6632291
FT                   /estimated_length=216
FT   gap             6632751..6632910
FT                   /estimated_length=160
FT   gap             6640919..6641350
FT                   /estimated_length=432
FT   gap             6654562..6654581
FT                   /estimated_length=20
FT   gap             6662568..6662587
FT                   /estimated_length=20
FT   gap             6703860..6703897
FT                   /estimated_length=38
FT   gap             6725295..6725314
FT                   /estimated_length=20
FT   gap             6730563..6730582
FT                   /estimated_length=20
FT   gap             6733756..6737124
FT                   /estimated_length=3369
FT   gap             6759846..6760338
FT                   /estimated_length=493
FT   gap             6761554..6761995
FT                   /estimated_length=442
FT   gap             6807041..6811759
FT                   /estimated_length=4719
FT   gap             6819249..6819268
FT                   /estimated_length=20
FT   gap             6844476..6844495
FT                   /estimated_length=20
FT   gap             6868839..6868897
FT                   /estimated_length=59
FT   gap             6876362..6876393
FT                   /estimated_length=32
FT   gap             6890565..6894467
FT                   /estimated_length=3903
FT   gap             6905468..6905622
FT                   /estimated_length=155
FT   gap             6914860..6914879
FT                   /estimated_length=20
FT   gap             6918401..6918680
FT                   /estimated_length=280
FT   gap             6939771..6939790
FT                   /estimated_length=20
FT   gap             6968120..6968139
FT                   /estimated_length=20
FT   gap             6997423..6997442
FT                   /estimated_length=20
FT   gap             6999993..7000012
FT                   /estimated_length=20
FT   gap             7001173..7001192
FT                   /estimated_length=20
FT   gap             7011098..7011159
FT                   /estimated_length=62
FT   gap             7030863..7030956
FT                   /estimated_length=94
FT   gap             7035636..7035655
FT                   /estimated_length=20
FT   gap             7045147..7045558
FT                   /estimated_length=412
FT   gap             7136583..7139898
FT                   /estimated_length=3316
FT   gene            7145022..7145991
FT                   /pseudo
FT                   /locus_tag="mCG_113048"
FT                   /note="gene_id=mCG113048.1"
FT   mRNA            7145022..7145991
FT                   /pseudo
FT                   /locus_tag="mCG_113048"
FT                   /note="gene_id=mCG113048.1 transcript_id=mCT114125.1
FT                   created on 30-MAY-2002"
FT   gap             7203283..7203302
FT                   /estimated_length=20
FT   gap             7222574..7222726
FT                   /estimated_length=153
FT   gap             7238578..7238718
FT                   /estimated_length=141
FT   gap             7241561..7241580
FT                   /estimated_length=20
FT   gap             7242867..7243071
FT                   /estimated_length=205
FT   gap             7282154..7282203
FT                   /estimated_length=50
FT   gap             7283695..7283728
FT                   /estimated_length=34
FT   gap             7286424..7286507
FT                   /estimated_length=84
FT   gap             7293336..7293787
FT                   /estimated_length=452
FT   gap             7310964..7311030
FT                   /estimated_length=67
FT   gap             7315486..7315505
FT                   /estimated_length=20
FT   gap             7336001..7336020
FT                   /estimated_length=20
FT   gene            <7344156..7585048
FT                   /gene="Dtna"
FT                   /locus_tag="mCG_140483"
FT                   /note="gene_id=mCG140483.1"
FT   mRNA            join(<7344156..7344339,7403796..7403922,7463693..7463760,
FT                   7474217..7474297,7498031..7498244,7511602..7511687,
FT                   7518718..7518872,7521503..7521608,7523976..7524142,
FT                   7525950..7526074,7531102..7531185,7549903..7549990,
FT                   7550483..7550580,7553578..7553691,7559822..7559918,
FT                   7571599..7571758,7574649..7574738,7575340..7575505,
FT                   7579966..7580098,7581779..7581827,7584263..7585048)
FT                   /gene="Dtna"
FT                   /locus_tag="mCG_140483"
FT                   /product="dystrobrevin alpha, transcript variant mCT188860"
FT                   /note="gene_id=mCG140483.1 transcript_id=mCT188860.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(7344156..7344339,7403796..7403922,7463693..7463760,
FT                   7474217..7474297,7498031..7498244,7511602..7511687,
FT                   7518718..7518872,7521503..7521608,7523976..7524142,
FT                   7525950..7526074,7531102..7531185,7538979..7539056,
FT                   7539579..7539671,7549903..7549990,7550483..7550580,
FT                   7553578..7553691,7559822..7559918,7561695..7561715,
FT                   7571599..7571758,7574649..7574738,7575340..7575505,
FT                   7579966..7580098,7581779..7581827,7584263..7584651)
FT                   /gene="Dtna"
FT                   /locus_tag="mCG_140483"
FT                   /product="dystrobrevin alpha, transcript variant mCT169730"
FT                   /note="gene_id=mCG140483.1 transcript_id=mCT169730.0
FT                   created on 30-MAY-2002"
FT   mRNA            join(<7344186..7344339,7403796..7403922,7463693..7463760,
FT                   7474217..7474297,7498031..7498244,7511602..7511687,
FT                   7518718..7518872,7521503..7521608,7523976..7524142,
FT                   7525950..7526074,7531102..7531185,7538979..7539056,
FT                   7539579..7539671,7549903..7549990,7550483..7550580,
FT                   7553578..7553691,7559822..7559918,7561695..7562903)
FT                   /gene="Dtna"
FT                   /locus_tag="mCG_140483"
FT                   /product="dystrobrevin alpha, transcript variant mCT188862"
FT                   /note="gene_id=mCG140483.1 transcript_id=mCT188862.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(7344278..7344339,7403796..7403922,7463693..7463760,
FT                   7474217..7474297,7498031..7498244,7511602..7511687,
FT                   7518718..7518872,7521503..7521608,7523976..7524142,
FT                   7525950..7526074,7531102..7531185,7549903..7549990,
FT                   7550483..7550580,7553578..7553691,7559822..7559918,
FT                   7561695..7561715,7571599..7571758,7574649..7574738,
FT                   7575340..7575505,7579966..7580098,7581779..7581827,
FT                   7584263..7584651)
FT                   /gene="Dtna"
FT                   /locus_tag="mCG_140483"
FT                   /product="dystrobrevin alpha, transcript variant mCT169729"
FT                   /note="gene_id=mCG140483.1 transcript_id=mCT169729.0
FT                   created on 30-MAY-2002"
FT   mRNA            join(<7344278..7344339,7403796..7403922,7463693..7463760,
FT                   7474217..7474297,7498031..7498244,7511602..7511687,
FT                   7518718..7518872,7521503..7521608,7523976..7524142,
FT                   7525950..7526074,7531102..7531185,7538979..7539056,
FT                   7539579..7539671,7549903..7549990,7550483..7550580,
FT                   7553578..7553691,7559822..7559918,7561695..7561715,
FT                   7564137..7564241)
FT                   /gene="Dtna"
FT                   /locus_tag="mCG_140483"
FT                   /product="dystrobrevin alpha, transcript variant mCT188861"
FT                   /note="gene_id=mCG140483.1 transcript_id=mCT188861.0
FT                   created on 08-MAR-2004"
FT   gap             7370653..7374887
FT                   /estimated_length=4235
FT   gap             7381854..7382005
FT                   /estimated_length=152
FT   gap             7384663..7384682
FT                   /estimated_length=20
FT   gap             7402780..7402863
FT                   /estimated_length=84
FT   CDS             join(<7403831..7403922,7463693..7463760,7474217..7474297,
FT                   7498031..7498244,7511602..7511687,7518718..7518872,
FT                   7521503..7521608,7523976..7524142,7525950..7526074,
FT                   7531102..7531185,7549903..7549990,7550483..7550580,
FT                   7553578..7553691,7559822..7559918,7571599..7571758,
FT                   7574649..7574738,7575340..7575505,7579966..7580098,
FT                   7581779..7581796)
FT                   /codon_start=1
FT                   /gene="Dtna"
FT                   /locus_tag="mCG_140483"
FT                   /product="dystrobrevin alpha, isoform CRA_b"
FT                   /note="gene_id=mCG140483.1 transcript_id=mCT188860.0
FT                   protein_id=mCP109861.0 isoform=CRA_b"
FT                   /protein_id="EDK96977.1"
FT                   /translation="EVFKCHSQLLFQRKQNRWFWKVHAVSSLNFRMIEDSGKRGNTMAE
FT                   RRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPN
FT                   IELNVARLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFDPEGHGKISVFAV
FT                   KMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTE
FT                   QSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSES
FT                   MMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLTNALSKSLSC
FT                   ASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFITRSMLESSN
FT                   RLDEEHRLIARYAARLAAESSSSQPTQQRSAPDISFTIDANKQQRQLIAELENKNREIL
FT                   QEIQRLRVEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQL
FT                   EGLMKLLKTQGASSPRSSPSHTISRPIPMPIRSASACPTPTHTPQDSLTGVGGDVQEAF
FT                   AQSSRRNLRSDLLVAADSITNTMSSLVKELNSEVASETESTVDSEFSRPQFEDLAPSPT
FT                   SEKAFLAQIHSRKPGYIHGGAASTTHGDMVPEDGDPYTQPEDGNYENESVRQLENELQL
FT                   EEYLKQKLQDEAYQVSLQG"
FT   CDS             join(<7403831..7403922,7463693..7463760,7474217..7474297,
FT                   7498031..7498244,7511602..7511687,7518718..7518872,
FT                   7521503..7521608,7523976..7524142,7525950..7526074,
FT                   7531102..7531185,7538979..7539056,7539579..7539671,
FT                   7549903..7549990,7550483..7550580,7553578..7553691,
FT                   7559822..7559918,7561695..7561715,7564137..7564175)
FT                   /codon_start=1
FT                   /gene="Dtna"
FT                   /locus_tag="mCG_140483"
FT                   /product="dystrobrevin alpha, isoform CRA_c"
FT                   /note="gene_id=mCG140483.1 transcript_id=mCT188861.0
FT                   protein_id=mCP109862.0 isoform=CRA_c"
FT                   /protein_id="EDK96978.1"
FT                   /translation="EVFKCHSQLLFQRKQNRWFWKVHAVSSLNFRMIEDSGKRGNTMAE
FT                   RRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPN
FT                   IELNVARLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFDPEGHGKISVFAV
FT                   KMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTE
FT                   QSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSES
FT                   MMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLTNALSKSLSC
FT                   ASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFITRSSPPKDS
FT                   EVEQNKMLARAAPAFLKGRGIQYSLNVADRLADEHVLIGLYVNMLRNNPPCMLESSNRL
FT                   DEEHRLIARYAARLAAESSSSQPTQQRSAPDISFTIDANKQQRQLIAELENKNREILQE
FT                   IQRLRVEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEG
FT                   LMKLLKEEELKQGVMHEIIPLEERT"
FT   CDS             join(<7403831..7403922,7463693..7463760,7474217..7474297,
FT                   7498031..7498244,7511602..7511687,7518718..7518872,
FT                   7521503..7521608,7523976..7524142,7525950..7526074,
FT                   7531102..7531185,7538979..7539056,7539579..7539671,
FT                   7549903..7549990,7550483..7550580,7553578..7553691,
FT                   7559822..7559918,7561695..7561745)
FT                   /codon_start=1
FT                   /gene="Dtna"
FT                   /locus_tag="mCG_140483"
FT                   /product="dystrobrevin alpha, isoform CRA_d"
FT                   /note="gene_id=mCG140483.1 transcript_id=mCT188862.0
FT                   protein_id=mCP109863.0 isoform=CRA_d"
FT                   /protein_id="EDK96979.1"
FT                   /translation="EVFKCHSQLLFQRKQNRWFWKVHAVSSLNFRMIEDSGKRGNTMAE
FT                   RRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPN
FT                   IELNVARLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFDPEGHGKISVFAV
FT                   KMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTE
FT                   QSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSES
FT                   MMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLTNALSKSLSC
FT                   ASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFITRSSPPKDS
FT                   EVEQNKMLARAAPAFLKGRGIQYSLNVADRLADEHVLIGLYVNMLRNNPPCMLESSNRL
FT                   DEEHRLIARYAARLAAESSSSQPTQQRSAPDISFTIDANKQQRQLIAELENKNREILQE
FT                   IQRLRVEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEG
FT                   LMKLLKEEELKQGVSYVPYCRS"
FT   gap             7414649..7414696
FT                   /estimated_length=48
FT   gap             7434239..7434311
FT                   /estimated_length=73
FT   gap             7450388..7450422
FT                   /estimated_length=35
FT   CDS             join(7463694..7463760,7474217..7474297,7498031..7498244,
FT                   7511602..7511687,7518718..7518872,7521503..7521608,
FT                   7523976..7524142,7525950..7526074,7531102..7531185,
FT                   7538979..7539056,7539579..7539671,7549903..7549990,
FT                   7550483..7550580,7553578..7553691,7559822..7559918,
FT                   7561695..7561715,7571599..7571758,7574649..7574738,
FT                   7575340..7575505,7579966..7580098,7581779..7581796)
FT                   /codon_start=1
FT                   /gene="Dtna"
FT                   /locus_tag="mCG_140483"
FT                   /product="dystrobrevin alpha, isoform CRA_e"
FT                   /note="gene_id=mCG140483.1 transcript_id=mCT169730.0
FT                   protein_id=mCP92528.0 isoform=CRA_e"
FT                   /protein_id="EDK96980.1"
FT                   /translation="MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQ
FT                   KKCNLHLVDIWNVIEALRENALNNLDPNIELNVARLEAVLSTIFYQLNKRMPTTHQIHV
FT                   EQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMV
FT                   YGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCL
FT                   VWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHS
FT                   NQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVT
FT                   SMNDTLFSHSVPSSGSPFITRSSPPKDSEVEQNKMLARAAPAFLKGRGIQYSLNVADRL
FT                   ADEHVLIGLYVNMLRNNPPCMLESSNRLDEEHRLIARYAARLAAESSSSQPTQQRSAPD
FT                   ISFTIDANKQQRQLIAELENKNREILQEIQRLRVEHEQASQPTPEKAQQNPTLLAELRL
FT                   LRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEELKQGTQGASSPRSSPSHTISRP
FT                   IPMPIRSASACPTPTHTPQDSLTGVGGDVQEAFAQSSRRNLRSDLLVAADSITNTMSSL
FT                   VKELNSEVASETESTVDSEFSRPQFEDLAPSPTSEKAFLAQIHSRKPGYIHGGAASTTH
FT                   GDMVPEDGDPYTQPEDGNYENESVRQLENELQLEEYLKQKLQDEAYQVSLQG"
FT   CDS             join(7463694..7463760,7474217..7474297,7498031..7498244,
FT                   7511602..7511687,7518718..7518872,7521503..7521608,
FT                   7523976..7524142,7525950..7526074,7531102..7531185,
FT                   7549903..7549990,7550483..7550580,7553578..7553691,
FT                   7559822..7559918,7561695..7561715,7571599..7571758,
FT                   7574649..7574738,7575340..7575505,7579966..7580098,
FT                   7581779..7581796)
FT                   /codon_start=1
FT                   /gene="Dtna"
FT                   /locus_tag="mCG_140483"
FT                   /product="dystrobrevin alpha, isoform CRA_a"
FT                   /note="gene_id=mCG140483.1 transcript_id=mCT169729.0
FT                   protein_id=mCP92529.0 isoform=CRA_a"
FT                   /protein_id="EDK96976.1"
FT                   /translation="MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQ
FT                   KKCNLHLVDIWNVIEALRENALNNLDPNIELNVARLEAVLSTIFYQLNKRMPTTHQIHV
FT                   EQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMV
FT                   YGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCL
FT                   VWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHS
FT                   NQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVT
FT                   SMNDTLFSHSVPSSGSPFITRSMLESSNRLDEEHRLIARYAARLAAESSSSQPTQQRSA
FT                   PDISFTIDANKQQRQLIAELENKNREILQEIQRLRVEHEQASQPTPEKAQQNPTLLAEL
FT                   RLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEELKQGTQGASSPRSSPSHTIS
FT                   RPIPMPIRSASACPTPTHTPQDSLTGVGGDVQEAFAQSSRRNLRSDLLVAADSITNTMS
FT                   SLVKELNSEVASETESTVDSEFSRPQFEDLAPSPTSEKAFLAQIHSRKPGYIHGGAAST
FT                   THGDMVPEDGDPYTQPEDGNYENESVRQLENELQLEEYLKQKLQDEAYQVSLQG"
FT   gap             7478585..7478604
FT                   /estimated_length=20
FT   gap             7494207..7494317
FT                   /estimated_length=111
FT   gap             7551998..7552017
FT                   /estimated_length=20
FT   gap             7570318..7570344
FT                   /estimated_length=27
FT   gene            complement(7573778..>7605413)
FT                   /locus_tag="mCG_145817"
FT                   /note="gene_id=mCG145817.0"
FT   mRNA            complement(join(7573778..7575105,7578354..7578750,
FT                   7580195..7580287,7605369..>7605413))
FT                   /locus_tag="mCG_145817"
FT                   /product="mCG145817"
FT                   /note="gene_id=mCG145817.0 transcript_id=mCT185925.0
FT                   created on 03-JUL-2003"
FT   CDS             complement(join(7574950..7575105,7578354..>7578542))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145817"
FT                   /product="mCG145817"
FT                   /note="gene_id=mCG145817.0 transcript_id=mCT185925.0
FT                   protein_id=mCP107338.0"
FT                   /protein_id="EDK96981.1"
FT                   /translation="CLHPWTTFIWTLSSTSLPSPLLRLGSSASPQFPPSFLCRWTVTAS
FT                   LVGVSPMLALVKSHKPSQGLRGDSIVKSELLAAVKDRIQFPGPMSSYSQPSTTQGIRRL
FT                   IWLYIDKACP"
FT   gap             7600257..7600276
FT                   /estimated_length=20
FT   gap             7604401..7604789
FT                   /estimated_length=389
FT   gap             7624302..7624342
FT                   /estimated_length=41
FT   gene            complement(7678767..7680651)
FT                   /locus_tag="mCG_145695"
FT                   /note="gene_id=mCG145695.0"
FT   mRNA            complement(join(7678767..7678900,7679921..7680164,
FT                   7680586..7680651))
FT                   /locus_tag="mCG_145695"
FT                   /product="mCG145695"
FT                   /note="gene_id=mCG145695.0 transcript_id=mCT185233.0
FT                   created on 09-JUN-2003"
FT   CDS             complement(join(7678770..7678900,7679921..7680074))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145695"
FT                   /product="mCG145695"
FT                   /note="gene_id=mCG145695.0 transcript_id=mCT185233.0
FT                   protein_id=mCP106491.0"
FT                   /protein_id="EDK96982.1"
FT                   /translation="MKRTKKMLWTQYQAQYLQLLDVVPTLAVHNTLQCLTWKQIVGLLP
FT                   LVPREQDNAQLPVGWVIYFNIGASKWIVKKMNIFPSSLKILKFKCKWLY"
FT   gene            <7682064..7814150
FT                   /gene="Mapre2"
FT                   /locus_tag="mCG_128309"
FT                   /note="gene_id=mCG128309.2"
FT   mRNA            join(<7682064..7682210,7700962..7701017,7754225..7754352,
FT                   7775027..7775172,7779317..7779530,7799317..7799456,
FT                   7804909..7805067,7812228..7813736)
FT                   /gene="Mapre2"
FT                   /locus_tag="mCG_128309"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 2, transcript variant mCT185253"
FT                   /note="gene_id=mCG128309.2 transcript_id=mCT185253.0
FT                   created on 09-JUN-2003"
FT   CDS             join(<7682130..7682210,7700962..7701017,7754225..7754352,
FT                   7775027..7775172,7779317..7779530,7799317..7799456,
FT                   7804909..7805067,7812228..7812302)
FT                   /codon_start=1
FT                   /gene="Mapre2"
FT                   /locus_tag="mCG_128309"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 2, isoform CRA_b"
FT                   /note="gene_id=mCG128309.2 transcript_id=mCT185253.0
FT                   protein_id=mCP106511.0 isoform=CRA_b"
FT                   /protein_id="EDK96984.1"
FT                   /translation="SVGTAGCYLAEQDARMKQIRDQRVIRKGPQKHHSLQQPGRVPGCS
FT                   NWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCI
FT                   SLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFY
FT                   DANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGST
FT                   PSRPSSAKRASSSGSASRSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIE
FT                   LLCQEHGQENDDLVQRLMEVLYASDEQEGQTEEPEAEEQAHDQQPQQQEEY"
FT   gap             7708074..7708325
FT                   /estimated_length=252
FT   mRNA            join(7725390..7725607,7754225..7754352,7775027..7775172,
FT                   7779317..7779530,7799317..7799456,7804909..7805067,
FT                   7812228..7812440,7813648..7814150)
FT                   /gene="Mapre2"
FT                   /locus_tag="mCG_128309"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 2, transcript variant mCT129604"
FT                   /note="gene_id=mCG128309.2 transcript_id=mCT129604.0
FT                   created on 09-JUN-2003"
FT   CDS             join(7725489..7725607,7754225..7754352,7775027..7775172,
FT                   7779317..7779530,7799317..7799456,7804909..7805067,
FT                   7812228..7812302)
FT                   /codon_start=1
FT                   /gene="Mapre2"
FT                   /locus_tag="mCG_128309"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 2, isoform CRA_a"
FT                   /note="gene_id=mCG128309.2 transcript_id=mCT129604.0
FT                   protein_id=mCP69128.1 isoform=CRA_a"
FT                   /protein_id="EDK96983.1"
FT                   /translation="MPGPTQTLSPNGENNNDIIQDNGTIIPFRKHTVRGERSYSWGMAV
FT                   NVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVK
FT                   FQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDG
FT                   KEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGSTPSRPSS
FT                   AKRASSSGSASRSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEH
FT                   GQENDDLVQRLMEVLYASDEQEGQTEEPEAEEQAHDQQPQQQEEY"
FT   gap             7821609..7821664
FT                   /estimated_length=56
FT   gap             7829984..7830003
FT                   /estimated_length=20
FT   gap             7833661..7833813
FT                   /estimated_length=153
FT   gap             7837840..7838065
FT                   /estimated_length=226
FT   gap             7843953..7843981
FT                   /estimated_length=29
FT   gap             7858239..7865634
FT                   /estimated_length=7396
FT   gap             7866756..7869275
FT                   /estimated_length=2520
FT   gene            <7876669..7886761
FT                   /gene="Zfp397"
FT                   /locus_tag="mCG_144790"
FT                   /note="gene_id=mCG144790.0"
FT   mRNA            join(<7876669..7876845,7878323..7878837,7879039..7879180,
FT                   7882000..7886761)
FT                   /gene="Zfp397"
FT                   /locus_tag="mCG_144790"
FT                   /product="zinc finger protein 397, transcript variant
FT                   mCT184214"
FT                   /note="gene_id=mCG144790.0 transcript_id=mCT184214.0
FT                   created on 09-JUN-2003"
FT   mRNA            join(<7876871..7877007,7878323..7878837,7879039..7879180,
FT                   7882000..>7882378)
FT                   /gene="Zfp397"
FT                   /locus_tag="mCG_144790"
FT                   /product="zinc finger protein 397, transcript variant
FT                   mCT185313"
FT                   /note="gene_id=mCG144790.0 transcript_id=mCT185313.0
FT                   created on 09-JUN-2003"
FT   CDS             join(<7878397..7878837,7879039..7879180,7882000..7883027)
FT                   /codon_start=1
FT                   /gene="Zfp397"
FT                   /locus_tag="mCG_144790"
FT                   /product="zinc finger protein 397, isoform CRA_a"
FT                   /note="gene_id=mCG144790.0 transcript_id=mCT184214.0
FT                   protein_id=mCP105284.0 isoform=CRA_a"
FT                   /protein_id="EDK96985.1"
FT                   /translation="AFCELFQPRMAVESRAISTLKPQDHQEELILVKIEDSSFSWSQKC
FT                   KQNGSAQSCQELFRQQFRKFCYHETPGPREALGRLQELCHQWLMPELHTKEQILELLVL
FT                   EQFLSILPEELKIWVQQHGPKSGEEAVTLLEDLEKEFDDPGQQVPDNLQGPSVSWKDLT
FT                   YLKTSQDSTSIQVRPLKTQLKSWNPCLSSKSDAKNNESTAKEDISEEKAPELSWDPSCR
FT                   GVSEHKSNLEWQQRSSPVHRGSFSQVIFTHKSLAKRDHLDESQRCLIISTNSVTCQKVS
FT                   TDDRPYRCDVCGHSFKQHFSLTQHQRIHTGEKPYKCNQCGKAFSLRSYLIIHQKIHSGE
FT                   KAYECNECGKAFNQSSALTRHRKIHTGEKACKCNECGKAFSQSSYLIIHQRIHTGEKPY
FT                   GCSECGKTFSQSSKLIRHQRIHTGERPYECNECGKAFKQSSELITHQRIHSGEKPYECN
FT                   ECGKAFSLNSNLIRHQRIHSGEEPYQCNDCGKTFKRSSALVQHQRIHSGDEAYICNECG
FT                   KAFRHRSVLMRHQRVHTIK"
FT   CDS             join(<7878397..7878837,7879039..7879180,7882000..>7882378)
FT                   /codon_start=1
FT                   /gene="Zfp397"
FT                   /locus_tag="mCG_144790"
FT                   /product="zinc finger protein 397, isoform CRA_b"
FT                   /note="gene_id=mCG144790.0 transcript_id=mCT185313.0
FT                   protein_id=mCP106571.0 isoform=CRA_b"
FT                   /protein_id="EDK96986.1"
FT                   /translation="AFCELFQPRMAVESRAISTLKPQDHQEELILVKIEDSSFSWSQKC
FT                   KQNGSAQSCQELFRQQFRKFCYHETPGPREALGRLQELCHQWLMPELHTKEQILELLVL
FT                   EQFLSILPEELKIWVQQHGPKSGEEAVTLLEDLEKEFDDPGQQVPDNLQGPSVSWKDLT
FT                   YLKTSQDSTSIQVRPLKTQLKSWNPCLSSKSDAKNNESTAKEDISEEKAPELSWDPSCR
FT                   GVSEHKSNLEWQQRSSPVHRGSFSQVIFTHKSLAKRDHLDESQRCLIISTNSVTCQKVS
FT                   TDDRPYRCDVCGHSFKQHFSLTQHQRIHTGEKPYKCNQCG"
FT   gene            complement(7886786..>7909213)
FT                   /locus_tag="mCG_128307"
FT                   /note="gene_id=mCG128307.2"
FT   mRNA            complement(join(7886786..7887784,7892911..7893078,
FT                   7893366..7893829,7903508..7903591,7909047..7909213))
FT                   /locus_tag="mCG_128307"
FT                   /product="mCG128307, transcript variant mCT129602"
FT                   /note="gene_id=mCG128307.2 transcript_id=mCT129602.2
FT                   created on 09-JUN-2003"
FT   CDS             complement(join(7886793..7887784,7892911..7893064))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128307"
FT                   /product="mCG128307, isoform CRA_a"
FT                   /note="gene_id=mCG128307.2 transcript_id=mCT129602.2
FT                   protein_id=mCP69099.2 isoform=CRA_a"
FT                   /protein_id="EDK96987.1"
FT                   /translation="MICKETTLMGTSESLSSPLQSLESHCKSEPQDPQIFHERDEATLP
FT                   FRVDDEAKQEIIECVASVAMASPGRLPRETSPVQIVEETMECLDNNEKQRGSDDTSNKT
FT                   SQLSSQEDYFSLATFNKKPPIEQNIFECNEGDRIPSQNLHGTTRPTTHTGKLLYACVDC
FT                   GKTFCNRSKLIRHQRSHTGERPYACKECGKAFGFRADLVRHQRIHSGEKPYKCCDCGKA
FT                   FGSNTGLIRHRRIHTGEKPYGCDECGRAFSQCSTLIQHKRIHSGEKHYSCDECGKAFIQ
FT                   SSALIQHKKIHSGDKSYECTECGKAFWTSYVLREHQRIHTGEKPYKCNECGKSFNRSSA
FT                   LTVHQRTHSGEKPYECNECRKIFRHRSGLVQHQRTHTRVQL"
FT   mRNA            complement(join(7888664..7889182,7892911..7893136,
FT                   7893366..7893829,7903508..7903591,7909047..>7909213))
FT                   /locus_tag="mCG_128307"
FT                   /product="mCG128307, transcript variant mCT188878"
FT                   /note="gene_id=mCG128307.2 transcript_id=mCT188878.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(7893086..7893136,7893366..7893829,
FT                   7903508..7903591,7909047..>7909203))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128307"
FT                   /product="mCG128307, isoform CRA_b"
FT                   /note="gene_id=mCG128307.2 transcript_id=mCT188878.0
FT                   protein_id=mCP109859.0 isoform=CRA_b"
FT                   /protein_id="EDK96988.1"
FT                   /translation="SAERGECEGVAFGLRCLPGPSDGAQSSRTLYPAPFSRSQLGESLK
FT                   QCPDHLAGIRLRSEGLVANVLSHPVLPRTPTTPRQGVLWIHLLSASAFQIILTRMFRET
FT                   TALACHASKGQNRLNFVKVEEENGVWKQDLSLQGNLQSQEVFRQQFRQFGYSDFTGPRE
FT                   ALNRLQKLCQQWLRPEEHSKEQILELLVLEQFMTILPMELKAWVQEHRPRSGEEAVTLL
FT                   EELEREFDEPKHQGFSLSCTQSHYWYLLL"
FT   gene            7911665..7926696
FT                   /gene="Zfp35"
FT                   /locus_tag="mCG_128304"
FT                   /note="gene_id=mCG128304.1"
FT   mRNA            join(7911665..7911717,7912159..7912371,7924617..7926696)
FT                   /gene="Zfp35"
FT                   /locus_tag="mCG_128304"
FT                   /product="zinc finger protein 35"
FT                   /note="gene_id=mCG128304.1 transcript_id=mCT129599.0
FT                   created on 30-MAY-2002"
FT   CDS             join(7912323..7912371,7924617..7926310)
FT                   /codon_start=1
FT                   /gene="Zfp35"
FT                   /locus_tag="mCG_128304"
FT                   /product="zinc finger protein 35"
FT                   /note="gene_id=mCG128304.1 transcript_id=mCT129599.0
FT                   protein_id=mCP69080.1"
FT                   /db_xref="GOA:Q3V142"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:99179"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V142"
FT                   /protein_id="EDK96989.1"
FT                   /translation="MEIQFSYESQDHHFLSDGETKIKIGEPATEEEMTGKIGTVTEESG
FT                   SLEEDVPHDSRGKEFREFGEELNDQMLFRRRQYNCDECDQSFAWSTGLIRHQRTHWKPY
FT                   ECEECGKAFRMSSALVLHQRIHTGEKPYPCSWCIKSFSRSSDLIKHQRVHTGEKPYKCD
FT                   ECGKAFSQSSDLMIHQRIHTGEKPYQCSHCSKSFSQHSGMVKHLRIHTGEKPYMCNHCY
FT                   KHFSQSSDLIKHQRIHTGEKPYKCDVCGKAFSQSSDRILHQRIHTGEKPYPCAQCNKSF
FT                   SQNSDLIKHRRIHTGEKPYKCSECGKAFNQSSVLILHQRIHTGEKPYPCNQCTKSFSRL
FT                   SDLINHQRIHTGEKPYPCSQCSKMFSRRSDLVKHYRIHTGEKPYECDKCGKTFSQSSNL
FT                   ILHQRIHTGEKPYPCNSCSKSFSRGSDLIKHQRVHTGEKPYTCNLCSKSFSQSSDLTKH
FT                   QRVHSGEKPYHCSSCNKAFRQSSDLILHHRVHTGERPYACTQCPRSFSQKSDLIKHQRI
FT                   HTGEKPYKCMCGKAFSQCSAFTLHQRIHTGEKPYPCAQCGKSFSQRSDLVNHQRVHADQ
FT                   KLQM"
FT   gap             7913743..7913762
FT                   /estimated_length=20
FT   gap             7929172..7929191
FT                   /estimated_length=20
FT   gene            complement(7934971..7942753)
FT                   /locus_tag="mCG_128305"
FT                   /note="gene_id=mCG128305.2"
FT   mRNA            complement(join(7934971..7936652,7939251..7939398,
FT                   7939635..7940135,7942681..7942753))
FT                   /locus_tag="mCG_128305"
FT                   /product="mCG128305, transcript variant mCT129600"
FT                   /note="gene_id=mCG128305.2 transcript_id=mCT129600.1
FT                   created on 12-JUN-2003"
FT   mRNA            complement(join(7934971..7936652,7939251..7939398,
FT                   7939635..7940135,7942187..7942289))
FT                   /locus_tag="mCG_128305"
FT                   /product="mCG128305, transcript variant mCT185252"
FT                   /note="gene_id=mCG128305.2 transcript_id=mCT185252.0
FT                   created on 12-JUN-2003"
FT   CDS             complement(join(7936114..7936652,7939251..7939398,
FT                   7939635..7940054))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128305"
FT                   /product="mCG128305, isoform CRA_a"
FT                   /note="gene_id=mCG128305.2 transcript_id=mCT185252.0
FT                   protein_id=mCP106510.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q91VN1"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR008916"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1929704"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VN1"
FT                   /protein_id="EDK96990.1"
FT                   /translation="MSAQSVEEDSILIIPNPDEEEKILRVKLEEDPDGEEGSSISWNHL
FT                   PDPEVFRQRFRQFGYQDSPGPREAVSQLRELCRLWLRPETHTKEQILELVVLEQFVAIL
FT                   PKELQTWVREHHPENGEEAVAVLEDLESELDDPGQPVSLRRQKREVLVEEITSQEDAQG
FT                   LPSSELDAVENQLKWASWELHSLRHCDDDATTENGALAPKQEMASAGESHEGPGTLNIG
FT                   VPQLFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGC
FT                   VECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQC
FT                   GKSYSQSSNLFRHQRRHNAEKLLNVVKV"
FT   CDS             complement(join(7936114..7936652,7939251..7939398,
FT                   7939635..7940054))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128305"
FT                   /product="mCG128305, isoform CRA_a"
FT                   /note="gene_id=mCG128305.2 transcript_id=mCT129600.1
FT                   protein_id=mCP69081.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q91VN1"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR008916"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1929704"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VN1"
FT                   /protein_id="EDK96991.1"
FT                   /translation="MSAQSVEEDSILIIPNPDEEEKILRVKLEEDPDGEEGSSISWNHL
FT                   PDPEVFRQRFRQFGYQDSPGPREAVSQLRELCRLWLRPETHTKEQILELVVLEQFVAIL
FT                   PKELQTWVREHHPENGEEAVAVLEDLESELDDPGQPVSLRRQKREVLVEEITSQEDAQG
FT                   LPSSELDAVENQLKWASWELHSLRHCDDDATTENGALAPKQEMASAGESHEGPGTLNIG
FT                   VPQLFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGC
FT                   VECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQC
FT                   GKSYSQSSNLFRHQRRHNAEKLLNVVKV"
FT   gap             7945184..7945255
FT                   /estimated_length=72
FT   gap             7954103..7954433
FT                   /estimated_length=331
FT   gap             7974891..7975077
FT                   /estimated_length=187
FT   gap             7993610..7993629
FT                   /estimated_length=20
FT   gap             7994916..7994935
FT                   /estimated_length=20
FT   gap             8012403..8012548
FT                   /estimated_length=146
FT   gap             8013686..8013947
FT                   /estimated_length=262
FT   gap             8018998..8019017
FT                   /estimated_length=20
FT   gene            complement(8026657..8043216)
FT                   /gene="D030070L09Rik"
FT                   /locus_tag="mCG_128310"
FT                   /note="gene_id=mCG128310.1"
FT   mRNA            complement(join(8026657..8028562,8033595..8033662,
FT                   8034541..8034652,8035956..8036066,8043033..8043216))
FT                   /gene="D030070L09Rik"
FT                   /locus_tag="mCG_128310"
FT                   /product="RIKEN cDNA D030070L09"
FT                   /note="gene_id=mCG128310.1 transcript_id=mCT129605.0
FT                   created on 30-MAY-2002"
FT   CDS             complement(join(8028431..8028562,8033595..8033662,
FT                   8034541..8034652,8035956..8036066,8043033..8043185))
FT                   /codon_start=1
FT                   /gene="D030070L09Rik"
FT                   /locus_tag="mCG_128310"
FT                   /product="RIKEN cDNA D030070L09"
FT                   /note="gene_id=mCG128310.1 transcript_id=mCT129605.0
FT                   protein_id=mCP69140.1"
FT                   /protein_id="EDK96992.1"
FT                   /translation="MAAQIPIVAATSTPAVARNSKKRPASPSHNSSGGGYGASKKKKLS
FT                   ASGFAQGVSIEAMNESKMASSELSSGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTW
FT                   KNLKQILAAERALPWQLNDPNYFSIDAPPSFKPAKKYSDISGLLANYTDPQSKLRFSTV
FT                   EEFSYIRRLPSDVVTGYLALRKATSIVP"
FT   gap             8028932..8028951
FT                   /estimated_length=20
FT   gap             8037351..8037370
FT                   /estimated_length=20
FT   gap             8044618..8044637
FT                   /estimated_length=20
FT   gap             8049789..8049808
FT                   /estimated_length=20
FT   gap             8051131..8051150
FT                   /estimated_length=20
FT   gap             8073798..8074634
FT                   /estimated_length=837
FT   gap             8082439..8082458
FT                   /estimated_length=20
FT   gap             8105428..8105832
FT                   /estimated_length=405
FT   gap             8121943..8121962
FT                   /estimated_length=20
FT   gene            <8128929..8210063
FT                   /gene="Galnt1"
FT                   /locus_tag="mCG_128302"
FT                   /note="gene_id=mCG128302.3"
FT   mRNA            join(<8128929..8129006,8155820..8155874,8161462..8161705,
FT                   8169269..8169443,8177472..8177638,8187584..8187791,
FT                   8190785..8190955,8192705..8192822,8194843..8195023,
FT                   8195919..8196058,8203197..8203295,8205356..8205490,
FT                   8207964..8208886)
FT                   /gene="Galnt1"
FT                   /locus_tag="mCG_128302"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 1, transcript variant
FT                   mCT188868"
FT                   /note="gene_id=mCG128302.3 transcript_id=mCT188868.0
FT                   created on 08-MAR-2004"
FT   gap             8129026..8129708
FT                   /estimated_length=683
FT   mRNA            join(<8129709..8129803,8155820..8155874,8161462..8161705,
FT                   8169269..8169443,8177472..8177638,8187584..8187791,
FT                   8190785..8190955,8192705..8192822,8194843..8195023,
FT                   8195919..8196058,8203197..8203295,8205356..8205490,
FT                   8207964..8210063)
FT                   /gene="Galnt1"
FT                   /locus_tag="mCG_128302"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 1, transcript variant
FT                   mCT129597"
FT                   /note="gene_id=mCG128302.3 transcript_id=mCT129597.2
FT                   created on 02-JUN-2003"
FT   gap             8135452..8135471
FT                   /estimated_length=20
FT   gap             8171782..8175141
FT                   /estimated_length=3360
FT   CDS             join(<8177635..8177638,8187584..8187791,8190785..8190955,
FT                   8192705..8192822,8194843..8195023,8195919..8196058,
FT                   8203197..8203295,8205356..8205490,8207964..8208110)
FT                   /codon_start=1
FT                   /gene="Galnt1"
FT                   /locus_tag="mCG_128302"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 1, isoform CRA_a"
FT                   /note="gene_id=mCG128302.3 transcript_id=mCT129597.2
FT                   protein_id=mCP69351.2 isoform=CRA_a"
FT                   /protein_id="EDK96993.1"
FT                   /translation="RNFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQV
FT                   ITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKL
FT                   NFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLE
FT                   ISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFF
FT                   YIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETN
FT                   QCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHH
FT                   LKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRNVTLPEI
FT                   F"
FT   CDS             join(<8177635..8177638,8187584..8187791,8190785..8190955,
FT                   8192705..8192822,8194843..8195023,8195919..8196058,
FT                   8203197..8203295,8205356..8205490,8207964..8208110)
FT                   /codon_start=1
FT                   /gene="Galnt1"
FT                   /locus_tag="mCG_128302"
FT                   /product="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 1, isoform CRA_a"
FT                   /note="gene_id=mCG128302.3 transcript_id=mCT188868.0
FT                   protein_id=mCP109857.0 isoform=CRA_a"
FT                   /protein_id="EDK96994.1"
FT                   /translation="RNFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQV
FT                   ITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKL
FT                   NFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLE
FT                   ISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFF
FT                   YIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETN
FT                   QCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHH
FT                   LKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRNVTLPEI
FT                   F"
FT   gap             8180844..8187081
FT                   /estimated_length=6238
FT   gap             8240682..8245068
FT                   /estimated_length=4387
FT   gap             8246112..8246131
FT                   /estimated_length=20
FT   gene            <8259609..8264875
FT                   /locus_tag="mCG_144788"
FT                   /note="gene_id=mCG144788.0"
FT   mRNA            join(<8259609..8259724,8261188..8261416,8262063..8264875)
FT                   /locus_tag="mCG_144788"
FT                   /product="mCG144788"
FT                   /note="gene_id=mCG144788.0 transcript_id=mCT184212.0
FT                   created on 05-JUN-2003"
FT   CDS             <8262248..8262661
FT                   /codon_start=1
FT                   /locus_tag="mCG_144788"
FT                   /product="mCG144788"
FT                   /note="gene_id=mCG144788.0 transcript_id=mCT184212.0
FT                   protein_id=mCP105277.0"
FT                   /protein_id="EDK96995.1"
FT                   /translation="RPVWTWYLCQQQGVSPHMSLFSTLRTERREDLWGFLVVSLDKLSL
FT                   SLSLSLSLSLSLTHTHTHTHTHTHTHKALASKNKTQREKEAPSPRLPHPHPALCRCTSC
FT                   SFPHIYAHMPQTAMPGSHMYTHTQERGARCSGA"
FT   gap             8276690..8276709
FT                   /estimated_length=20
FT   gap             8285055..8285074
FT                   /estimated_length=20
FT   gap             8350297..8350403
FT                   /estimated_length=107
FT   gap             8376411..8376514
FT                   /estimated_length=104
FT   gene            <8391234..8398288
FT                   /locus_tag="mCG_128306"
FT                   /note="gene_id=mCG128306.2"
FT   mRNA            join(<8391234..8391468,8393328..8393527,8395903..8396102,
FT                   8397647..8398288)
FT                   /locus_tag="mCG_128306"
FT                   /product="mCG128306, transcript variant mCT188876"
FT                   /note="gene_id=mCG128306.2 transcript_id=mCT188876.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(8391250..8391364,8391446..8391468,8393328..8393527,
FT                   8395903..8396102,8397647..8398143)
FT                   /locus_tag="mCG_128306"
FT                   /product="mCG128306, transcript variant mCT129601"
FT                   /note="gene_id=mCG128306.2 transcript_id=mCT129601.0
FT                   created on 30-MAY-2002"
FT   CDS             join(8391288..8391364,8391446..8391468,8393328..8393527,
FT                   8395903..8396102,8397647..8397800)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128306"
FT                   /product="mCG128306, isoform CRA_a"
FT                   /note="gene_id=mCG128306.2 transcript_id=mCT129601.0
FT                   protein_id=mCP69083.1 isoform=CRA_a"
FT                   /protein_id="EDK96996.1"
FT                   /translation="MRQKYYIEAAARGLVGSCPGQARYLLWAYSSTHEDNSTFQETCPH
FT                   CFQLLVLDNSRVRLKPKAKLTPKIQKLLNREARNDTLSFKEAKLLRKYKDSTSVLLITC
FT                   RTCNRTVRHHGKSRSFLWALKSNAATAANKASPKTPKRTAPGSANLGQSTNGSKGKSPS
FT                   LTIRTPTSGQSTPICSSRNGSKRKKHFSQLKALLSQSASDKNPKLDFRHFLSSL"
FT   CDS             join(<8391369..8391468,8393328..8393527,8395903..8396102,
FT                   8397647..8397800)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128306"
FT                   /product="mCG128306, isoform CRA_b"
FT                   /note="gene_id=mCG128306.2 transcript_id=mCT188876.0
FT                   protein_id=mCP109858.0 isoform=CRA_b"
FT                   /protein_id="EDK96997.1"
FT                   /translation="KRGGGRADGRAGGHGALASPPLFFCRWAYSSTHEDNSTFQETCPH
FT                   CFQLLVLDNSRVRLKPKAKLTPKIQKLLNREARNDTLSFKEAKLLRKYKDSTSVLLITC
FT                   RTCNRTVRHHGKSRSFLWALKSNAATAANKASPKTPKRTAPGSANLGQSTNGSKGKSPS
FT                   LTIRTPTSGQSTPICSSRNGSKRKKHFSQLKALLSQSASDKNPKLDFRHFLSSL"
FT   gene            complement(8405335..8451003)
FT                   /gene="BC021395"
FT                   /locus_tag="mCG_128308"
FT                   /note="gene_id=mCG128308.1"
FT   mRNA            complement(join(8405335..8406027,8407441..8407544,
FT                   8408512..8408707,8427210..8427385,8427481..8427607,
FT                   8428374..8428471,8428550..8428656,8430172..8430301,
FT                   8450434..8451003))
FT                   /gene="BC021395"
FT                   /locus_tag="mCG_128308"
FT                   /product="cDNA sequence BC021395, transcript variant
FT                   mCT129603"
FT                   /note="gene_id=mCG128308.1 transcript_id=mCT129603.0
FT                   created on 30-MAY-2002"
FT   mRNA            complement(join(8408326..8408707,8427210..8427385,
FT                   8427481..8427607,8428374..8428471,8428550..8428656,
FT                   8430172..8430301,8450434..>8450659))
FT                   /gene="BC021395"
FT                   /locus_tag="mCG_128308"
FT                   /product="cDNA sequence BC021395, transcript variant
FT                   mCT188832"
FT                   /note="gene_id=mCG128308.1 transcript_id=mCT188832.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(8408558..8408707,8427210..8427385,
FT                   8427481..8427607,8428374..8428471,8428550..8428656,
FT                   8430172..8430301,8450434..>8450659))
FT                   /codon_start=1
FT                   /gene="BC021395"
FT                   /locus_tag="mCG_128308"
FT                   /product="cDNA sequence BC021395, isoform CRA_a"
FT                   /note="gene_id=mCG128308.1 transcript_id=mCT188832.0
FT                   protein_id=mCP109860.0 isoform=CRA_a"
FT                   /protein_id="EDK96998.1"
FT                   /translation="AATRAATLSSPRLHGVGRRERGSGGMSAFSEAALEKKLSELSNSQ
FT                   QSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQNSKRKGPEFTK
FT                   DFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKHALYGDKKARKR
FT                   TYEQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEV
FT                   SLLEKITDKESGERLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALA
FT                   EKEHKLEEYKRKLARVSLVRKELRARIQSLPDLSRLPNVTGSHMHLPFAGDIYSED"
FT   CDS             complement(join(8408558..8408707,8427210..8427385,
FT                   8427481..8427607,8428374..8428471,8428550..8428656,
FT                   8430172..8430301,8450434..8450584))
FT                   /codon_start=1
FT                   /gene="BC021395"
FT                   /locus_tag="mCG_128308"
FT                   /product="cDNA sequence BC021395, isoform CRA_b"
FT                   /note="gene_id=mCG128308.1 transcript_id=mCT129603.0
FT                   protein_id=mCP69115.1 isoform=CRA_b"
FT                   /protein_id="EDK96999.1"
FT                   /translation="MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWE
FT                   RELRKAKPNRKLTFLYLANDVIQNSKRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHL
FT                   GRVLSIWEERSVYENDVLEQLKHALYGDKKARKRTYEQIKVDENENCSSLGSPSEPPQT
FT                   LDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLEKITDKESGERLSKMVEDACML
FT                   LADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELRA
FT                   RIQSLPDLSRLPNVTGSHMHLPFAGDIYSED"
FT   gap             8436085..8436164
FT                   /estimated_length=80
FT   gap             8438252..8438334
FT                   /estimated_length=83
FT   gap             8447102..8447343
FT                   /estimated_length=242
FT   gap             8457569..8457979
FT                   /estimated_length=411
FT   gap             8463891..8464026
FT                   /estimated_length=136
FT   gap             8466180..8466403
FT                   /estimated_length=224
FT   gap             8477561..8479141
FT                   /estimated_length=1581
FT   gene            complement(8493733..8517321)
FT                   /gene="Slc39a6"
FT                   /locus_tag="mCG_121210"
FT                   /note="gene_id=mCG121210.1"
FT   mRNA            complement(join(8493733..8494930,8496170..8496360,
FT                   8497873..8497953,8498979..8499356,8503591..8503696,
FT                   8510110..8510328,8511587..8511756,8513074..8513257,
FT                   8514659..8515465,8517113..8517321))
FT                   /gene="Slc39a6"
FT                   /locus_tag="mCG_121210"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 6"
FT                   /note="gene_id=mCG121210.1 transcript_id=mCT122402.1
FT                   created on 31-MAY-2002"
FT   CDS             complement(join(8494778..8494930,8496170..8496360,
FT                   8497873..8497953,8498979..8499356,8503591..8503696,
FT                   8510110..8510328,8511587..8511756,8513074..8513257,
FT                   8514659..8515456))
FT                   /codon_start=1
FT                   /gene="Slc39a6"
FT                   /locus_tag="mCG_121210"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 6"
FT                   /note="gene_id=mCG121210.1 transcript_id=mCT122402.1
FT                   protein_id=mCP69285.1"
FT                   /protein_id="EDK97000.1"
FT                   /translation="MATDLSVIMILTFALWVTSPLHELQSTAAFSQTTEKINSNWEPGV
FT                   NVDLAVTMQRHHLQQLFYRYGENDSLSVEGFRKLLQNIGIDKIKRVHIHHDHEHHADHE
FT                   HHSDHEHHSDHEHHSDHEHHSDHEHHSHRSHTVAGKNNRKAFCPDLDSDNSGKNPRTSL
FT                   GKGSRPAEHMNGRRNIKESASSSEVTSAVYNAVSEGTRFVETIETPKPGRRTKDVNPST
FT                   PPSITEKSRVGRLSRLARKKSNESVSEPRKSFMYSRNTNDNIQECFNTTKLLTSHGMSI
FT                   QALLNATEFNYLCPAIINQIDARACLIHTASEKKAEIPPKTYSLQIAWLGGFIAISIIS
FT                   FLSLLGVILVPLMNRVFFKFLLSFLVALAVGTLSGDALLHLLPHSHASHQHSHSHEEPA
FT                   MEMKRGPLFSHLSAQNIEESSYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKN
FT                   QKKPENDEDVESKKQLSKYDSQLSSNEEKVDPGERPESYLRADSQEPSPFDSQQPTMLE
FT                   EEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHHHDYHHILHHHHHQN
FT                   HHPHSHSQRYSREELKDAGIATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSVA
FT                   VFCHELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMATGIFIGHYAENVSMWIF
FT                   ALTAGLFMYVALVDMVPEMLHNDASDHGCSRWGYFFLQNAGILLGFGIMLLISIFEHKI
FT                   VFRINF"
FT   gene            <8517821..8552619
FT                   /gene="Statip1"
FT                   /locus_tag="mCG_121200"
FT                   /note="gene_id=mCG121200.1"
FT   mRNA            join(<8517821..8517958,8520683..8520761,8523456..8523526,
FT                   8525739..8525895,8526274..8526351,8528242..8528306,
FT                   8528987..8529053,8529715..8529852,8531223..8531318,
FT                   8532900..8533000,8533204..8533335,8535901..8536059,
FT                   8536301..8536489,8539334..8539400,8539947..8540039,
FT                   8540210..8540267,8540817..8540889,8545172..8545364,
FT                   8546572..8546693,8548152..8548285,8548714..8548821,
FT                   8552207..8552619)
FT                   /gene="Statip1"
FT                   /locus_tag="mCG_121200"
FT                   /product="signal transducer and activator of transcription
FT                   interacting protein 1"
FT                   /note="gene_id=mCG121200.1 transcript_id=mCT122397.0
FT                   created on 31-MAY-2002"
FT   CDS             join(8517821..8517958,8520683..8520761,8523456..8523526,
FT                   8525739..8525895,8526274..8526351,8528242..8528306,
FT                   8528987..8529053,8529715..8529852,8531223..8531318,
FT                   8532900..8533000,8533204..8533335,8535901..8536059,
FT                   8536301..8536489,8539334..8539400,8539947..8540039,
FT                   8540210..8540267,8540817..8540889,8545172..8545364,
FT                   8546572..8546693,8548152..8548285,8548714..8548821,
FT                   8552207..8552384)
FT                   /codon_start=1
FT                   /gene="Statip1"
FT                   /locus_tag="mCG_121200"
FT                   /product="signal transducer and activator of transcription
FT                   interacting protein 1"
FT                   /note="gene_id=mCG121200.1 transcript_id=mCT122397.0
FT                   protein_id=mCP69032.0"
FT                   /protein_id="EDK97001.1"
FT                   /translation="MVSSVLEVSHVFCCPNRVRGALSWNTGPGGLLAFGTSCSVVLYDP
FT                   QKKVVITNLNGHTARVNCLQWIRTEDGSPSNELVSGGSDNRVIHWELENNQVLKSVRLQ
FT                   GHEGPVCAVHAIYQSGPSEGEQHALIASAASDSTVRIWSKKGSEVKYLQTLSFRDGFVL
FT                   SVCLAILPGTNVPVLACGDDDCRIHLYIQQDDQFQKALSLCGHEDWIRGVEWATFGRDL
FT                   FLASCSQDCLIRIWRLYMKPASFETKDGSLRLKENTFTIKDGGVRTTVAVTLETVLAGH
FT                   ENWVNAVHWQPSFYKDGVLQQPVRLLSASMDKTMILWAPDEESGVWLEQVRVGEVGGNT
FT                   LGFYDCQFGENGTMIIAHAFHGALHLWKQSTVNPRQWAPEIVISGHFDGVQDLMWDPEG
FT                   EFIITTSTDQTTRLFAPWKKKDQKDRSQVTWHEIARPQIHGYNIKCLAMIDRFQFVSGA
FT                   DEKVLRVFSAPRNFVENFSVISRQSLSHMLCDDQDLPEGATVPALGLSNKALFQGDIAS
FT                   QPFEEDELISPAFGSPQVTFQPAVLNEPPTEDHLLQNTLWPEIQKLYGHGYEIVCVACN
FT                   NSKTLLASACKASQKEHAAIILWSTASWKQVQSLAFHTLTVTQMTFSPDDKFLLAVSRD
FT                   RTWSLWKRQDATSSEFDPFFSLFAFTNKITSVHSRIIWSCDWSPDNKYFFTGSRDKKVV
FT                   VWGECKSSHNPMEHPIRPCSSILDVGSSVTAVSVCPVLNPAQRYIVAIGLESGKICIYS
FT                   WNKTNQEINDWTSCVETNPSQSHSLGIRRLCWKSCSDDDDDDDDDDTEQSEEGPEWLHF
FT                   ASCGEDHTVKIYRVNRRAL"
FT   gap             8563258..8563438
FT                   /estimated_length=181
FT   gene            8567365..8615008
FT                   /locus_tag="mCG_121208"
FT                   /note="gene_id=mCG121208.1"
FT   mRNA            join(8567365..8567948,8573858..8573947,8577885..8577951,
FT                   8579878..8579999,8580102..8580552,8584466..8584542,
FT                   8588142..8588341,8590471..8590587,8592846..8593271,
FT                   8596593..8596755,8600091..8600169,8602402..8602526,
FT                   8605982..8606087,8609332..8609470,8613286..8613390,
FT                   8614819..8615008)
FT                   /locus_tag="mCG_121208"
FT                   /product="mCG121208"
FT                   /note="gene_id=mCG121208.1 transcript_id=mCT122401.1
FT                   created on 31-MAY-2002"
FT   CDS             join(8567807..8567948,8573858..8573947,8577885..8577951,
FT                   8579878..8579999,8580102..8580552,8584466..8584542,
FT                   8588142..8588341,8590471..8590587,8592846..8593271,
FT                   8596593..8596755,8600091..8600169,8602402..8602526,
FT                   8605982..8606087,8609332..8609470,8613286..8613390,
FT                   8614819..8614929)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121208"
FT                   /product="mCG121208"
FT                   /note="gene_id=mCG121208.1 transcript_id=mCT122401.1
FT                   protein_id=mCP69075.1"
FT                   /protein_id="EDK97002.1"
FT                   /translation="MACGAAERGPEPPAFQRHLEASTQRLAHGYGLRSMSELRDQEFGR
FT                   LAGTVYLDHAGATLFPQSQLTNFTKDLMENVYGNPHSQNITSKLTHDTVEQVRYRILTH
FT                   FHTTPEDYIVIFTAGSTAALRLVAEAFPWVSRSPENTMSVTSIPVKPEDMWSAEGKDAG
FT                   ACDPDCQLPHLFCYPAQSNFSGTRYPLSWVEEVKSGRRSPVNAPGKWFVLLDAASYVST
FT                   SPLDLSAHQADFIPISFYKIFGLPTGLGALLVNKHVAPLLRKGYFGGGTAAAYLAGEDF
FT                   YVPRSSVAERFEDGTISFLDVIALKHGFDALEHLTGGMVNIQQHTFALVQYTHSALSSL
FT                   RYLNGAPVVRIYSDSEFSSPDVQGPIINFNVLDDGGKIIGYSQVDKMASLYNIHLRTGC
FT                   FCNLGACQRHLGLSDEMVKKHFQAGHVCGDDVDIIDGRPTGSVRISFGYMSTLEDAQAF
FT                   LRFISTIYLRSPSDQPVPQASISDAGALTSKSDCHSPQEGSCTDPSVCNGSYPDTNIMD
FT                   LHPSLSKASSAQQTPQDKAAGILNGDPGSHIVTNIYLYPIKSCAAFEVTKWPVGSQGLL
FT                   YDRSWMVVNHNGICMSQKQEPRLCLIQPFIDLQQRIMVIKAEGMEPIQVPLEEDGEQTQ
FT                   ICQSRVCADRVNTYDCGENVSRWLSKFLGRLCHLIKQSPHFQRNARKTPKKGQPPGTTV
FT                   ALSLVNEAQYLLVNTSSILELQRQLNASDEHGKEESFSMKDLISRFRANIITKGARAFE
FT                   EEKWDEISIGSLHFQVLGPCHRCQMICINQQTGQRNQDVFQTLSESRGRKVNFGVYLMH
FT                   SYLDLSSPCFLSVGSEVLPVLKDCGVS"
FT   gap             8580034..8580080
FT                   /estimated_length=47
FT   gene            complement(8621814..8622783)
FT                   /locus_tag="mCG_146820"
FT                   /note="gene_id=mCG146820.0"
FT   mRNA            complement(8621814..8622783)
FT                   /locus_tag="mCG_146820"
FT                   /product="mCG146820"
FT                   /note="gene_id=mCG146820.0 transcript_id=mCT187083.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(8622404..8622547)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146820"
FT                   /product="mCG146820"
FT                   /note="gene_id=mCG146820.0 transcript_id=mCT187083.0
FT                   protein_id=mCP108176.0"
FT                   /protein_id="EDK97003.1"
FT                   /translation="MKETELVSLRLGTQTREQGSLQACDWEIAIRSPGKDSREVCAGEK
FT                   RS"
FT   gap             8622826..8622880
FT                   /estimated_length=55
FT   gene            8622896..9051164
FT                   /gene="Fhod3"
FT                   /locus_tag="mCG_145755"
FT                   /note="gene_id=mCG145755.0"
FT   mRNA            join(8622896..8623200,8667883..8667989,8685834..8685898,
FT                   8813713..8813780,8819967..8820072,8885240..8885334,
FT                   8901291..8901402,8906128..8906222,8910571..8910714,
FT                   8917946..8918187,8973812..8973946,8977882..8977932,
FT                   8983775..8983983,9002918..9003196,9007659..9008155,
FT                   9008338..9008559,9019205..9019363,9027734..9027916,
FT                   9030225..9030344,9031189..9031350,9033378..9033568,
FT                   9037654..9037846,9043278..9043452,9048068..9048229,
FT                   9050575..9051164)
FT                   /gene="Fhod3"
FT                   /locus_tag="mCG_145755"
FT                   /product="formin homology 2 domain containing 3"
FT                   /note="gene_id=mCG145755.0 transcript_id=mCT185760.0
FT                   created on 16-JUN-2003"
FT   CDS             join(8623036..8623200,8667883..8667989,8685834..8685898,
FT                   8813713..8813780,8819967..8820072,8885240..8885334,
FT                   8901291..8901402,8906128..8906222,8910571..8910714,
FT                   8917946..8918187,8973812..8973946,8977882..8977932,
FT                   8983775..8983983,9002918..9003196,9007659..9008155,
FT                   9008338..9008559,9019205..9019363,9027734..9027916,
FT                   9030225..9030344,9031189..9031350,9033378..9033568,
FT                   9037654..9037846,9043278..9043452,9048068..9048229,
FT                   9050575..9050657)
FT                   /codon_start=1
FT                   /gene="Fhod3"
FT                   /locus_tag="mCG_145755"
FT                   /product="formin homology 2 domain containing 3"
FT                   /note="gene_id=mCG145755.0 transcript_id=mCT185760.0
FT                   protein_id=mCP107018.0"
FT                   /protein_id="EDK97004.1"
FT                   /translation="MATLACRVQFLDDTDPFNSTNFPEPSRPPLFTFREDLALGTQLAG
FT                   VHRLLRAPHKLDDCTLQLSHNGAYLDLEATLAEQRDELEGFQDDTGRGKKNSIILRTQL
FT                   SVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVIAEGLTCLIKVGAEADQN
FT                   YQNYILRALGQIMLYVDGMNGVINHSETIQWLYTLVGSKFRLVVKTALKLLLVFVEYSE
FT                   SNAPLLIQAVSAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLAGLPDQDT
FT                   FYDVVDCLEELGIAAVSQRHLNKKGTDLDLLEQFNIYEVALRHEDGDETAEPPPSGHRD
FT                   RRRASMCSGGTVGEQQGLDRRRSRRHSIQNIKSPLSAPTSPCSPSVPAFKPSQVRDLCE
FT                   KSSPSGLLTSSFRQHQESLAAERERRRQEREERLQRIEREERNKFNREYLDKREEQRQA
FT                   RGERYKYLEQLAAETQEKEPRSQSVSRGRADLSLDLSLPAAPAPPPPSSQSPSADSQEA
FT                   LPVPSSPPTLQCPQVSGKDHEPELEAEAGQGADEASQDIASAHRGAESQEEPVLELEPE
FT                   ERASLSEKERQNEEVNERDNCSASSISSSSSTLEREEKEDKLSEDRATGLWSTSLQDVG
FT                   VNGQCGDILTSKRFMLDMLYAHNRKSTEDEEKDDGEPGRSAQEVEAVASLATRISTLQA
FT                   NSQAPEESIKRVDIGCLDNRGSVKAFAEKFNSGEVGRGAISPDVESQDKVPDTPPAQLK
FT                   TESDYIWDQLMANPRELRIQDMDFTDLGEEDDIDVLDGLGWSQVPRGQPAFTKKKKTIR
FT                   LFWNEVRPFEWPSKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVTKKTAADGK
FT                   RQEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKILTMIPTEEEKQ
FT                   KIQEAQLANPEVPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKE
FT                   GIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCT
FT                   MVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPV
FT                   LKQRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEF
FT                   ALEYRTTRERVLQQKQKRANHRERNKTRGKMITDSGKFSGSSPAAPSQPQGLSYAEDAA
FT                   EHENMKAVLKTSSPALEDATPVLGVRTRSRASRGSTSSWTMGTEESPSVTDDAADEIMD
FT                   RIVKSATQVPSQRVVPRERKRSRANRKSLRRTLKSGLTPEEARALGLVGTSELQL"
FT   gap             8639748..8639767
FT                   /estimated_length=20
FT   gap             8660174..8660193
FT                   /estimated_length=20
FT   gap             8662332..8662351
FT                   /estimated_length=20
FT   gap             8675493..8675512
FT                   /estimated_length=20
FT   gap             8694401..8694420
FT                   /estimated_length=20
FT   gap             8731026..8731142
FT                   /estimated_length=117
FT   gap             8738184..8738203
FT                   /estimated_length=20
FT   gene            8738299..8739336
FT                   /locus_tag="mCG_121199"
FT                   /note="gene_id=mCG121199.1"
FT   mRNA            8738299..8739336
FT                   /locus_tag="mCG_121199"
FT                   /product="mCG121199"
FT                   /note="gene_id=mCG121199.1 transcript_id=mCT122396.1
FT                   created on 31-MAY-2002"
FT   CDS             8738349..8738825
FT                   /codon_start=1
FT                   /locus_tag="mCG_121199"
FT                   /product="mCG121199"
FT                   /note="gene_id=mCG121199.1 transcript_id=mCT122396.1
FT                   protein_id=mCP69023.1"
FT                   /protein_id="EDK97005.1"
FT                   /translation="MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAI
FT                   PGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWR
FT                   PAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS"
FT   gap             8747621..8747640
FT                   /estimated_length=20
FT   gap             8773722..8773741
FT                   /estimated_length=20
FT   gap             8785841..8785860
FT                   /estimated_length=20
FT   gap             8796551..8796614
FT                   /estimated_length=64
FT   gap             8862519..8862595
FT                   /estimated_length=77
FT   gap             8902575..8902594
FT                   /estimated_length=20
FT   gap             8904079..8904108
FT                   /estimated_length=30
FT   gap             8927597..8927616
FT                   /estimated_length=20
FT   gap             8957614..8958195
FT                   /estimated_length=582
FT   gap             8962174..8962328
FT                   /estimated_length=155
FT   gap             8966190..8966209
FT                   /estimated_length=20
FT   gap             8967362..8967381
FT                   /estimated_length=20
FT   gap             9008193..9008212
FT                   /estimated_length=20
FT   gap             9010327..9010354
FT                   /estimated_length=28
FT   gap             9034685..9034784
FT                   /estimated_length=100
FT   gene            complement(9047046..9049067)
FT                   /locus_tag="mCG_146819"
FT                   /note="gene_id=mCG146819.0"
FT   mRNA            complement(9047046..9049067)
FT                   /locus_tag="mCG_146819"
FT                   /product="mCG146819"
FT                   /note="gene_id=mCG146819.0 transcript_id=mCT187082.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(9047541..9048014)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146819"
FT                   /product="mCG146819"
FT                   /note="gene_id=mCG146819.0 transcript_id=mCT187082.0
FT                   protein_id=mCP108175.0"
FT                   /db_xref="MGI:MGI:3642336"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C9X9"
FT                   /protein_id="EDK97006.1"
FT                   /translation="MLLFFYVADSHQKWIPAKISGSFRVSDMPRLMACPHLCLPSCWCC
FT                   GCLNWDIYFVFSYNTAVFLSLCYLTLSLSPVCDIATCRSYDYLRAHDPSNTLHRISDIQ
FT                   KGTSSTTQRATKRLLNHIFIMYLVNVTETNSVCDTHFMLGFPLESKLALLHQQ"
FT   gap             9049097..9049302
FT                   /estimated_length=206
FT   gene            complement(9053671..9086454)
FT                   /gene="5730494M16Rik"
FT                   /locus_tag="mCG_121204"
FT                   /note="gene_id=mCG121204.2"
FT   mRNA            complement(join(9053671..9056809,9058116..9058276,
FT                   9059191..9059307,9066785..9066913,9068871..9068958,
FT                   9075921..9076000,9085978..9086454))
FT                   /gene="5730494M16Rik"
FT                   /locus_tag="mCG_121204"
FT                   /product="RIKEN cDNA 5730494M16"
FT                   /note="gene_id=mCG121204.2 transcript_id=mCT122399.2
FT                   created on 02-JUN-2003"
FT   CDS             complement(join(9056576..9056809,9058116..9058276,
FT                   9059191..9059307,9066785..9066913,9068871..9068958,
FT                   9075921..9075941))
FT                   /codon_start=1
FT                   /gene="5730494M16Rik"
FT                   /locus_tag="mCG_121204"
FT                   /product="RIKEN cDNA 5730494M16"
FT                   /note="gene_id=mCG121204.2 transcript_id=mCT122399.2
FT                   protein_id=mCP69058.1"
FT                   /protein_id="EDK97007.1"
FT                   /translation="MISSWEQKNNCVMPEDVRNFYLMTNGFHMTWSVKLDEHIIPLGSM
FT                   VINGISKLTQLIQSSVYSLPNAPTLADLEDDTQEGNEDHQLEKPHFDCRSAIFELDSCN
FT                   GNGKVCLVYKNGKPGLAHDTEIWFLDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFT
FT                   SYGISPQAKQWFSMYKPITYNTSLLTEESDNFVNKLDPSKVFKSKNKILIPKKKGPVPP
FT                   ASGQKGPGPLPPPTSKPTTGSGNPVRK"
FT   gap             9059565..9059648
FT                   /estimated_length=84
FT   gap             9083772..9085472
FT                   /estimated_length=1701
FT   gene            <9092134..9382455
FT                   /locus_tag="mCG_121202"
FT                   /note="gene_id=mCG121202.1"
FT   mRNA            join(<9092134..9092167,9092786..9092928,9099499..9099593,
FT                   9121306..9121435,9206406..9206519,9256296..9256964,
FT                   9317467..9317648,9337532..9337640,9381341..9382455)
FT                   /locus_tag="mCG_121202"
FT                   /product="mCG121202"
FT                   /note="gene_id=mCG121202.1 transcript_id=mCT122398.1
FT                   created on 20-AUG-2002"
FT   CDS             join(<9092134..9092167,9092786..9092928,9099499..9099593,
FT                   9121306..9121435,9206406..9206519,9256296..9256964,
FT                   9317467..9317487)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121202"
FT                   /product="mCG121202"
FT                   /note="gene_id=mCG121202.1 transcript_id=mCT122398.1
FT                   protein_id=mCP69049.1"
FT                   /protein_id="EDK97008.1"
FT                   /translation="SDEDQSVAYVPGISTEGNTRSRVKLINPKVDVKVKASRVTDASVS
FT                   MESLKGAGDSVAEQNFCKRGMKSASLKDLCLEDKRRIANLIKELARVSEEKEVTEERLK
FT                   TEQESFEKKIRQLEEQNELIIKEREDILLKYRECQELLSLYQKYLSEQQEKLTLSLSEL
FT                   GAARAQEQQITKKKNTPQCSLMDLDGSFLSVARPQNYGQTKARPKSANQVSESFTELRN
FT                   NSLRPITLHHPKEDLERMSTKTRTCTYESLGRRLINAAPIEKSLPVELKIKEYPNLPPT
FT                   PSSQYCGHKCSESGAYVHENYHPTNMAPQCCKTHPESCSHCRIPWASQMHDRVILQPRE
FT                   TDIEKQLSEDRRQQLMLQKMELEIEKERLQHLLAQQETKLLLKQQQLHQSRLDYNLMEA
FT                   KM"
FT   gap             9133105..9136726
FT                   /estimated_length=3622
FT   gap             9170250..9174525
FT                   /estimated_length=4276
FT   gap             9178084..9178103
FT                   /estimated_length=20
FT   gap             9195080..9195349
FT                   /estimated_length=270
FT   gap             9196568..9196856
FT                   /estimated_length=289
FT   gap             9217678..9217732
FT                   /estimated_length=55
FT   gap             9221764..9221861
FT                   /estimated_length=98
FT   gene            complement(<9238540..>9238767)
FT                   /locus_tag="mCG_1031601"
FT                   /note="gene_id=mCG1031601.1"
FT   mRNA            complement(<9238540..>9238767)
FT                   /locus_tag="mCG_1031601"
FT                   /product="mCG1031601"
FT                   /note="gene_id=mCG1031601.1 transcript_id=mCT149305.1
FT                   created on 31-MAY-2002"
FT   CDS             complement(<9238540..>9238767)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031601"
FT                   /product="mCG1031601"
FT                   /note="gene_id=mCG1031601.1 transcript_id=mCT149305.1
FT                   protein_id=mCP69106.1"
FT                   /protein_id="EDK97009.1"
FT                   /translation="DLQAQDRAHRIGQQNEVQVLRLCTVNSVEEKILEAAKYKLNVDQK
FT                   VIQVGMFDQKSSSHKRRAFLQAILEHEEENE"
FT   gap             9252722..9252741
FT                   /estimated_length=20
FT   gap             9266478..9266497
FT                   /estimated_length=20
FT   gap             9269729..9270793
FT                   /estimated_length=1065
FT   gap             9280393..9282704
FT                   /estimated_length=2312
FT   gap             9292189..9292440
FT                   /estimated_length=252
FT   gap             9304259..9304278
FT                   /estimated_length=20
FT   gap             9330901..9330920
FT                   /estimated_length=20
FT   gap             9339203..9339222
FT                   /estimated_length=20
FT   gap             9369932..9370019
FT                   /estimated_length=88
FT   gap             9371509..9371537
FT                   /estimated_length=29
FT   gap             9374707..9375081
FT                   /estimated_length=375
FT   gene            complement(9395630..>9672097)
FT                   /gene="Brunol4"
FT                   /locus_tag="mCG_145685"
FT                   /note="gene_id=mCG145685.1"
FT   mRNA            complement(join(9395630..9397425,9404509..9404680,
FT                   9408803..9408886,9413884..9413967,9415127..9415192,
FT                   9418865..9419014,9420597..9420744,9421803..9421946,
FT                   9422153..9422232,9422556..9422681,9455212..9455290,
FT                   9597770..9597852,9671496..9671903))
FT                   /gene="Brunol4"
FT                   /locus_tag="mCG_145685"
FT                   /product="bruno-like 4, RNA binding protein (Drosophila),
FT                   transcript variant mCT185113"
FT                   /note="gene_id=mCG145685.1 transcript_id=mCT185113.0
FT                   created on 02-JUN-2003"
FT   mRNA            complement(join(9396181..9397425,9404509..9404680,
FT                   9408743..9408886,9413884..9413967,9415127..9415192,
FT                   9418865..9419014,9420597..9420744,9421803..9421946,
FT                   9422153..9422232,9422556..9422681,9455242..9455290,
FT                   9597770..9597852,9671496..>9671904))
FT                   /gene="Brunol4"
FT                   /locus_tag="mCG_145685"
FT                   /product="bruno-like 4, RNA binding protein (Drosophila),
FT                   transcript variant mCT188855"
FT                   /note="gene_id=mCG145685.1 transcript_id=mCT188855.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(9396829..9397425,9404509..9404680,
FT                   9408803..9408886,9413884..9413964,9415127..9415192,
FT                   9418865..9419014,9420597..9420744,9421803..9421946,
FT                   9422153..9422232,9422556..9422684,9455212..9455290,
FT                   9597770..9597852,9671496..>9672097))
FT                   /gene="Brunol4"
FT                   /locus_tag="mCG_145685"
FT                   /product="bruno-like 4, RNA binding protein (Drosophila),
FT                   transcript variant mCT188854"
FT                   /note="gene_id=mCG145685.1 transcript_id=mCT188854.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(9397185..9397425,9404509..9404680,
FT                   9408743..9408886,9413884..9413964,9415127..9415192,
FT                   9418865..9419014,9420597..9420744,9421803..9421946,
FT                   9422153..9422232,9422556..9422681,9455212..9455290,
FT                   9597770..9597852,9671496..>9672097))
FT                   /gene="Brunol4"
FT                   /locus_tag="mCG_145685"
FT                   /product="bruno-like 4, RNA binding protein (Drosophila),
FT                   transcript variant mCT188853"
FT                   /note="gene_id=mCG145685.1 transcript_id=mCT188853.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(9397187..9397425,9404509..9404680,
FT                   9413884..9413964,9415127..9415192,9418865..9419014,
FT                   9420597..9420744,9421803..9421946,9422153..9422232,
FT                   9422556..9422684,9455212..9455290,9597770..9597852,
FT                   9671496..>9671859))
FT                   /gene="Brunol4"
FT                   /locus_tag="mCG_145685"
FT                   /product="bruno-like 4, RNA binding protein (Drosophila),
FT                   transcript variant mCT188852"
FT                   /note="gene_id=mCG145685.1 transcript_id=mCT188852.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(9404553..9404680,9408743..9408886,
FT                   9413884..9413967,9415127..9415192,9418865..9419014,
FT                   9420597..9420744,9421803..9421946,9422153..9422232,
FT                   9422556..9422681,9455242..9455290,9597770..9597852,
FT                   9671496..>9671799))
FT                   /codon_start=1
FT                   /gene="Brunol4"
FT                   /locus_tag="mCG_145685"
FT                   /product="bruno-like 4, RNA binding protein (Drosophila),
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG145685.1 transcript_id=mCT188855.0
FT                   protein_id=mCP109870.0 isoform=CRA_e"
FT                   /protein_id="EDK97014.1"
FT                   /translation="KERFFSMYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHS
FT                   PGNPSTIPMKDHDAIKLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCA
FT                   FLTYCERESALKAQSALHEQKTLPGMNRPIQVKPADSESRGDRKLFVGMLNKQQSEDDV
FT                   RRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQTMPGASSSLVV
FT                   KFADTDKERTMRRMQQMAGQMGMFNPMAIPFGAYGAYAQALMQQQAALMASVAQGGYLN
FT                   PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPIGVNGFTGLP
FT                   PQANGQPAAEAVFANGIHPYPAQSPTAADPLQQAYAGVQQYAGPAAYPAAYGQISQAFP
FT                   QPPPMIPQQQREGPEGCNLLIYHLPQEFGDAELMQMFLPFGNVISSKVFVDRATNQSKC
FT                   FGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPKDANRPY"
FT   CDS             complement(join(9404553..9404680,9408743..9408886,
FT                   9413884..9413964,9415127..9415192,9418865..9419014,
FT                   9420597..9420744,9421803..9421946,9422153..9422232,
FT                   9422556..9422681,9455212..9455290,9597770..9597852,
FT                   9671496..>9671799))
FT                   /codon_start=1
FT                   /gene="Brunol4"
FT                   /locus_tag="mCG_145685"
FT                   /product="bruno-like 4, RNA binding protein (Drosophila),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG145685.1 transcript_id=mCT188853.0
FT                   protein_id=mCP109868.0 isoform=CRA_c"
FT                   /protein_id="EDK97012.1"
FT                   /translation="KERFFSMYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHS
FT                   PGNPSTIPMKDHDAIKLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCA
FT                   FLTYCERESALKAQSALHEQKTLPGMNRPIQVKPADSESRGGSSCLRQPPSHRKLFVGM
FT                   LNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQT
FT                   MPGASSSLVVKFADTDKERTMRRMQQMAGQMGMFNPMAIPFGAYGAYAQALMQQQAALM
FT                   ASVAQGGYLNPMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSP
FT                   IGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQSPTAADPLQQAYAGVQQYAGPAYPAA
FT                   YGQISQAFPQPPPMIPQQQREGPEGCNLLIYHLPQEFGDAELMQMFLPFGNVISSKVFV
FT                   DRATNQSKCFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPKDANRPY"
FT   CDS             complement(join(9404553..9404680,9413884..9413964,
FT                   9415127..9415192,9418865..9419014,9420597..9420744,
FT                   9421803..9421946,9422153..9422232,9422556..9422684,
FT                   9455212..9455290,9597770..9597852,9671496..>9671799))
FT                   /codon_start=1
FT                   /gene="Brunol4"
FT                   /locus_tag="mCG_145685"
FT                   /product="bruno-like 4, RNA binding protein (Drosophila),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG145685.1 transcript_id=mCT188852.0
FT                   protein_id=mCP109867.0 isoform=CRA_b"
FT                   /protein_id="EDK97011.1"
FT                   /translation="KERFFSMYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHS
FT                   PGNPSTIPMKDHDAIKLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCA
FT                   FLTYCERESALKAQSALHEQKTLPGMNRPIQVKPADSESRGGSSCLRQPPSQDRKLFVG
FT                   MLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQ
FT                   TMPGASSSLVVKFADTDKERTMRRMQQMAGQMGMFNPMAIPFGAYGAYAQALMQQQAAL
FT                   MASVAQGGYLNPMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPS
FT                   PIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQSPTAADPLQQAYAGVQQYAGPAYPA
FT                   AYGQISQAFPQPPPMIPQQQREGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPKD
FT                   ANRPY"
FT   CDS             complement(join(9404553..9404680,9408803..9408886,
FT                   9413884..9413964,9415127..9415192,9418865..9419014,
FT                   9420597..9420744,9421803..9421946,9422153..9422232,
FT                   9422556..9422684,9455212..9455290,9597770..9597852,
FT                   9671496..>9671799))
FT                   /codon_start=1
FT                   /gene="Brunol4"
FT                   /locus_tag="mCG_145685"
FT                   /product="bruno-like 4, RNA binding protein (Drosophila),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG145685.1 transcript_id=mCT188854.0
FT                   protein_id=mCP109869.0 isoform=CRA_d"
FT                   /protein_id="EDK97013.1"
FT                   /translation="KERFFSMYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHS
FT                   PGNPSTIPMKDHDAIKLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCA
FT                   FLTYCERESALKAQSALHEQKTLPGMNRPIQVKPADSESRGGSSCLRQPPSQDRKLFVG
FT                   MLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQ
FT                   TMPGASSSLVVKFADTDKERTMRRMQQMAGQMGMFNPMAIPFGAYGAYAQALMQQQAAL
FT                   MASVAQGGYLNPMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPS
FT                   PIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQSPTAADPLQQAYAGVQQYAGPAYPA
FT                   AYGQISQAFPQPPPMIPQQQREGPEGCNLLIYHLPQEFGDAELMQMFLPFGFVSFDNPA
FT                   SAQTAIQAMNGFQIGMKRLKVQLKRPKDANRPY"
FT   CDS             complement(join(9404553..9404680,9408803..9408886,
FT                   9413884..9413967,9415127..9415192,9418865..9419014,
FT                   9420597..9420744,9421803..9421946,9422153..9422232,
FT                   9422556..9422681,9455212..9455290,9597770..9597852,
FT                   9671496..9671781))
FT                   /codon_start=1
FT                   /gene="Brunol4"
FT                   /locus_tag="mCG_145685"
FT                   /product="bruno-like 4, RNA binding protein (Drosophila),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG145685.1 transcript_id=mCT185113.0
FT                   protein_id=mCP106371.0 isoform=CRA_a"
FT                   /protein_id="EDK97010.1"
FT                   /translation="MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPST
FT                   IPMKDHDAIKLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCE
FT                   RESALKAQSALHEQKTLPGMNRPIQVKPADSESRGGSSCLRQPPSHRKLFVGMLNKQQS
FT                   EDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQTMPGASS
FT                   SLVVKFADTDKERTMRRMQQMAGQMGMFNPMAIPFGAYGAYAQALMQQQAALMASVAQG
FT                   GYLNPMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPIGVNGF
FT                   TGLPPQANGQPAAEAVFANGIHPYPAQSPTAADPLQQAYAGVQQYAGPAAYPAAYGQIS
FT                   QAFPQPPPMIPQQQREGPEGCNLLIYHLPQEFGDAELMQMFLPFGFVSFDNPASAQTAI
FT                   QAMNGFQIGMKRLKVQLKRPKDANRPY"
FT   gap             9404760..9404779
FT                   /estimated_length=20
FT   gap             9428828..9428919
FT                   /estimated_length=92
FT   gap             9451115..9451467
FT                   /estimated_length=353
FT   gap             9455378..9455397
FT                   /estimated_length=20
FT   gap             9458327..9458346
FT                   /estimated_length=20
FT   gap             9463728..9463929
FT                   /estimated_length=202
FT   gap             9480905..9481605
FT                   /estimated_length=701
FT   gap             9488595..9488614
FT                   /estimated_length=20
FT   gap             9499835..9500770
FT                   /estimated_length=936
FT   gap             9508208..9508227
FT                   /estimated_length=20
FT   gap             9508934..9509114
FT                   /estimated_length=181
FT   gap             9558896..9558915
FT                   /estimated_length=20
FT   gap             9568343..9568362
FT                   /estimated_length=20
FT   gap             9575108..9580081
FT                   /estimated_length=4974
FT   gene            9632124..9637504
FT                   /locus_tag="mCG_146825"
FT                   /note="gene_id=mCG146825.0"
FT   mRNA            join(9632124..9632310,9636345..9637504)
FT                   /locus_tag="mCG_146825"
FT                   /product="mCG146825"
FT                   /note="gene_id=mCG146825.0 transcript_id=mCT187088.0
FT                   created on 13-JAN-2004"
FT   CDS             9637059..9637178
FT                   /codon_start=1
FT                   /locus_tag="mCG_146825"
FT                   /product="mCG146825"
FT                   /note="gene_id=mCG146825.0 transcript_id=mCT187088.0
FT                   protein_id=mCP108180.0"
FT                   /protein_id="EDK97015.1"
FT                   /translation="MMTFISDCSEVLLKISRYAPPPIPIPSGWGNLWILAHSQ"
FT   gap             9672100..9672360
FT                   /estimated_length=261
FT   gap             9673935..9673954
FT                   /estimated_length=20
FT   gap             9695885..9695904
FT                   /estimated_length=20
FT   gap             9702870..9706021
FT                   /estimated_length=3152
FT   gap             9711333..9711892
FT                   /estimated_length=560
FT   gap             9717668..9717755
FT                   /estimated_length=88
FT   gap             9735062..9735090
FT                   /estimated_length=29
FT   gene            complement(9740562..9741452)
FT                   /pseudo
FT                   /locus_tag="mCG_121623"
FT                   /note="gene_id=mCG121623.1"
FT   mRNA            complement(9740562..9741452)
FT                   /pseudo
FT                   /locus_tag="mCG_121623"
FT                   /note="gene_id=mCG121623.1 transcript_id=mCT122830.1
FT                   created on 31-MAY-2002"
FT   gap             9746989..9747008
FT                   /estimated_length=20
FT   gap             9770149..9770168
FT                   /estimated_length=20
FT   gap             9779929..9780213
FT                   /estimated_length=285
FT   gap             9823224..9823339
FT                   /estimated_length=116
FT   gap             9838823..9839116
FT                   /estimated_length=294
FT   gap             9841915..9841934
FT                   /estimated_length=20
FT   gap             9866595..9866676
FT                   /estimated_length=82
FT   gap             9905830..9905859
FT                   /estimated_length=30
FT   gap             9922876..9923445
FT                   /estimated_length=570
FT   gene            <9923828..9987587
FT                   /locus_tag="mCG_144791"
FT                   /note="gene_id=mCG144791.0"
FT   mRNA            join(<9923828..9923979,9938770..9938984,9980216..9980491,
FT                   9987186..9987587)
FT                   /locus_tag="mCG_144791"
FT                   /product="mCG144791"
FT                   /note="gene_id=mCG144791.0 transcript_id=mCT184215.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<9923831..9923979,9938770..9938779)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144791"
FT                   /product="mCG144791"
FT                   /note="gene_id=mCG144791.0 transcript_id=mCT184215.0
FT                   protein_id=mCP105286.0"
FT                   /protein_id="EDK97016.1"
FT                   /translation="VGLGPLGGRAVSRPMHQMKDPRRETLPQTLKSRDSRVPKKTLRPY
FT                   IKCRRPK"
FT   gap             9966988..9967007
FT                   /estimated_length=20
FT   gap             9983946..9983965
FT                   /estimated_length=20
FT   gap             9996181..9996200
FT                   /estimated_length=20
FT   gap             9997509..9997528
FT                   /estimated_length=20
FT   gap             10069681..10069700
FT                   /estimated_length=20
FT   gap             10140307..10141317
FT                   /estimated_length=1011
FT   gap             10147232..10147353
FT                   /estimated_length=122
FT   gap             10166801..10166845
FT                   /estimated_length=45
FT   gap             10179429..10179448
FT                   /estimated_length=20
FT   gap             10202549..10202568
FT                   /estimated_length=20
FT   gap             10227620..10227716
FT                   /estimated_length=97
FT   gap             10307796..10307815
FT                   /estimated_length=20
FT   gap             10365722..10365815
FT                   /estimated_length=94
FT   gap             10435152..10435171
FT                   /estimated_length=20
FT   gap             10463530..10463699
FT                   /estimated_length=170
FT   gap             10465576..10465799
FT                   /estimated_length=224
FT   gap             10476322..10478087
FT                   /estimated_length=1766
FT   gap             10498349..10498544
FT                   /estimated_length=196
FT   gap             10521862..10521881
FT                   /estimated_length=20
FT   gap             10544417..10544451
FT                   /estimated_length=35
FT   gap             10573269..10573341
FT                   /estimated_length=73
FT   gap             10600643..10600662
FT                   /estimated_length=20
FT   gap             10604287..10604306
FT                   /estimated_length=20
FT   gap             10611595..10612416
FT                   /estimated_length=822
FT   gap             10635305..10635576
FT                   /estimated_length=272
FT   gap             10665793..10665812
FT                   /estimated_length=20
FT   gap             10682375..10683026
FT                   /estimated_length=652
FT   gap             10735508..10735527
FT                   /estimated_length=20
FT   gap             10747057..10747076
FT                   /estimated_length=20
FT   gap             10750654..10750673
FT                   /estimated_length=20
FT   gap             10816744..10816763
FT                   /estimated_length=20
FT   gap             10830617..10830636
FT                   /estimated_length=20
FT   gap             10864951..10865031
FT                   /estimated_length=81
FT   gap             10915818..10918388
FT                   /estimated_length=2571
FT   gap             10929257..10929276
FT                   /estimated_length=20
FT   gap             10956740..10956936
FT                   /estimated_length=197
FT   gap             10977757..10981406
FT                   /estimated_length=3650
FT   gap             10998230..10998249
FT                   /estimated_length=20
FT   gap             11006503..11006522
FT                   /estimated_length=20
FT   gap             11017171..11017190
FT                   /estimated_length=20
FT   gap             11024115..11024152
FT                   /estimated_length=38
FT   gap             11059671..11059690
FT                   /estimated_length=20
FT   gap             11094517..11096488
FT                   /estimated_length=1972
FT   gap             11114755..11114950
FT                   /estimated_length=196
FT   gap             11121490..11121661
FT                   /estimated_length=172
FT   gap             11143549..11143568
FT                   /estimated_length=20
FT   gap             11148192..11148211
FT                   /estimated_length=20
FT   gap             11191277..11191296
FT                   /estimated_length=20
FT   gap             11239490..11239509
FT                   /estimated_length=20
FT   gap             11243345..11243444
FT                   /estimated_length=100
FT   gap             11251967..11252150
FT                   /estimated_length=184
FT   gap             11291793..11292658
FT                   /estimated_length=866
FT   gap             11420272..11420291
FT                   /estimated_length=20
FT   gap             11429262..11429281
FT                   /estimated_length=20
FT   gap             11492598..11492772
FT                   /estimated_length=175
FT   gap             11495421..11495440
FT                   /estimated_length=20
FT   gap             11501917..11501936
FT                   /estimated_length=20
FT   gene            11510702..11512543
FT                   /pseudo
FT                   /locus_tag="mCG_119613"
FT                   /note="gene_id=mCG119613.1"
FT   mRNA            join(11510702..11511475,11511630..11512543)
FT                   /pseudo
FT                   /locus_tag="mCG_119613"
FT                   /note="gene_id=mCG119613.1 transcript_id=mCT120788.0
FT                   created on 31-MAY-2002"
FT   gap             11515451..11515685
FT                   /estimated_length=235
FT   gap             11643479..11643622
FT                   /estimated_length=144
FT   gap             11669879..11669898
FT                   /estimated_length=20
FT   gap             11696027..11698605
FT                   /estimated_length=2579
FT   gap             11703097..11703193
FT                   /estimated_length=97
FT   gap             11776917..11776936
FT                   /estimated_length=20
FT   gap             11799990..11800009
FT                   /estimated_length=20
FT   gap             11823015..11823034
FT                   /estimated_length=20
FT   gap             11863678..11863697
FT                   /estimated_length=20
FT   gap             11904220..11904239
FT                   /estimated_length=20
FT   gap             11924490..11925864
FT                   /estimated_length=1375
FT   gap             11944698..11944727
FT                   /estimated_length=30
FT   gap             11953333..11953352
FT                   /estimated_length=20
FT   gap             11994233..11994259
FT                   /estimated_length=27
FT   gap             12004556..12004575
FT                   /estimated_length=20
FT   gene            complement(12101846..12103427)
FT                   /pseudo
FT                   /locus_tag="mCG_119614"
FT                   /note="gene_id=mCG119614.1"
FT   mRNA            complement(12101846..12103427)
FT                   /pseudo
FT                   /locus_tag="mCG_119614"
FT                   /note="gene_id=mCG119614.1 transcript_id=mCT120789.1
FT                   created on 31-MAY-2002"
FT   gap             12169931..12169977
FT                   /estimated_length=47
FT   gap             12172189..12172669
FT                   /estimated_length=481
FT   gap             12182448..12182467
FT                   /estimated_length=20
FT   gap             12191286..12191305
FT                   /estimated_length=20
FT   gap             12198757..12198776
FT                   /estimated_length=20
FT   gap             12223894..12224130
FT                   /estimated_length=237
FT   gap             12225547..12225722
FT                   /estimated_length=176
FT   gap             12230761..12230780
FT                   /estimated_length=20
FT   gap             12235824..12235843
FT                   /estimated_length=20
FT   gap             12257567..12257586
FT                   /estimated_length=20
FT   gap             12258758..12258777
FT                   /estimated_length=20
FT   gap             12263477..12263496
FT                   /estimated_length=20
FT   gap             12264509..12265188
FT                   /estimated_length=680
FT   gap             12279145..12279164
FT                   /estimated_length=20
FT   gap             12299484..12299503
FT                   /estimated_length=20
FT   gap             12322314..12322333
FT                   /estimated_length=20
FT   gap             12323813..12323836
FT                   /estimated_length=24
FT   gap             12356910..12357044
FT                   /estimated_length=135
FT   gap             12388723..12388751
FT                   /estimated_length=29
FT   gap             12393215..12393601
FT                   /estimated_length=387
FT   gap             12407148..12407544
FT                   /estimated_length=397
FT   gap             12413250..12413269
FT                   /estimated_length=20
FT   gap             12443012..12443076
FT                   /estimated_length=65
FT   gap             12457343..12457515
FT                   /estimated_length=173
FT   gap             12464460..12464479
FT                   /estimated_length=20
FT   gap             12479377..12479502
FT                   /estimated_length=126
FT   gap             12498204..12498223
FT                   /estimated_length=20
FT   gap             12499452..12499471
FT                   /estimated_length=20
FT   gap             12500582..12500601
FT                   /estimated_length=20
FT   gap             12513472..12513491
FT                   /estimated_length=20
FT   gap             12519219..12523720
FT                   /estimated_length=4502
FT   gap             12526056..12526299
FT                   /estimated_length=244
FT   gap             12531246..12535338
FT                   /estimated_length=4093
FT   gap             12536537..12536556
FT                   /estimated_length=20
FT   gap             12588248..12588267
FT                   /estimated_length=20
FT   gap             12595162..12595385
FT                   /estimated_length=224
FT   gene            12618471..12633365
FT                   /locus_tag="mCG_146817"
FT                   /note="gene_id=mCG146817.0"
FT   mRNA            join(12618471..12618613,12631772..12633365)
FT                   /locus_tag="mCG_146817"
FT                   /product="mCG146817"
FT                   /note="gene_id=mCG146817.0 transcript_id=mCT187080.0
FT                   created on 13-JAN-2004"
FT   CDS             join(12618604..12618613,12631772..12631986)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146817"
FT                   /product="mCG146817"
FT                   /note="gene_id=mCG146817.0 transcript_id=mCT187080.0
FT                   protein_id=mCP108173.0"
FT                   /protein_id="EDK97017.1"
FT                   /translation="MMSGKELFTSSIQNESFQLQLAANSSLTVNQQLELFVTVAATEAF
FT                   QATRQKPGETERELVHLKGTIATQQLILG"
FT   gap             12629823..12629885
FT                   /estimated_length=63
FT   gap             12652847..12652866
FT                   /estimated_length=20
FT   gap             12655022..12656717
FT                   /estimated_length=1696
FT   gap             12668446..12668465
FT                   /estimated_length=20
FT   gap             12697561..12697615
FT                   /estimated_length=55
FT   gap             12719873..12723690
FT                   /estimated_length=3818
FT   gene            <12778241..12843962
FT                   /locus_tag="mCG_145683"
FT                   /note="gene_id=mCG145683.0"
FT   mRNA            join(<12778241..12778291,12785964..12786121,
FT                   12788947..12789066,12791157..12791208,12794010..12794118,
FT                   12830027..12830100,12843898..12843962)
FT                   /locus_tag="mCG_145683"
FT                   /product="mCG145683"
FT                   /note="gene_id=mCG145683.0 transcript_id=mCT185110.0
FT                   created on 06-JUN-2003"
FT   CDS             join(<12794074..12794118,12830027..12830100,
FT                   12843898..12843937)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145683"
FT                   /product="mCG145683"
FT                   /note="gene_id=mCG145683.0 transcript_id=mCT185110.0
FT                   protein_id=mCP106368.0"
FT                   /protein_id="EDK97018.1"
FT                   /translation="VAYFYVSMNMSPWSEVIFKAPLLYRLTDFVHIAVVHSFYRLTENN
FT                   CCHKKDD"
FT   gap             12828535..12828748
FT                   /estimated_length=214
FT   gap             12867638..12867657
FT                   /estimated_length=20
FT   gap             12868811..12868830
FT                   /estimated_length=20
FT   gap             12870207..12870226
FT                   /estimated_length=20
FT   gap             12880157..12880432
FT                   /estimated_length=276
FT   gap             12918931..12924455
FT                   /estimated_length=5525
FT   gap             12940677..12940934
FT                   /estimated_length=258
FT   gap             12946244..12947076
FT                   /estimated_length=833
FT   gap             12976022..12976087
FT                   /estimated_length=66
FT   gap             12993573..12993592
FT                   /estimated_length=20
FT   gap             13012782..13012801
FT                   /estimated_length=20
FT   gap             13032859..13032878
FT                   /estimated_length=20
FT   gap             13096187..13105950
FT                   /estimated_length=9764
FT   gap             13124806..13125057
FT                   /estimated_length=252
FT   gap             13204291..13204310
FT                   /estimated_length=20
FT   gap             13213544..13213563
FT                   /estimated_length=20
FT   gap             13228628..13228887
FT                   /estimated_length=260
FT   gap             13253918..13254058
FT                   /estimated_length=141
FT   gap             13263876..13263947
FT                   /estimated_length=72
FT   gap             13270911..13271263
FT                   /estimated_length=353
FT   gap             13316695..13316714
FT                   /estimated_length=20
FT   gene            <13345119..13369027
FT                   /locus_tag="mCG_145684"
FT                   /note="gene_id=mCG145684.0"
FT   mRNA            join(<13345119..13345241,13350685..13350796,
FT                   13354959..13355184,13368907..13369027)
FT                   /locus_tag="mCG_145684"
FT                   /product="mCG145684"
FT                   /note="gene_id=mCG145684.0 transcript_id=mCT185111.0
FT                   created on 06-JUN-2003"
FT   CDS             join(<13350733..13350796,13354959..13355119)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145684"
FT                   /product="mCG145684"
FT                   /note="gene_id=mCG145684.0 transcript_id=mCT185111.0
FT                   protein_id=mCP106369.0"
FT                   /protein_id="EDK97019.1"
FT                   /translation="PNTAWKEVVYVSLLCIMRRNQGQELSKNVPSEPSRNYEKCYVGHA
FT                   NQVLNSESGAWSLESTKNALSVPIHELQR"
FT   gene            complement(13350745..>13399292)
FT                   /locus_tag="mCG_119571"
FT                   /note="gene_id=mCG119571.1"
FT   mRNA            complement(join(13350745..13350803,13354646..13354852,
FT                   13399211..>13399292))
FT                   /locus_tag="mCG_119571"
FT                   /product="mCG119571"
FT                   /note="gene_id=mCG119571.1 transcript_id=mCT120746.1
FT                   created on 31-MAY-2002"
FT   CDS             complement(join(13350769..13350803,13354646..13354852,
FT                   13399211..>13399292))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119571"
FT                   /product="mCG119571"
FT                   /note="gene_id=mCG119571.1 transcript_id=mCT120746.1
FT                   protein_id=mCP69188.0"
FT                   /protein_id="EDK97020.1"
FT                   /translation="QVSASVRFGFDVCTQDGSPGVTQIYSAGINWKLQVPAKPVLEETQ
FT                   SLWTHKRMYSTSQLTDLTVKDSWVAFQSIEMTLEHLCSQPCPYPLLKPLFQSPTLVSSH
FT                   DAQ"
FT   gap             13378650..13378784
FT                   /estimated_length=135
FT   gap             13399334..13399353
FT                   /estimated_length=20
FT   gap             13401107..13401279
FT                   /estimated_length=173
FT   gap             13439820..13439928
FT                   /estimated_length=109
FT   gap             13458844..13458863
FT                   /estimated_length=20
FT   gap             13477759..13477826
FT                   /estimated_length=68
FT   gap             13509935..13510020
FT                   /estimated_length=86
FT   gap             13533438..13533785
FT                   /estimated_length=348
FT   gap             13552882..13553011
FT                   /estimated_length=130
FT   gene            complement(13560032..13560785)
FT                   /pseudo
FT                   /locus_tag="mCG_124383"
FT                   /note="gene_id=mCG124383.1"
FT   mRNA            complement(13560032..13560785)
FT                   /pseudo
FT                   /locus_tag="mCG_124383"
FT                   /note="gene_id=mCG124383.1 transcript_id=mCT125624.1
FT                   created on 31-MAY-2002"
FT   gap             13560805..13561689
FT                   /estimated_length=885
FT   gap             13593620..13593639
FT                   /estimated_length=20
FT   gap             13615593..13620138
FT                   /estimated_length=4546
FT   gap             13686171..13686190
FT                   /estimated_length=20
FT   gap             13692034..13692142
FT                   /estimated_length=109
FT   gap             13746366..13747127
FT                   /estimated_length=762
FT   gap             13759997..13760016
FT                   /estimated_length=20
FT   gap             13764171..13764190
FT                   /estimated_length=20
FT   gap             13772656..13772675
FT                   /estimated_length=20
FT   gap             13773849..13773868
FT                   /estimated_length=20
FT   gap             13778620..13779056
FT                   /estimated_length=437
FT   gap             13848233..13848252
FT                   /estimated_length=20
FT   gap             13856524..13856738
FT                   /estimated_length=215
FT   gap             13880042..13880061
FT                   /estimated_length=20
FT   gap             13881241..13881426
FT                   /estimated_length=186
FT   gap             13905183..13905299
FT                   /estimated_length=117
FT   gap             13948172..13948448
FT                   /estimated_length=277
FT   gap             13952517..13953060
FT                   /estimated_length=544
FT   gap             13979625..13979778
FT                   /estimated_length=154
FT   gap             14016691..14016759
FT                   /estimated_length=69
FT   gap             14027094..14027113
FT                   /estimated_length=20
FT   gap             14051586..14051605
FT                   /estimated_length=20
FT   gap             14102528..14102558
FT                   /estimated_length=31
FT   gap             14111643..14111662
FT                   /estimated_length=20
FT   gap             14143599..14143618
FT                   /estimated_length=20
FT   gap             14155095..14155114
FT                   /estimated_length=20
FT   gap             14160259..14160289
FT                   /estimated_length=31
FT   gap             14164481..14164540
FT                   /estimated_length=60
FT   gap             14174466..14174573
FT                   /estimated_length=108
FT   gene            14176053..14251396
FT                   /gene="Pik3c3"
FT                   /locus_tag="mCG_124384"
FT                   /note="gene_id=mCG124384.1"
FT   mRNA            join(14176053..14176327,14177578..14177766,
FT                   14180281..14180424,14185266..14185395,14192085..14192171,
FT                   14193805..14193900,14196393..14196464,14196953..14197057,
FT                   14197670..14197762,14201907..14202092,14206254..14206408,
FT                   14206900..14206990,14208309..14208376,14214491..14214596,
FT                   14215823..14215939,14220114..14220245,14222772..14222900,
FT                   14223505..14223574,14225441..14225505,14226793..14226877,
FT                   14227815..14227889,14236431..14236599,14239364..14239454,
FT                   14247222..14247347,14250994..14251396)
FT                   /gene="Pik3c3"
FT                   /locus_tag="mCG_124384"
FT                   /product="phosphoinositide-3-kinase, class 3, transcript
FT                   variant mCT125625"
FT                   /note="gene_id=mCG124384.1 transcript_id=mCT125625.1
FT                   created on 31-MAY-2002"
FT   mRNA            join(<14176181..14176327,14177578..14177766,
FT                   14180281..14180424,14185266..14185395,14192085..14192171,
FT                   14193805..14193900,14196393..14196464,14196953..14197057,
FT                   14197670..14197762,14201907..14202092,14206254..14206408,
FT                   14206900..14206990,14208309..14208376,14214491..14214596,
FT                   14215823..14215939,14220114..14220245,14222772..14222900,
FT                   14223505..14223574,14225441..14225505,14226793..14226877,
FT                   14227815..14227889,14236431..14236599,14239364..14239454,
FT                   14245992..14246384)
FT                   /gene="Pik3c3"
FT                   /locus_tag="mCG_124384"
FT                   /product="phosphoinositide-3-kinase, class 3, transcript
FT                   variant mCT188873"
FT                   /note="gene_id=mCG124384.1 transcript_id=mCT188873.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<14176188..14176327,14177578..14177766,
FT                   14180281..14180424,14185266..14185395,14192085..14192171,
FT                   14193805..14193900,14196393..14196464,14196953..14197057,
FT                   14197670..14197762,14201907..14202092,14206254..14206408,
FT                   14206900..14206990,14208309..14208376,14214491..14214596,
FT                   14215823..14215939,14220114..14220245,14222772..14222900,
FT                   14223505..14223574,14225441..14225505,14226793..14226877,
FT                   14227815..14227889,14236431..14236599,14239364..14239454,
FT                   14245992..14246015)
FT                   /codon_start=1
FT                   /gene="Pik3c3"
FT                   /locus_tag="mCG_124384"
FT                   /product="phosphoinositide-3-kinase, class 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG124384.1 transcript_id=mCT188873.0
FT                   protein_id=mCP109847.0 isoform=CRA_b"
FT                   /protein_id="EDK97022.1"
FT                   /translation="CSGGFFLESSSSRAVSVASGLRAVMGEAEKFHYIYSCDLDINVQL
FT                   KIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKA
FT                   FSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGSAVPVGGTTVSLFGKYGMFRQG
FT                   MHDLKVWPNVEADGSEPTRTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTF
FT                   REIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPD
FT                   PQMSMENLVESKHHKLARSLRSGPSDHDLKPNATTRDQLNIIVSYPPTKQLTYEEQDLV
FT                   WKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPT
FT                   VRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQTSASESLSNSG
FT                   VSSGDIDSSQIITNPLPPVASPPPASKAKEVSDGENLEQDLCTFLISRACKNSTLANYL
FT                   YWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRL
FT                   VHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATL
FT                   FKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPY
FT                   KVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSETGPYGISAEVMDTYVKSC
FT                   AGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMG
FT                   GTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKMSCHRK
FT                   I"
FT   mRNA            join(<14176236..14176327,14177578..14177766,
FT                   14180281..14180424,14185266..14185395,14192085..14192171,
FT                   14193805..14193900,14196393..14196464,14196953..14197057,
FT                   14197670..14197762,14201907..14202092,14206254..14206408,
FT                   14206900..14206990,14208309..14208376,14214418..14214596,
FT                   14215823..14215939,14220114..14220245,14222772..14222900,
FT                   14223505..14223574,14225441..14225505,14226793..14226877,
FT                   14227815..14227889,14236431..14236599,14239364..14239454,
FT                   14247222..14247347,14250994..14251390)
FT                   /gene="Pik3c3"
FT                   /locus_tag="mCG_124384"
FT                   /product="phosphoinositide-3-kinase, class 3, transcript
FT                   variant mCT188874"
FT                   /note="gene_id=mCG124384.1 transcript_id=mCT188874.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<14176236..14176327,14177578..14177766,
FT                   14180281..14180424,14185266..14185395,14192085..14192171,
FT                   14193805..14193900,14196393..14196464,14196953..14197057,
FT                   14197670..14197762,14201907..14202092,14206254..14206408,
FT                   14206900..14206990,14208309..14208376,14214418..14214475)
FT                   /codon_start=1
FT                   /gene="Pik3c3"
FT                   /locus_tag="mCG_124384"
FT                   /product="phosphoinositide-3-kinase, class 3, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG124384.1 transcript_id=mCT188874.0
FT                   protein_id=mCP109848.0 isoform=CRA_c"
FT                   /protein_id="EDK97023.1"
FT                   /translation="VASGLRAVMGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKA
FT                   VLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVK
FT                   YPDLPRNAQVALTIWDVYGPGSAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSE
FT                   PTRTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNF
FT                   MYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKL
FT                   ARSLRSGPSDHDLKPNATTRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTK
FT                   FLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDED
FT                   LLMYLLQLVQALKYENFDDIKNGLEPTKKDSQTSASESLSNSGVSSGDIDSSQIITNPL
FT                   PPVASPPPASKAKEVSDGENLEQDLCTFLISRACKNSTLANYLYCSVSTDRMDLSVSSH
FT                   HPSI"
FT   CDS             join(14176260..14176327,14177578..14177766,
FT                   14180281..14180424,14185266..14185395,14192085..14192171,
FT                   14193805..14193900,14196393..14196464,14196953..14197057,
FT                   14197670..14197762,14201907..14202092,14206254..14206408,
FT                   14206900..14206990,14208309..14208376,14214491..14214596,
FT                   14215823..14215939,14220114..14220245,14222772..14222900,
FT                   14223505..14223574,14225441..14225505,14226793..14226877,
FT                   14227815..14227889,14236431..14236599,14239364..14239454,
FT                   14247222..14247347,14250994..14251008)
FT                   /codon_start=1
FT                   /gene="Pik3c3"
FT                   /locus_tag="mCG_124384"
FT                   /product="phosphoinositide-3-kinase, class 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG124384.1 transcript_id=mCT125625.1
FT                   protein_id=mCP69385.1 isoform=CRA_a"
FT                   /protein_id="EDK97021.1"
FT                   /translation="MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLK
FT                   FSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNA
FT                   QVALTIWDVYGPGSAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGRT
FT                   SSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFR
FT                   CVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGP
FT                   SDHDLKPNATTRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWD
FT                   LPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQL
FT                   VQALKYENFDDIKNGLEPTKKDSQTSASESLSNSGVSSGDIDSSQIITNPLPPVASPPP
FT                   ASKAKEVSDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMY
FT                   LNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQAL
FT                   LGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIF
FT                   KHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVL
FT                   DTEGSIQNFFRKYAPSETGPYGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTK
FT                   TGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRY
FT                   SNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALF
FT                   AAVVEQIHKFAQYWRK"
FT   gap             14187144..14187558
FT                   /estimated_length=415
FT   gap             14212639..14212658
FT                   /estimated_length=20
FT   gap             14255330..14255349
FT                   /estimated_length=20
FT   gap             14262030..14262158
FT                   /estimated_length=129
FT   gap             14295641..14295795
FT                   /estimated_length=155
FT   gap             14296562..14296860
FT                   /estimated_length=299
FT   gap             14299726..14302396
FT                   /estimated_length=2671
FT   gap             14307082..14307117
FT                   /estimated_length=36
FT   gene            complement(14324783..14325229)
FT                   /pseudo
FT                   /locus_tag="mCG_1031576"
FT                   /note="gene_id=mCG1031576.1"
FT   mRNA            complement(14324783..14325229)
FT                   /pseudo
FT                   /locus_tag="mCG_1031576"
FT                   /note="gene_id=mCG1031576.1 transcript_id=mCT149280.1
FT                   created on 31-MAY-2002"
FT   gene            complement(14364249..14364966)
FT                   /locus_tag="mCG_124381"
FT                   /note="gene_id=mCG124381.1"
FT   mRNA            complement(14364249..14364966)
FT                   /locus_tag="mCG_124381"
FT                   /product="mCG124381"
FT                   /note="gene_id=mCG124381.1 transcript_id=mCT125622.1
FT                   created on 31-MAY-2002"
FT   CDS             complement(14364367..14364891)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124381"
FT                   /product="mCG124381"
FT                   /note="gene_id=mCG124381.1 transcript_id=mCT125622.1
FT                   protein_id=mCP69372.1"
FT                   /protein_id="EDK97024.1"
FT                   /translation="MLFSLPVPGAAGATGYRADMKHTTHNQSCKWHRNGIKKPRSQRYE
FT                   SLKGVDPKFLRNMRFAEKHKKALKKMQANNAKAVSARAEAIKALVKPQAIKPKMPKGPK
FT                   LKWLAFIARPKLGKRIRSYMAKGQRFCQLKPKVQTKAGAKAPAKAQASAPAQAPKGAQA
FT                   PKGAQAPVKAP"
FT   gene            complement(<14400185..14400629)
FT                   /locus_tag="mCG_124382"
FT                   /note="gene_id=mCG124382.1"
FT   mRNA            complement(<14400185..14400629)
FT                   /locus_tag="mCG_124382"
FT                   /product="mCG124382"
FT                   /note="gene_id=mCG124382.1 transcript_id=mCT125623.0
FT                   created on 31-MAY-2002"
FT   CDS             complement(14400185..14400559)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124382"
FT                   /product="mCG124382"
FT                   /note="gene_id=mCG124382.1 transcript_id=mCT125623.0
FT                   protein_id=mCP69381.1"
FT                   /protein_id="EDK97025.1"
FT                   /translation="MLSRLLKEHQAKQNERKELQEKRREAIAAATCLTEALVDHLNVGV
FT                   AQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENLARSIKLDM
FT                   CTIATALEYVYKGQLQSAPS"
FT   gap             14402171..14402245
FT                   /estimated_length=75
FT   gap             14417420..14417718
FT                   /estimated_length=299
FT   gap             14430274..14430293
FT                   /estimated_length=20
FT   gap             14431508..14432593
FT                   /estimated_length=1086
FT   gap             14455124..14455144
FT                   /estimated_length=21
FT   gap             14469281..14475684
FT                   /estimated_length=6404
FT   gap             14478518..14478537
FT                   /estimated_length=20
FT   gap             14492372..14492391
FT                   /estimated_length=20
FT   gap             14493796..14493815
FT                   /estimated_length=20
FT   gap             14495226..14495245
FT                   /estimated_length=20
FT   gap             14496829..14496848
FT                   /estimated_length=20
FT   gap             14504220..14504239
FT                   /estimated_length=20
FT   gene            complement(14512593..14513160)
FT                   /pseudo
FT                   /locus_tag="mCG_119617"
FT                   /note="gene_id=mCG119617.1"
FT   mRNA            complement(14512593..14513160)
FT                   /pseudo
FT                   /locus_tag="mCG_119617"
FT                   /note="gene_id=mCG119617.1 transcript_id=mCT120792.0
FT                   created on 31-MAY-2002"
FT   gap             14569651..14569670
FT                   /estimated_length=20
FT   gap             14571064..14571083
FT                   /estimated_length=20
FT   gap             14591735..14591754
FT                   /estimated_length=20
FT   gap             14593238..14594001
FT                   /estimated_length=764
FT   gap             14595509..14595528
FT                   /estimated_length=20
FT   gap             14600702..14600810
FT                   /estimated_length=109
FT   gap             14615141..14615720
FT                   /estimated_length=580
FT   gap             14624493..14624512
FT                   /estimated_length=20
FT   gap             14625565..14627049
FT                   /estimated_length=1485
FT   gap             14634972..14634991
FT                   /estimated_length=20
FT   gap             14636223..14636242
FT                   /estimated_length=20
FT   gap             14646395..14646750
FT                   /estimated_length=356
FT   gap             14655805..14660276
FT                   /estimated_length=4472
FT   gap             14662215..14662406
FT                   /estimated_length=192
FT   gap             14685203..14685355
FT                   /estimated_length=153
FT   gap             14707609..14708035
FT                   /estimated_length=427
FT   gap             14709172..14709274
FT                   /estimated_length=103
FT   gap             14718696..14723504
FT                   /estimated_length=4809
FT   gap             14735524..14735568
FT                   /estimated_length=45
FT   gap             14757119..14757584
FT                   /estimated_length=466
FT   gap             14759645..14759666
FT                   /estimated_length=22
FT   gap             14787671..14787690
FT                   /estimated_length=20
FT   gap             14810882..14810901
FT                   /estimated_length=20
FT   gap             14849496..14849938
FT                   /estimated_length=443
FT   gap             14879191..14879322
FT                   /estimated_length=132
FT   gene            complement(14889336..>15234888)
FT                   /gene="Rit2"
FT                   /locus_tag="mCG_141326"
FT                   /note="gene_id=mCG141326.1"
FT   mRNA            complement(join(14889336..14891351,15069324..15069515,
FT                   15160316..15160372,15234437..>15234888))
FT                   /gene="Rit2"
FT                   /locus_tag="mCG_141326"
FT                   /product="Ras-like without CAAX 2, transcript variant
FT                   mCT188850"
FT                   /note="gene_id=mCG141326.1 transcript_id=mCT188850.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(14890162..14891351,15069324..15069515,
FT                   15129857..15129930,15160316..15160372,15234437..15234722))
FT                   /gene="Rit2"
FT                   /locus_tag="mCG_141326"
FT                   /product="Ras-like without CAAX 2, transcript variant
FT                   mCT174622"
FT                   /note="gene_id=mCG141326.1 transcript_id=mCT174622.0
FT                   created on 15-OCT-2002"
FT   CDS             complement(join(14891124..14891351,15069324..15069515,
FT                   15129857..15129930,15160316..15160372,15234437..15234539))
FT                   /codon_start=1
FT                   /gene="Rit2"
FT                   /locus_tag="mCG_141326"
FT                   /product="Ras-like without CAAX 2, isoform CRA_a"
FT                   /note="gene_id=mCG141326.1 transcript_id=mCT174622.0
FT                   protein_id=mCP97541.0 isoform=CRA_a"
FT                   /protein_id="EDK97026.1"
FT                   /translation="MEVENEAHCCPGSSSGGSREYKVVMLGAGGVGKSAVTMQFISHQF
FT                   PDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDR
FT                   QSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGMNLARDYNCAFFETS
FT                   AALRFGIDDAFQGLVREIRRKESMLSLVERKLKRKDSLWKKIKASLKKKRENML"
FT   CDS             complement(join(14891124..14891351,15069324..15069515,
FT                   15160316..>15160351))
FT                   /codon_start=1
FT                   /gene="Rit2"
FT                   /locus_tag="mCG_141326"
FT                   /product="Ras-like without CAAX 2, isoform CRA_b"
FT                   /note="gene_id=mCG141326.1 transcript_id=mCT188850.0
FT                   protein_id=mCP109866.0 isoform=CRA_b"
FT                   /protein_id="EDK97027.1"
FT                   /translation="ATSSRTITTPQSAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAA
FT                   KFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGMNLARDYNCAFFETSAALRFGI
FT                   DDAFQGLVREIRRKESMLSLVERKLKRKDSLWKKIKASLKKKRENML"
FT   gap             14901753..14901772
FT                   /estimated_length=20
FT   gap             14902821..14903397
FT                   /estimated_length=577
FT   gap             14914576..14914859
FT                   /estimated_length=284
FT   gap             14924151..14924170
FT                   /estimated_length=20
FT   gap             14958261..14959403
FT                   /estimated_length=1143
FT   gap             14977365..14977384
FT                   /estimated_length=20
FT   gap             14988873..14989097
FT                   /estimated_length=225
FT   gap             14997031..14997387
FT                   /estimated_length=357
FT   gap             15013973..15014708
FT                   /estimated_length=736
FT   gap             15021313..15021598
FT                   /estimated_length=286
FT   gap             15028908..15028927
FT                   /estimated_length=20
FT   gap             15035576..15035595
FT                   /estimated_length=20
FT   gap             15091047..15091066
FT                   /estimated_length=20
FT   gap             15092219..15092238
FT                   /estimated_length=20
FT   gap             15111174..15111193
FT                   /estimated_length=20
FT   gap             15116239..15116258
FT                   /estimated_length=20
FT   gap             15164865..15164884
FT                   /estimated_length=20
FT   gap             15202320..15203480
FT                   /estimated_length=1161
FT   gap             15260103..15260122
FT                   /estimated_length=20
FT   gene            complement(15266829..15268039)
FT                   /pseudo
FT                   /locus_tag="mCG_1031577"
FT                   /note="gene_id=mCG1031577.1"
FT   mRNA            complement(join(15266829..15267234,15267595..15268039))
FT                   /pseudo
FT                   /locus_tag="mCG_1031577"
FT                   /note="gene_id=mCG1031577.1 transcript_id=mCT149281.1
FT                   created on 19-DEC-2002"
FT   gap             15272037..15277804
FT                   /estimated_length=5768
FT   gap             15288551..15291619
FT                   /estimated_length=3069
FT   gap             15302151..15302435
FT                   /estimated_length=285
FT   gap             15323159..15323221
FT                   /estimated_length=63
FT   gap             15333150..15333176
FT                   /estimated_length=27
FT   gap             15344337..15344356
FT                   /estimated_length=20
FT   gap             15351384..15351403
FT                   /estimated_length=20
FT   gene            complement(15356728..15364833)
FT                   /gene="Syt4"
FT                   /locus_tag="mCG_119616"
FT                   /note="gene_id=mCG119616.1"
FT   mRNA            complement(join(15356728..15358032,15359135..15359255,
FT                   15360993..15361807,15364757..15364833))
FT                   /gene="Syt4"
FT                   /locus_tag="mCG_119616"
FT                   /product="synaptotagmin IV"
FT                   /note="gene_id=mCG119616.1 transcript_id=mCT120791.0
FT                   created on 15-OCT-2002"
FT   CDS             complement(join(15357725..15358032,15359135..15359255,
FT                   15360993..15361807,15364757..15364790))
FT                   /codon_start=1
FT                   /gene="Syt4"
FT                   /locus_tag="mCG_119616"
FT                   /product="synaptotagmin IV"
FT                   /note="gene_id=mCG119616.1 transcript_id=mCT120791.0
FT                   protein_id=mCP69125.1"
FT                   /protein_id="EDK97028.1"
FT                   /translation="MAPITTSRVEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRRSAKS
FT                   NKTPPYKFVHVLKGVDIYPENLSSKKKFGGDDKSEVKGKAALPNLSLHLDLEKRDLNGN
FT                   FPKANPKAGSSSDLENVTPKLFTETEKEANSPESLKSSTSLTSEEKQEKLGTLFLSLEY
FT                   NFEKKAFVVNIKEAQGLPAMDEQSMTSDPYIKMTILPEKKHRVKTRVLRKTLDPVFDET
FT                   FTFYGIPYPHIQELSLHFTVLSFDRFSRDDVIGEVLIPLSGIELSDGKMLMTREIIKRN
FT                   AKKSSGRGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISK
FT                   KKTHVKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEG
FT                   SGGGHWKEICDFPRRQIAKWHMLCDG"
FT   gene            <15357859..15366722
FT                   /locus_tag="mCG_145819"
FT                   /note="gene_id=mCG145819.0"
FT   mRNA            join(<15357859..15357970,15361062..15361243,
FT                   15364516..15366722)
FT                   /locus_tag="mCG_145819"
FT                   /product="mCG145819"
FT                   /note="gene_id=mCG145819.0 transcript_id=mCT185927.0
FT                   created on 03-JUL-2003"
FT   CDS             join(<15357860..15357970,15361062..15361243,
FT                   15364516..15364588)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145819"
FT                   /product="mCG145819"
FT                   /note="gene_id=mCG145819.0 transcript_id=mCT185927.0
FT                   protein_id=mCP107340.0"
FT                   /db_xref="MGI:MGI:3641933"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BRT4"
FT                   /protein_id="EDK97029.1"
FT                   /translation="PFRIQNQEFNTDFFKTLTRNIKDKQFIEHCVGSAFLNRNQDFSND
FT                   IISRKPVKTQNCKVQGELLDVGIRDSIECEGFIKNRVQRLPEHSGLHSVLLLCSGCSLQ
FT                   SRVNIRELLEGEITRQC"
FT   gap             15363300..15363402
FT                   /estimated_length=103
FT   gap             15368210..15368311
FT                   /estimated_length=102
FT   gap             15368985..15369004
FT                   /estimated_length=20
FT   gap             15371394..15371716
FT                   /estimated_length=323
FT   gap             15391103..15391122
FT                   /estimated_length=20
FT   gap             15411419..15411461
FT                   /estimated_length=43
FT   gap             15437527..15437700
FT                   /estimated_length=174
FT   gene            complement(15474265..15528246)
FT                   /gene="1200007B05Rik"
FT                   /locus_tag="mCG_127142"
FT                   /note="gene_id=mCG127142.2"
FT   mRNA            complement(join(15474265..15474439,15474991..15475787,
FT                   15476702..15476774,15512714..15512771,15515176..15515232,
FT                   15518269..15518369,15520860..15520937,15523924..15523981,
FT                   15525567..15525609,15527863..15528246))
FT                   /gene="1200007B05Rik"
FT                   /locus_tag="mCG_127142"
FT                   /product="RIKEN cDNA 1200007B05, transcript variant
FT                   mCT185119"
FT                   /note="gene_id=mCG127142.2 transcript_id=mCT185119.0
FT                   created on 02-JUN-2003"
FT   CDS             complement(join(15476733..15476774,15512714..15512771,
FT                   15515176..15515232,15518269..15518369,15520860..15520937,
FT                   15523924..15523981,15525567..15525609,15527863..15528145))
FT                   /codon_start=1
FT                   /gene="1200007B05Rik"
FT                   /locus_tag="mCG_127142"
FT                   /product="RIKEN cDNA 1200007B05, isoform CRA_a"
FT                   /note="gene_id=mCG127142.2 transcript_id=mCT185119.0
FT                   protein_id=mCP106377.0 isoform=CRA_a"
FT                   /protein_id="EDK97030.1"
FT                   /translation="MHPRRPEGFDGLGYRGGVRDDPAFGGPFHARSFGSGTELGHWVTT
FT                   PPDIPGSRNLHWGEKSPSYGVPSAPPTLEGSAEEPFPGGGEGPRPGPSSEQLNRFAGFG
FT                   IGLASLFTENVLAHPCIVLRRQCQVNYHARHYHLTPFSIINIMYSFNKTQGPRALWKGM
FT                   GSTFIVQGVTLGAEGIISEFTPLPREVSHKLNPKQIGEHLLLKCLTYMVAMPFYSASLI
FT                   ETVQSVYESDYVLISIC"
FT   gap             15480287..15480306
FT                   /estimated_length=20
FT   gap             15495846..15495865
FT                   /estimated_length=20
FT   mRNA            complement(join(15499725..15501902,15512714..15512771,
FT                   15515176..15515232,15518269..15518369,15520860..15520937,
FT                   15523924..15523981,15525567..15525609,15527863..15528240))
FT                   /gene="1200007B05Rik"
FT                   /locus_tag="mCG_127142"
FT                   /product="RIKEN cDNA 1200007B05, transcript variant
FT                   mCT128423"
FT                   /note="gene_id=mCG127142.2 transcript_id=mCT128423.0
FT                   created on 02-JUN-2003"
FT   CDS             complement(join(15501324..15501902,15512714..15512771,
FT                   15515176..15515232,15518269..15518369,15520860..15520937,
FT                   15523924..15523981,15525567..15525609,15527863..15528145))
FT                   /codon_start=1
FT                   /gene="1200007B05Rik"
FT                   /locus_tag="mCG_127142"
FT                   /product="RIKEN cDNA 1200007B05, isoform CRA_b"
FT                   /note="gene_id=mCG127142.2 transcript_id=mCT128423.0
FT                   protein_id=mCP69273.1 isoform=CRA_b"
FT                   /protein_id="EDK97031.1"
FT                   /translation="MHPRRPEGFDGLGYRGGVRDDPAFGGPFHARSFGSGTELGHWVTT
FT                   PPDIPGSRNLHWGEKSPSYGVPSAPPTLEGSAEEPFPGGGEGPRPGPSSEQLNRFAGFG
FT                   IGLASLFTENVLAHPCIVLRRQCQVNYHARHYHLTPFSIINIMYSFNKTQGPRALWKGM
FT                   GSTFIVQGVTLGAEGIISEFTPLPREVSHKLNPKQIGEHLLLKCLTYMVAMPFYSASLI
FT                   ETVQSEIIRDNTGILECVKEGIGRVIGLGVPHSKRLLPLFSLIFPTVLHGVLHYIISSI
FT                   IQKIVLLILKRKTYNSHLAESTSPMQNMLDAYFPELIANFAASLCSDVILYPLETVLHR
FT                   LHIQGTRTIIDNTDLGYEVLPINTQYEGMRDCINTIKQEEGVFGFYKGFGAVIIQYTLH
FT                   ATILQITKMIYSTLLQNSI"
FT   gap             15524702..15524721
FT                   /estimated_length=20
FT   gene            15527847..15529087
FT                   /locus_tag="mCG_146822"
FT                   /note="gene_id=mCG146822.0"
FT   mRNA            15527847..15529087
FT                   /locus_tag="mCG_146822"
FT                   /product="mCG146822"
FT                   /note="gene_id=mCG146822.0 transcript_id=mCT187085.0
FT                   created on 13-JAN-2004"
FT   CDS             15528059..15528238
FT                   /codon_start=1
FT                   /locus_tag="mCG_146822"
FT                   /product="mCG146822"
FT                   /note="gene_id=mCG146822.0 transcript_id=mCT187085.0
FT                   protein_id=mCP108178.0"
FT                   /protein_id="EDK97032.1"
FT                   /translation="MERAAESRIIPNASPVAQAIEALRAPRMHLGQADEDERGRPTEPR
FT                   PPPRPRRSRCASGD"
FT   gap             15538025..15538044
FT                   /estimated_length=20
FT   gap             15547786..15547805
FT                   /estimated_length=20
FT   gene            15552570..15638813
FT                   /gene="Sap130"
FT                   /locus_tag="mCG_127151"
FT                   /note="gene_id=mCG127151.1"
FT   mRNA            join(15552570..15552781,15554274..15554391,
FT                   15565335..15565570,15566428..15566586,15567851..15567962,
FT                   15568797..15568921,15571863..15571987,15585065..15585212,
FT                   15585360..15585450,15585628..15585732,15593073..15593214,
FT                   15596064..15596185,15599082..15599384,15600720..15600897,
FT                   15608121..15608225,15617229..15617587,15630119..15630367,
FT                   15630530..15630655,15634260..15634363,15636380..15636493,
FT                   15637924..15638813)
FT                   /gene="Sap130"
FT                   /locus_tag="mCG_127151"
FT                   /product="Sin3A associated protein, 130kDa, transcript
FT                   variant mCT128432"
FT                   /note="gene_id=mCG127151.1 transcript_id=mCT128432.1
FT                   created on 19-DEC-2002"
FT   mRNA            join(<15552671..15552781,15554274..15554391,
FT                   15565335..15565570,15566428..15566586,15567851..15567962,
FT                   15568797..15568921,15571863..15571987,15585087..15585212,
FT                   15585360..15585450,15585628..15585732,15593073..15593214,
FT                   15596064..15596185,15599082..15599384,15600720..15600897,
FT                   15608121..15608225,15617229..15617587,15630119..15630367,
FT                   15630530..15631935)
FT                   /gene="Sap130"
FT                   /locus_tag="mCG_127151"
FT                   /product="Sin3A associated protein, 130kDa, transcript
FT                   variant mCT188865"
FT                   /note="gene_id=mCG127151.1 transcript_id=mCT188865.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<15552674..15552781,15554274..15554391,
FT                   15565335..15565570,15566428..15566586,15567851..15567962,
FT                   15568797..15568921,15571863..15571987,15585065..15585212,
FT                   15585360..15585450,15585628..15585732,15593073..15593214,
FT                   15596064..15596185,15599082..15599384,15600723..15600897,
FT                   15608121..15608225,15617229..15617587,15630119..15630367,
FT                   15630530..15630655,15634260..15634363,15636380..15636493,
FT                   15637924..15638813)
FT                   /gene="Sap130"
FT                   /locus_tag="mCG_127151"
FT                   /product="Sin3A associated protein, 130kDa, transcript
FT                   variant mCT188866"
FT                   /note="gene_id=mCG127151.1 transcript_id=mCT188866.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<15552674..15552781,15554274..15554391,
FT                   15565335..15565570,15566428..15566586,15567851..15567962,
FT                   15568797..15568921,15571863..15571987,15585065..15585212,
FT                   15585360..15585450,15585628..15585732,15593073..15593214,
FT                   15596064..15596185,15599082..15599384,15600723..15600897,
FT                   15608121..15608225,15617229..15617587,15630119..15630367,
FT                   15630530..15630655,15634260..15634363,15636380..15636493,
FT                   15637924..15638082)
FT                   /codon_start=1
FT                   /gene="Sap130"
FT                   /locus_tag="mCG_127151"
FT                   /product="Sin3A associated protein, 130kDa, isoform CRA_c"
FT                   /note="gene_id=mCG127151.1 transcript_id=mCT188866.0
FT                   protein_id=mCP109856.0 isoform=CRA_c"
FT                   /protein_id="EDK97035.1"
FT                   /translation="QSASGRAAAAGPEPEDISPKDGEHTRASSRRRGRAQVEMSSQQFP
FT                   RLGTPSPGLSQPPSQIASSGSAGLINQVATVNDEAGRDADVGTREHVGPSSSLPPREEK
FT                   QEPVVVRPYPQVQMLPAHHAVASATPVAVTAPPAHLTPAVPLSFSEGLMKPPPKPTMPS
FT                   RPIAPAPPSTMSLPPKVPGQVTVTMESSIPQASAIPVATISGQQGHPSNLHHIMTTNVQ
FT                   MSIIRSNAPGPPLHIGASHLPRGAAAAAVMSSSKVTTVLRPTSQLPNAATAQPAVQHLI
FT                   HQPIQSRPPVTTSSTIPPAVVATVSATRAQSPVITTTAAHAADSTLSRPTLSIQHPPSA
FT                   AISIQRPAQSRDVTTRITLPSHPALGTPKQQLHTMAQKTIFSTGTPVAAATVAPILATN
FT                   TLPSTTTAGSVSHTQAPTSTIVTMTMPSHSSHATAVTTSNIPVAKVVPQQITHTSPRIQ
FT                   PDYPPERSSLIPISGHRASPNPVAMETRNDNRPSVPVQFQYFLPTYPPSAYPLAAHTYT
FT                   PITSSVSTIRQYPVSAQAPNSTITAQTGVGVASTVHLNPMQLMTVDASHARHIQGIQPA
FT                   PISTQGIQPAPIGTSGIQPAPIGTPGIHSAAPINTQGLQPAAMANQQPQPEGKTSVVLA
FT                   DGATIVANPISNPFSAAPAATTVVQTHSQSASTNTPAQGSSPRPSILRKKPATDGMAVR
FT                   KTLLPPQPPDVATPRVESSMRSASGSPRPAGAKPKSEVHVSIATPVTVSLETISNQNAE
FT                   QPTVAVPPTAQQPPPTIPSMIAAASPPSQPAIALSTIPGAVPVTPPITTIAATPTLSAP
FT                   VGGTPSTVLGPPVPEIKVKEEVEPVDITRPVSTVPPLATNTVSPSLALLASNLSMPPSD
FT                   LPPGASPRKKPRKQQHVISTEEGDMMETNSTDDEKSTAKSLLVKAEKRKSPPKEYIDEE
FT                   GVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRA
FT                   QGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRC
FT                   KLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV"
FT   CDS             join(15554280..15554391,15565335..15565570,
FT                   15566428..15566586,15567851..15567962,15568797..15568921,
FT                   15571863..15571987,15585065..15585212,15585360..15585450,
FT                   15585628..15585732,15593073..15593214,15596064..15596185,
FT                   15599082..15599384,15600720..15600897,15608121..15608225,
FT                   15617229..15617587,15630119..15630367,15630530..15630655,
FT                   15634260..15634363,15636380..15636493,15637924..15638082)
FT                   /codon_start=1
FT                   /gene="Sap130"
FT                   /locus_tag="mCG_127151"
FT                   /product="Sin3A associated protein, 130kDa, isoform CRA_a"
FT                   /note="gene_id=mCG127151.1 transcript_id=mCT128432.1
FT                   protein_id=mCP69033.1 isoform=CRA_a"
FT                   /protein_id="EDK97033.1"
FT                   /translation="MSSQQFPRLGTPSPGLSQPPSQIASSGSAGLINQVATVNDEAGRD
FT                   ADVGTREHVGPSSSLPPREEKQEPVVVRPYPQVQMLPAHHAVASATPVAVTAPPAHLTP
FT                   AVPLSFSEGLMKPPPKPTMPSRPIAPAPPSTMSLPPKVPGQVTVTMESSIPQASAIPVA
FT                   TISGQQGHPSNLHHIMTTNVQMSIIRSNAPGPPLHIGASHLPRGAAAAAVMSSSKVTTV
FT                   LRPTSQLPNAATAQPAVQHLIHQPIQSRPPVTTSSTIPPAVVATVSATRAQSPVITTTA
FT                   AHAADSTLSRPTLSIQHPPSAAISIQRPAQSRDVTTRITLPSHPALGTPKQQLHTMAQK
FT                   TIFSTGTPVAAATVAPILATNTLPSTTTAGSVSHTQAPTSTIVTMTMPSHSSHATAVTT
FT                   SNIPVAKVVPQQITHTSPRIQPDYPPERSSLIPISGHRASPNPVAMETRNDNRPSVPVQ
FT                   FQYFLPTYPPSAYPLAAHTYTPITSSVSTIRQYPVSAQAPNSTITAQTGVGVASTVHLN
FT                   PMQLMTVDASHARHIQGIQPAPISTQGIQPAPIGTSGIQPAPIGTPGIHSAAPINTQGL
FT                   QPAAMANQQPQPEGKTSAVVLADGATIVANPISNPFSAAPAATTVVQTHSQSASTNTPA
FT                   QGSSPRPSILRKKPATDGMAVRKTLLPPQPPDVATPRVESSMRSASGSPRPAGAKPKSE
FT                   VHVSIATPVTVSLETISNQNAEQPTVAVPPTAQQPPPTIPSMIAAASPPSQPAIALSTI
FT                   PGAVPVTPPITTIAATPTLSAPVGGTPSTVLGPPVPEIKVKEEVEPVDITRPVSTVPPL
FT                   ATNTVSPSLALLASNLSMPPSDLPPGASPRKKPRKQQHVISTEEGDMMETNSTDDEKST
FT                   AKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVR
FT                   VKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKK
FT                   KAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKV
FT                   SKLKRKEKV"
FT   gap             15570385..15570404
FT                   /estimated_length=20
FT   CDS             join(<15571976..15571987,15585087..15585212,
FT                   15585360..15585450,15585628..15585732,15593073..15593214,
FT                   15596064..15596185,15599082..15599384,15600720..15600897,
FT                   15608121..15608225,15617229..15617587,15630119..15630367,
FT                   15630530..15630660)
FT                   /codon_start=1
FT                   /gene="Sap130"
FT                   /locus_tag="mCG_127151"
FT                   /product="Sin3A associated protein, 130kDa, isoform CRA_b"
FT                   /note="gene_id=mCG127151.1 transcript_id=mCT188865.0
FT                   protein_id=mCP109855.0 isoform=CRA_b"
FT                   /protein_id="EDK97034.1"
FT                   /translation="LDAQHPPSAAISIQRPAQSRDVTTRITLPSHPALGTPKQQLHTMA
FT                   QKTIFSTGTPVAAATVAPILATNTLPSTTTAGSVSHTQAPTSTIVTMTMPSHSSHATAV
FT                   TTSNIPVAKVVPQQITHTSPRIQPDYPPERSSLIPISGHRASPNPVAMETRNDNRPSVP
FT                   VQFQYFLPTYPPSAYPLAAHTYTPITSSVSTIRQYPVSAQAPNSTITAQTGVGVASTVH
FT                   LNPMQLMTVDASHARHIQGIQPAPISTQGIQPAPIGTSGIQPAPIGTPGIHSAAPINTQ
FT                   GLQPAAMANQQPQPEGKTSAVVLADGATIVANPISNPFSAAPAATTVVQTHSQSASTNT
FT                   PAQGSSPRPSILRKKPATDGMAVRKTLLPPQPPDVATPRVESSMRSASGSPRPAGAKPK
FT                   SEVHVSIATPVTVSLETISNQNAEQPTVAVPPTAQQPPPTIPSMIAAASPPSQPAIALS
FT                   TIPGAVPVTPPITTIAATPTLSAPVGGTPSTVLGPPVPEIKVKEEVEPVDITRPVSTVP
FT                   PLATNTVSPSLALLASNLSMPPSDLPPGASPRKKPRKQQHVISTEEGDMMETNSTDDEK
FT                   STAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSD
FT                   VRVKG"
FT   gap             15576450..15576469
FT                   /estimated_length=20
FT   gap             15613025..15613095
FT                   /estimated_length=71
FT   gap             15635194..15635213
FT                   /estimated_length=20
FT   gap             15642775..15643320
FT                   /estimated_length=546
FT   gap             15656103..15656122
FT                   /estimated_length=20
FT   gap             15657635..15657654
FT                   /estimated_length=20
FT   gap             15659088..15659822
FT                   /estimated_length=735
FT   gap             15662226..15662245
FT                   /estimated_length=20
FT   gap             15663343..15664176
FT                   /estimated_length=834
FT   gene            15679321..15703495
FT                   /gene="E230022H04Rik"
FT                   /locus_tag="mCG_127148"
FT                   /note="gene_id=mCG127148.1"
FT   mRNA            join(15679321..15679665,15691124..15691568,
FT                   15693689..15693799,15694090..15694204,15695396..15695486,
FT                   15698270..15698366,15700058..15702141)
FT                   /gene="E230022H04Rik"
FT                   /locus_tag="mCG_127148"
FT                   /product="RIKEN cDNA E230022H04, transcript variant
FT                   mCT177667"
FT                   /note="gene_id=mCG127148.1 transcript_id=mCT177667.0
FT                   created on 19-DEC-2002"
FT   mRNA            join(15679446..15679665,15681240..15681350,
FT                   15691124..15691568,15693689..15693799,15694090..15694204,
FT                   15695396..15695486,15698270..15698366,15700058..15703495)
FT                   /gene="E230022H04Rik"
FT                   /locus_tag="mCG_127148"
FT                   /product="RIKEN cDNA E230022H04, transcript variant
FT                   mCT128429"
FT                   /note="gene_id=mCG127148.1 transcript_id=mCT128429.1
FT                   created on 19-DEC-2002"
FT   mRNA            join(15680548..15680659,15681240..15681350,
FT                   15691124..15691568,15693689..15693799,15694090..15694204,
FT                   15695396..15695486,15698270..15698366,15700058..15702141)
FT                   /gene="E230022H04Rik"
FT                   /locus_tag="mCG_127148"
FT                   /product="RIKEN cDNA E230022H04, transcript variant
FT                   mCT177666"
FT                   /note="gene_id=mCG127148.1 transcript_id=mCT177666.0
FT                   created on 19-DEC-2002"
FT   CDS             join(15680587..15680659,15681240..15681350,
FT                   15691124..15691568,15693689..15693799,15694090..15694204,
FT                   15695396..15695486,15698270..15698366,15700058..15700169)
FT                   /codon_start=1
FT                   /gene="E230022H04Rik"
FT                   /locus_tag="mCG_127148"
FT                   /product="RIKEN cDNA E230022H04, isoform CRA_b"
FT                   /note="gene_id=mCG127148.1 transcript_id=mCT177666.0
FT                   protein_id=mCP100589.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V0N3"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="MGI:MGI:2442711"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V0N3"
FT                   /protein_id="EDK97037.1"
FT                   /translation="MAPPTLTIASWHKVPCPQGPSMLSGIGRRNGIGRKKIHSRDKIAS
FT                   LSYCSCFLWDYNLSAFRFCSIPDQEHQIRMGKRRCVPPLEPKLAAGCCGVKKPKLSGSG
FT                   THSHGNQSTTVPGSSSGPLQNHQHVDNSSGRENVSDLTLGPGNSPITRMNTASGALSPL
FT                   PRPNGTANSTKNLVVTAEMCCYCFDVLYCHLYGFPQPRLPRFTNDPYPLFVTWKTGRDK
FT                   RLRGCIGTFSAMNLHSGLREYTLTSALKDSRFPPLTREELPKLFCSVSLLTNFEDASDY
FT                   LDWEVGVHGIRIEFINEKGIKRTATYLPEVAKEQDWDQIQTIDSLLRKGGFKAPITSEF
FT                   RKSIKLTRYRSEKVTISYAEYIASRQHCFQNGTLHAPPLYNHYS"
FT   mRNA            join(<15681264..15681350,15691124..15691568,
FT                   15693689..15693799,15694090..15694204,15695396..15695486,
FT                   15698270..15698366,15699455..15699582,15700058..15702141)
FT                   /gene="E230022H04Rik"
FT                   /locus_tag="mCG_127148"
FT                   /product="RIKEN cDNA E230022H04, transcript variant
FT                   mCT188875"
FT                   /note="gene_id=mCG127148.1 transcript_id=mCT188875.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<15681266..15681350,15691124..15691568,
FT                   15693689..15693799,15694090..15694204,15695396..15695486,
FT                   15698270..15698366,15699455..15699536)
FT                   /codon_start=1
FT                   /gene="E230022H04Rik"
FT                   /locus_tag="mCG_127148"
FT                   /product="RIKEN cDNA E230022H04, isoform CRA_c"
FT                   /note="gene_id=mCG127148.1 transcript_id=mCT188875.0
FT                   protein_id=mCP109853.0 isoform=CRA_c"
FT                   /protein_id="EDK97039.1"
FT                   /translation="RKKIHSRDKIASLSYCSCFLWDYNLSAFRFCSIPDQEHQIRMGKR
FT                   RCVPPLEPKLAAGCCGVKKPKLSGSGTHSHGNQSTTVPGSSSGPLQNHQHVDNSSGREN
FT                   VSDLTLGPGNSPITRMNTASGALSPLPRPNGTANSTKNLVVTAEMCCYCFDVLYCHLYG
FT                   FPQPRLPRFTNDPYPLFVTWKTGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKDSRFP
FT                   PLTREELPKLFCSVSLLTNFEDASDYLDWEVGVHGIRIEFINEKGIKRTATYLPEVAKE
FT                   QDWDQIQTIDSLLRKGGFKAPITSEFRKSIKLTRAKPKCYEFCSDGPVMWHIHLGIETF
FT                   L"
FT   CDS             join(15691162..15691568,15693689..15693799,
FT                   15694090..15694204,15695396..15695486,15698270..15698366,
FT                   15700058..15700169)
FT                   /codon_start=1
FT                   /gene="E230022H04Rik"
FT                   /locus_tag="mCG_127148"
FT                   /product="RIKEN cDNA E230022H04, isoform CRA_a"
FT                   /note="gene_id=mCG127148.1 transcript_id=mCT128429.1
FT                   protein_id=mCP69041.1 isoform=CRA_a"
FT                   /protein_id="EDK97036.1"
FT                   /translation="MGKRRCVPPLEPKLAAGCCGVKKPKLSGSGTHSHGNQSTTVPGSS
FT                   SGPLQNHQHVDNSSGRENVSDLTLGPGNSPITRMNTASGALSPLPRPNGTANSTKNLVV
FT                   TAEMCCYCFDVLYCHLYGFPQPRLPRFTNDPYPLFVTWKTGRDKRLRGCIGTFSAMNLH
FT                   SGLREYTLTSALKDSRFPPLTREELPKLFCSVSLLTNFEDASDYLDWEVGVHGIRIEFI
FT                   NEKGIKRTATYLPEVAKEQDWDQIQTIDSLLRKGGFKAPITSEFRKSIKLTRYRSEKVT
FT                   ISYAEYIASRQHCFQNGTLHAPPLYNHYS"
FT   CDS             join(15691162..15691568,15693689..15693799,
FT                   15694090..15694204,15695396..15695486,15698270..15698366,
FT                   15700058..15700169)
FT                   /codon_start=1
FT                   /gene="E230022H04Rik"
FT                   /locus_tag="mCG_127148"
FT                   /product="RIKEN cDNA E230022H04, isoform CRA_a"
FT                   /note="gene_id=mCG127148.1 transcript_id=mCT177667.0
FT                   protein_id=mCP100588.0 isoform=CRA_a"
FT                   /protein_id="EDK97038.1"
FT                   /translation="MGKRRCVPPLEPKLAAGCCGVKKPKLSGSGTHSHGNQSTTVPGSS
FT                   SGPLQNHQHVDNSSGRENVSDLTLGPGNSPITRMNTASGALSPLPRPNGTANSTKNLVV
FT                   TAEMCCYCFDVLYCHLYGFPQPRLPRFTNDPYPLFVTWKTGRDKRLRGCIGTFSAMNLH
FT                   SGLREYTLTSALKDSRFPPLTREELPKLFCSVSLLTNFEDASDYLDWEVGVHGIRIEFI
FT                   NEKGIKRTATYLPEVAKEQDWDQIQTIDSLLRKGGFKAPITSEFRKSIKLTRYRSEKVT
FT                   ISYAEYIASRQHCFQNGTLHAPPLYNHYS"
FT   gene            complement(15700640..>15708464)
FT                   /locus_tag="mCG_145815"
FT                   /note="gene_id=mCG145815.0"
FT   mRNA            complement(join(15700640..15701936,15704965..15705169,
FT                   15708179..>15708464))
FT                   /locus_tag="mCG_145815"
FT                   /product="mCG145815"
FT                   /note="gene_id=mCG145815.0 transcript_id=mCT185923.0
FT                   created on 03-JUL-2003"
FT   CDS             complement(15700651..>15700938)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145815"
FT                   /product="mCG145815"
FT                   /note="gene_id=mCG145815.0 transcript_id=mCT185923.0
FT                   protein_id=mCP107336.0"
FT                   /protein_id="EDK97040.1"
FT                   /translation="HWDLYRHLHSIPQQAMPQSSQQETQCRKSTRMSTESRVSMKTFTA
FT                   YCTMKCHHRISDLGLRILSRTHRGSWCPCSTLTWCSLLKHGGCGSTLGTQ"
FT   gene            15708531..15716129
FT                   /gene="Polr2d"
FT                   /locus_tag="mCG_127147"
FT                   /note="gene_id=mCG127147.1"
FT   mRNA            join(15708531..15708661,15711265..15711445,
FT                   15714709..15714804,15715471..15716129)
FT                   /gene="Polr2d"
FT                   /locus_tag="mCG_127147"
FT                   /product="polymerase (RNA) II (DNA directed) polypeptide D"
FT                   /note="gene_id=mCG127147.1 transcript_id=mCT128428.1
FT                   created on 22-NOV-2002"
FT   CDS             join(15708589..15708661,15711265..15711445,
FT                   15714709..15714804,15715471..15715549)
FT                   /codon_start=1
FT                   /gene="Polr2d"
FT                   /locus_tag="mCG_127147"
FT                   /product="polymerase (RNA) II (DNA directed) polypeptide D"
FT                   /note="gene_id=mCG127147.1 transcript_id=mCT128428.1
FT                   protein_id=mCP69039.1"
FT                   /protein_id="EDK97041.1"
FT                   /translation="MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRK
FT                   QQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLC
FT                   PETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY"
FT   gap             15712506..15712525
FT                   /estimated_length=20
FT   gap             15718927..15718946
FT                   /estimated_length=20
FT   gene            <15724666..15829760
FT                   /gene="Wdr33"
FT                   /locus_tag="mCG_127144"
FT                   /note="gene_id=mCG127144.2"
FT   mRNA            join(<15724666..15724824,15747975..15748201,
FT                   15749945..15750013,15750588..15750692,15754245..15754340,
FT                   15754518..15754669,15756319..15756416,15798967..15799093,
FT                   15800608..15800762,15800875..15800953,15802119..15802229,
FT                   15806409..15806503,15807049..15807135,15807676..15807815,
FT                   15808723..>15808796)
FT                   /gene="Wdr33"
FT                   /locus_tag="mCG_127144"
FT                   /product="WD repeat domain 33, transcript variant
FT                   mCT188867"
FT                   /note="gene_id=mCG127144.2 transcript_id=mCT188867.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(15724695..15724824,15747998..15748201,
FT                   15749945..15750013,15750588..15750692,15754245..15754340,
FT                   15754518..15754669,15756319..15756416,15798967..15799093,
FT                   15800608..15800762,15800875..15800953,15802119..15802229,
FT                   15806409..15806503,15807049..15807135,15807676..15807815,
FT                   15808723..15808875,15809105..15810188,15814024..15814132,
FT                   15819093..15819528,15824819..15824982,15825077..15825172,
FT                   15826731..15826946,15829156..15829760)
FT                   /gene="Wdr33"
FT                   /locus_tag="mCG_127144"
FT                   /product="WD repeat domain 33, transcript variant
FT                   mCT128425"
FT                   /note="gene_id=mCG127144.2 transcript_id=mCT128425.1
FT                   created on 15-OCT-2002"
FT   gap             15737054..15737859
FT                   /estimated_length=806
FT   gap             15740420..15740569
FT                   /estimated_length=150
FT   gene            complement(15740570..>15741416)
FT                   /locus_tag="mCG_127140"
FT                   /note="gene_id=mCG127140.1"
FT   mRNA            complement(15740570..>15741416)
FT                   /locus_tag="mCG_127140"
FT                   /product="mCG127140"
FT                   /note="gene_id=mCG127140.1 transcript_id=mCT128421.0
FT                   created on 19-DEC-2002"
FT   CDS             complement(15740869..>15741414)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127140"
FT                   /product="mCG127140"
FT                   /note="gene_id=mCG127140.1 transcript_id=mCT128421.0
FT                   protein_id=mCP69240.0"
FT                   /protein_id="EDK97044.1"
FT                   /translation="TPDYDRSQWLGEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLAR
FT                   KHNLCGETEEERIRVDILENQAMDTRIQLAMVCYSPDFEKKKPEYLEGLPDKMKLYSEF
FT                   LGKQPWFAGNKVTYVDFLVYDVLDQHRIFEPKCLDAFPNLKDFMGRFEGLKKISDYMKS
FT                   SRFLSKPIFAKMAFWNPK"
FT   CDS             join(<15747986..15748201,15749945..15750013,
FT                   15750588..15750692,15754245..15754340,15754518..15754669,
FT                   15756319..15756416,15798967..15799093,15800608..15800762,
FT                   15800875..15800953,15802119..15802229,15806409..15806503,
FT                   15807049..15807135,15807676..15807815,15808723..>15808796)
FT                   /codon_start=1
FT                   /gene="Wdr33"
FT                   /locus_tag="mCG_127144"
FT                   /product="WD repeat domain 33, isoform CRA_a"
FT                   /note="gene_id=mCG127144.2 transcript_id=mCT188867.0
FT                   protein_id=mCP109851.0 isoform=CRA_a"
FT                   /protein_id="EDK97042.1"
FT                   /translation="ENITMATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQL
FT                   TFDGKRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLN
FT                   NPMNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQA
FT                   HDSPVRAMTWSHNDMWMLTADHGGYVKYWQSNMNNVKMFQAHKEAIREASFSPTDNKFA
FT                   TCSDDGTVRIWDFLRCHEERILRGHGADVKCVDWHPTKGLVVSGSKDSQQPIKFWDPKT
FT                   GQSLATLHAHKNTVMEVKLNLNGNWLLTASRDHLCKLFDIRNLKEELQVFRGHKKEATA
FT                   VAWHPVHEGLFASGGSDGSLLFWHVGVEKEVGGMEMAHEGMIWSLAWHPLGHILCSGSN
FT                   DHTSKFWTRNRPGDKMRDRYNLNLLPGMSEDGVEYDDLEPNSLAVIPGMGIPEQLKLAM
FT                   EQEQMGKDESSEIEMTIPGLDWGMEEVMQKDQKKVPQKKVPYAKPIPAQFQQAWMQNKV
FT                   PIPAPNEVLNDRKEDIK"
FT   CDS             join(15747998..15748201,15749945..15750013,
FT                   15750588..15750692,15754245..15754340,15754518..15754669,
FT                   15756319..15756416,15798967..15799093,15800608..15800762,
FT                   15800875..15800953,15802119..15802229,15806409..15806503,
FT                   15807049..15807135,15807676..15807815,15808723..15808875,
FT                   15809105..15810163)
FT                   /codon_start=1
FT                   /gene="Wdr33"
FT                   /locus_tag="mCG_127144"
FT                   /product="WD repeat domain 33, isoform CRA_b"
FT                   /note="gene_id=mCG127144.2 transcript_id=mCT128425.1
FT                   protein_id=mCP69006.1 isoform=CRA_b partial"
FT                   /protein_id="EDK97043.1"
FT                   /translation="MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDG
FT                   KRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMN
FT                   AVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHDSP
FT                   VRAMTWSHNDMWMLTADHGGYVKYWQSNMNNVKMFQAHKEAIREASFSPTDNKFATCSD
FT                   DGTVRIWDFLRCHEERILRGHGADVKCVDWHPTKGLVVSGSKDSQQPIKFWDPKTGQSL
FT                   ATLHAHKNTVMEVKLNLNGNWLLTASRDHLCKLFDIRNLKEELQVFRGHKKEATAVAWH
FT                   PVHEGLFASGGSDGSLLFWHVGVEKEVGGMEMAHEGMIWSLAWHPLGHILCSGSNDHTS
FT                   KFWTRNRPGDKMRDRYNLNLLPGMSEDGVEYDDLEPNSLAVIPGMGIPEQLKLAMEQEQ
FT                   MGKDESSEIEMTIPGLDWGMEEVMQKDQKKVPQKKVPYAKPIPAQFQQAWMQNKVPIPA
FT                   PNEVLNDRKEDIKLEEKKKTQAEIEQEMATLQYTNPQLLEQLKIERLAQKQADQIQPPP
FT                   SSGTPLLGPQPFSGQGPISQIPQGFQQPHPSQQMPLVPQMGPPGPQGQFRAPGPQGQMG
FT                   PQGPPMHQGGGGPQGFMGPQGPQGPPQGLPRPQDMHGPQGMQRHPGPHGPLGPQGPPGP
FT                   QGSSGPQGHMGPQGPPGPQGHIGPQGPPAPQGHMGPQGPPGTQGMQGPPGPRGMQGPPH
FT                   PHGIQGGPASQGIQGPLMGLNPRGMQGPXXXXXXXSGESGSCSSRVNDWPPTSRDERTT
FT                   SSKWIAGTWPSGNERSSGDAGHAGSPTTGLNVGPSPGTSRTFRFTRAAGATPGLFGTST
FT                   PGWHARTPWTSGTAEPGKRATSISRANTVPAAESTSAR"
FT   gap             15751380..15751399
FT                   /estimated_length=20
FT   gap             15753991..15754010
FT                   /estimated_length=20
FT   gap             15762724..15762855
FT                   /estimated_length=132
FT   gap             15774378..15774397
FT                   /estimated_length=20
FT   gap             15775948..15775988
FT                   /estimated_length=41
FT   gap             15782790..15782809
FT                   /estimated_length=20
FT   gap             15809777..15809796
FT                   /estimated_length=20
FT   gap             15817417..15817436
FT                   /estimated_length=20
FT   gap             15818692..15818711
FT                   /estimated_length=20
FT   gap             15827445..15827674
FT                   /estimated_length=230
FT   gene            complement(15831498..15833628)
FT                   /locus_tag="mCG_1031606"
FT                   /note="gene_id=mCG1031606.1"
FT   mRNA            complement(15831498..15833628)
FT                   /locus_tag="mCG_1031606"
FT                   /product="mCG1031606"
FT                   /note="gene_id=mCG1031606.1 transcript_id=mCT149310.1
FT                   created on 03-JUN-2002"
FT   CDS             complement(15832859..15833488)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031606"
FT                   /product="mCG1031606"
FT                   /note="gene_id=mCG1031606.1 transcript_id=mCT149310.1
FT                   protein_id=mCP69150.1"
FT                   /protein_id="EDK97045.1"
FT                   /translation="MAVGTERCRAATRGLALPPQRDARPAPGGGRPVSAAGRALLRPGG
FT                   ALRAGAAAARAQVRAPLVAGLGAGVGERGAAAGRPGVRPPATRRGDALAEHAWLRRRLG
FT                   RHALRRAGPAQYGADGARRLRTGSRAALRVDRAPALGRCDGAATGARSPKSRDWPSQRA
FT                   PGVTVPVSRKRKPARLGTLHCTQANKDKAPTGLRGGVRALEADVKN"
FT   gap             15843013..15843059
FT                   /estimated_length=47
FT   gene            15844653..15880897
FT                   /gene="Lims2"
FT                   /locus_tag="mCG_127149"
FT                   /note="gene_id=mCG127149.1"
FT   mRNA            join(15844653..15844819,15864011..15864170,
FT                   15866416..15866482,15866713..15866833,15876713..15876862,
FT                   15877537..15877687,15878536..15878628,15879231..15879279,
FT                   15879517..15879592,15880122..15880890)
FT                   /gene="Lims2"
FT                   /locus_tag="mCG_127149"
FT                   /product="LIM and senescent cell antigen like domains 2,
FT                   transcript variant mCT169886"
FT                   /note="gene_id=mCG127149.1 transcript_id=mCT169886.0
FT                   created on 03-JUN-2002"
FT   gap             15850678..15850723
FT                   /estimated_length=46
FT   mRNA            join(15853728..15853954,15864011..15864170,
FT                   15866416..15866482,15866713..15866833,15876713..15876862,
FT                   15877537..15877687,15878536..15878628,15879231..15879279,
FT                   15879517..15879592,15880122..15880897)
FT                   /gene="Lims2"
FT                   /locus_tag="mCG_127149"
FT                   /product="LIM and senescent cell antigen like domains 2,
FT                   transcript variant mCT128430"
FT                   /note="gene_id=mCG127149.1 transcript_id=mCT128430.0
FT                   created on 03-JUN-2002"
FT   CDS             join(15853944..15853954,15864011..15864170,
FT                   15866416..15866482,15866713..15866833,15876713..15876862,
FT                   15877537..15877687,15878536..15878628,15879231..15879279,
FT                   15879517..15879592,15880122..15880269)
FT                   /codon_start=1
FT                   /gene="Lims2"
FT                   /locus_tag="mCG_127149"
FT                   /product="LIM and senescent cell antigen like domains 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG127149.1 transcript_id=mCT128430.0
FT                   protein_id=mCP69296.1 isoform=CRA_a"
FT                   /protein_id="EDK97046.1"
FT                   /translation="MTGSNMSECLADAMCQRCQARFAPTERIVNSNGELYHEHCFVCAQ
FT                   CFRPFPEGLFYEFEGRKYCEHDFQMLFAPCCGFCGEFVIGRVIKAMNANWHPGCFRCEL
FT                   CDVELADLGFVKNAGRHLCRPCHNREKAKGLGKFICQRCHLAIDEQPLMFKNDPYHPDH
FT                   FSCSNCGKELTSDARELKGELYCLPCHDKMGIPICGACRRPIEGRVVNALGKQWHVEHF
FT                   VCAKCEKPFLGHRHYEKKGLAYCETHYNQLFGDVCYNCSHVIEGDVVSALSKAWCVNCF
FT                   SCSTCNMKLTLKNKFVEFDMKPVCKRCYERFPLELKKRLKKLSDLSSRKAQPKSVDVNS
FT                   L"
FT   gap             15854953..15855006
FT                   /estimated_length=54
FT   gap             15859398..15859476
FT                   /estimated_length=79
FT   CDS             join(15864015..15864170,15866416..15866482,
FT                   15866713..15866833,15876713..15876862,15877537..15877687,
FT                   15878536..15878628,15879231..15879279,15879517..15879592,
FT                   15880122..15880269)
FT                   /codon_start=1
FT                   /gene="Lims2"
FT                   /locus_tag="mCG_127149"
FT                   /product="LIM and senescent cell antigen like domains 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG127149.1 transcript_id=mCT169886.0
FT                   protein_id=mCP92530.0 isoform=CRA_b"
FT                   /protein_id="EDK97047.1"
FT                   /translation="MSECLADAMCQRCQARFAPTERIVNSNGELYHEHCFVCAQCFRPF
FT                   PEGLFYEFEGRKYCEHDFQMLFAPCCGFCGEFVIGRVIKAMNANWHPGCFRCELCDVEL
FT                   ADLGFVKNAGRHLCRPCHNREKAKGLGKFICQRCHLAIDEQPLMFKNDPYHPDHFSCSN
FT                   CGKELTSDARELKGELYCLPCHDKMGIPICGACRRPIEGRVVNALGKQWHVEHFVCAKC
FT                   EKPFLGHRHYEKKGLAYCETHYNQLFGDVCYNCSHVIEGDVVSALSKAWCVNCFSCSTC
FT                   NMKLTLKNKFVEFDMKPVCKRCYERFPLELKKRLKKLSDLSSRKAQPKSVDVNSL"
FT   gene            complement(15868138..>15870285)
FT                   /locus_tag="mCG_1031659"
FT                   /note="gene_id=mCG1031659.2"
FT   mRNA            complement(15868138..>15870285)
FT                   /locus_tag="mCG_1031659"
FT                   /product="mCG1031659"
FT                   /note="gene_id=mCG1031659.2 transcript_id=mCT149363.1
FT                   created on 17-APR-2003"
FT   CDS             complement(15869266..15870285)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031659"
FT                   /product="mCG1031659"
FT                   /note="gene_id=mCG1031659.2 transcript_id=mCT149363.1
FT                   protein_id=mCP68986.0"
FT                   /protein_id="EDK97048.1"
FT                   /translation="MNGLEAALPSLTDNSSLAYSEQCGQETPLENMLFACFYLLDFILA
FT                   FVGNALALWLFIWDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIPC
FT                   RLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWIVVAVAM
FT                   APLLVSPQTVQTNHTVVCLQLYREKASHHALASLAVAFTFPFITTVTCYLLIIRSLRQG
FT                   PRIEKHLKNKAVRMIAMVLAIFLICFVPYHIHRSVYVLHYRGGGTSCAAQRALALGNRI
FT                   TSCLTSLNGALDPVMYFFVAEKFRHALCNLLCSKRLTGPPPSFEGKTNESSLSARSEL"
FT   gene            complement(15881509..>15958987)
FT                   /gene="Myo7b"
FT                   /locus_tag="mCG_127141"
FT                   /note="gene_id=mCG127141.1"
FT   mRNA            complement(join(15881509..15881781,15882078..15882197,
FT                   15882315..15882398,15883121..15883237,15883456..15883641,
FT                   15884089..15884195,15884559..15884646,15884947..15885060,
FT                   15886778..15886883,15887900..15888055,15888596..15888749,
FT                   15889210..15889367,15889520..15889650,15890312..15890493,
FT                   15891827..15891990,15893711..15893837,15893927..15894044,
FT                   15895215..15895382,15896371..15896598,15897463..15897636,
FT                   15898647..15898766,15899358..15899484,15903374..15903501,
FT                   15905611..15905769,15905917..15906126,15906240..15906410,
FT                   15907317..15907535,15909002..15909086,15910903..15910997,
FT                   15911882..15911980,15912538..15912690,15916655..15916792,
FT                   15917183..15917346,15920422..15920557,15920987..15921197,
FT                   15922351..15922493,15922670..15922789,15923742..15923818,
FT                   15925890..15926043,15927830..15927943,15929400..15929542,
FT                   15932453..15932574,15935808..15935992,15936751..15936903,
FT                   15937990..15938103,15944082..15944122,15958896..>15958987))
FT                   /gene="Myo7b"
FT                   /locus_tag="mCG_127141"
FT                   /product="myosin VIIb, transcript variant mCT188858"
FT                   /note="gene_id=mCG127141.1 transcript_id=mCT188858.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(15881509..15881781,15882078..15882197,
FT                   15882315..15882398,15883121..15883237,15883456..15883641,
FT                   15884089..15884195,15884559..15884646,15884947..15885060,
FT                   15886778..15886883,15887900..15888055,15888596..15888749,
FT                   15889210..15889367,15889520..15889650,15890312..15890493,
FT                   15891827..15891990,15893711..15893837,15893927..15894044,
FT                   15895215..15895382,15896371..15896598,15897463..15897636,
FT                   15898647..15898766,15899358..15899484,15903374..15903501,
FT                   15905611..15905769,15905917..15906126,15906240..15906410,
FT                   15907317..15907535,15909002..15909086,15910903..15910997,
FT                   15911882..15911980,15912538..15912690,15916655..15916792,
FT                   15917183..15917346,15920422..15920557,15920983..15921197,
FT                   15922351..15922493,15922670..15922789,15923742..15923818,
FT                   15925890..15926043,15927830..15927943,15929400..15929542,
FT                   15932453..15932574,15935808..15935992,15936751..15936903,
FT                   15937990..15938103,15944082..15944122,15958896..15958987))
FT                   /gene="Myo7b"
FT                   /locus_tag="mCG_127141"
FT                   /product="myosin VIIb, transcript variant mCT128422"
FT                   /note="gene_id=mCG127141.1 transcript_id=mCT128422.0
FT                   created on 03-JUN-2002"
FT   CDS             complement(join(15881680..15881781,15882078..15882197,
FT                   15882315..15882398,15883121..15883237,15883456..15883641,
FT                   15884089..15884195,15884559..15884646,15884947..15885060,
FT                   15886778..15886883,15887900..15888055,15888596..15888749,
FT                   15889210..15889367,15889520..15889650,15890312..15890493,
FT                   15891827..15891990,15893711..15893837,15893927..15894044,
FT                   15895215..15895382,15896371..15896598,15897463..15897636,
FT                   15898647..15898766,15899358..15899484,15903374..15903501,
FT                   15905611..15905769,15905917..15906126,15906240..15906410,
FT                   15907317..15907535,15909002..15909086,15910903..15910997,
FT                   15911882..15911980,15912538..15912690,15916655..15916792,
FT                   15917183..15917346,15920422..15920557,15920987..15921197,
FT                   15922351..15922493,15922670..15922789,15923742..15923818,
FT                   15925890..15926043,15927830..15927943,15929400..15929542,
FT                   15932453..15932574,15935808..15935992,15936751..15936903,
FT                   15937990..15938103,15944082..>15944105))
FT                   /codon_start=1
FT                   /gene="Myo7b"
FT                   /locus_tag="mCG_127141"
FT                   /product="myosin VIIb, isoform CRA_b"
FT                   /note="gene_id=mCG127141.1 transcript_id=mCT188858.0
FT                   protein_id=mCP109849.0 isoform=CRA_b"
FT                   /protein_id="EDK97050.1"
FT                   /translation="PGMSVFRLGDHVWLDPPSSSKTGVAIGGIVKETKLGKTLIEDDEG
FT                   KEHWVHAEDLSTLRPMHPNSAQGVDDMIRLGDLNEAGVVHNLLIRYQQHKIYTYTGSIL
FT                   VAVNPFQMLPLYTLEQVQIYYSRHMGELPPHIFAIANSCYFNMKKNKRDQCCIISGESG
FT                   AGKTETTKLILQFLATVSGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIH
FT                   FNSSGVIEGASIEHFLLEKSRVCRQAPEERNYHIFYCMLMGMSPEEKQMLSLGMPSEYH
FT                   YLTMGSCTSSEGLSDAKDYAHVRSAMKILQFSDSENWDISKLLAAILHLGNVGFMAAVF
FT                   ENLDSSDVMETPAFPLAMKLLEVQHQALRDCLIKHTIPVLGEFVSRPVNIAQATDRRDA
FT                   FVKGIYGRLFQWIVKKINAAIFTPQAQDPQNVRRAIGLLDIFGFENFQNNSFEQLCINF
FT                   ANEHLQQFFVKHVFTMEQEEYLSENITWNYIHYTDNQPILDMLALKPMSIISLLDEESR
FT                   FPQGTDVTMLQKLNSIHANNKSFLSPRSIHDTRFGIAHFAGDVYYQAEGFLEKNRDVLS
FT                   TDILILIHSSKNKFLKEIFNVDSSQTKLGHGTICQVKAGSQLFKSSDSIKRPVTLASQF
FT                   KQSLDQLMRILTNCQPYFVRCIKPNEYKKPLLFDRELCIQQLRYSGMMETVHIRKSGFP
FT                   IRYTFDEFSQRFRVLLPSPERMQFQNKPRQMTLHIADLCLGTDKDWKVGKTKIFLKDHQ
FT                   DTVLEIRRSQALDGAAIRIQRVLRGHKYRKEFLRQRRAAVTLQAGWRGYSQRKNFKLIL
FT                   VGFERLQAIARSHLLMRQFQAMRQRIVQLQARCRGYLVRQQVQAKRRAVVIIQAHARGM
FT                   VVRKSYWQQKSTGPQVILAKEPKAQVAVHERKRKSIYDTVTDTAMVEKVFGFLPAMIGG
FT                   QEGPAPTRFEDLEVKTQKLHEVDLDTVPMMAMPEEEVDSLAEYTFPKFAVTYFQKSASH
FT                   THIQKPLRYPLLYHENDTDHSAALDVWIIILRFMGDLPEPVVYGRNSLTGSSVMRQIHD
FT                   KLGKDSVTQHNRSSQVASQLNFGEEAFKFDGPISDRPMSNLEKVHFIVGYAIMRPGLRD
FT                   EIYCQICKQLSENYKTSSRARGWILLSLCLGCFPPSERFMKYLLNFISQGPPSYGPFCA
FT                   ERLQRTFANGVRAEPPTWLELQAVKSKKHIPIQVILATGRSLTISVDSASTSREICQHV
FT                   AQKQGLRDNLGFSLQVAVYDKFWSLGSGCDHLMDAVAQCEQLARERGESQRQAPWRIYF
FT                   RKEFFTPWHDSQEDPVSTELIYHQVLRGVWSGEYNFEKEEELVELLARHCYVQLGATVK
FT                   SNAVQELLPSCVPSKLYRTKSPEKWASLVTAAHAKAQYTQSKATPLAVREQTVEAARLL
FT                   WPLLFSRLFEVTTLSGPRLPKTQLVLAINWKGMYFLDQKERTLLGLSFAEVMGLVANRD
FT                   APGGKKLLLATLQEEYEFVSPSSVAIAEMVALFLGGLKERSVFAMALQDRRATDDITLL
FT                   PFKKGDLLILTKKQGLLASENWALGQNDRTGKTGLVPTACLYTIPSVTKPSTQLLSLLA
FT                   MSPEKRKLAAQEVRALEPPLEDQLTESPYTLEEFSYQFFRAPEKETISRAAMPMARSRG
FT                   HLWAYSPEPLRQPLLKSVHDKAKLRDAACQIFLAILKYTGDYPSRQSWHSLELTDQMFS
FT                   LALQDPALQDELYCQILKQLTHNSIRFSEERAWQLLWLCTGLFPPGKTLLPHAQKFIDS
FT                   RKKKPLALDCSRRLHRVLRVGPRKQPPHDVEVKAAEQNVSKLHHEVYLPNDTSKSMEVG
FT                   SSSRVRDLCEGIGTRLQLASWDGCSLFIKITDKVISLKEGDFFFDSLRQVSDWVKKNRP
FT                   QKEGASVTLPYQVFFMRKLWLNVTPGKDVNADTILHYHQELPKYLRGFHKCSREDAIHL
FT                   GGLICKIQFGSDSSQLASVSKVLKELVPQNLTRLMSSEEWKKSLLLECDKNKRKTVAEA
FT                   KVEFLKYMYRWPTFGSAFFEVKQTSEPSYPDILLIAINQHGLLLIHPKTKELLNTYPFT
FT                   KISSWSSGNTYFHMALGSLGQGSRLLCETSLGYKMDDLLTSYVQQLLNTVNKQRGFRAP
FT                   APANP"
FT   CDS             complement(join(15881680..15881781,15882078..15882197,
FT                   15882315..15882398,15883121..15883237,15883456..15883641,
FT                   15884089..15884195,15884559..15884646,15884947..15885060,
FT                   15886778..15886883,15887900..15888055,15888596..15888749,
FT                   15889210..15889367,15889520..15889650,15890312..15890493,
FT                   15891827..15891990,15893711..15893837,15893927..15894044,
FT                   15895215..15895382,15896371..15896598,15897463..15897636,
FT                   15898647..15898766,15899358..15899484,15903374..15903501,
FT                   15905611..15905769,15905917..15906126,15906240..15906410,
FT                   15907317..15907535,15909002..15909086,15910903..15910997,
FT                   15911882..15911980,15912538..15912690,15916655..15916792,
FT                   15917183..15917346,15920422..15920557,15920983..15921009))
FT                   /codon_start=1
FT                   /gene="Myo7b"
FT                   /locus_tag="mCG_127141"
FT                   /product="myosin VIIb, isoform CRA_a"
FT                   /note="gene_id=mCG127141.1 transcript_id=mCT128422.0
FT                   protein_id=mCP69241.0 isoform=CRA_a"
FT                   /protein_id="EDK97049.1"
FT                   /translation="MRRAASHRHGTDVTMLQKLNSIHANNKSFLSPRSIHDTRFGIAHF
FT                   AGDVYYQAEGFLEKNRDVLSTDILILIHSSKNKFLKEIFNVDSSQTKLGHGTICQVKAG
FT                   SQLFKSSDSIKRPVTLASQFKQSLDQLMRILTNCQPYFVRCIKPNEYKKPLLFDRELCI
FT                   QQLRYSGMMETVHIRKSGFPIRYTFDEFSQRFRVLLPSPERMQFQNKPRQMTLHIADLC
FT                   LGTDKDWKVGKTKIFLKDHQDTVLEIRRSQALDGAAIRIQRVLRGHKYRKEFLRQRRAA
FT                   VTLQAGWRGYSQRKNFKLILVGFERLQAIARSHLLMRQFQAMRQRIVQLQARCRGYLVR
FT                   QQVQAKRRAVVIIQAHARGMVVRKSYWQQKSTGPQVILAKEPKAQVAVHERKRKSIYDT
FT                   VTDTAMVEKVFGFLPAMIGGQEGPAPTRFEDLEVKTQKLHEVDLDTVPMMAMPEEEVDS
FT                   LAEYTFPKFAVTYFQKSASHTHIQKPLRYPLLYHENDTDHSAALDVWIIILRFMGDLPE
FT                   PVVYGRNSLTGSSVMRQIHDKLGKDSVTQHNRSSQVASQLNFGEEAFKFDGPISDRPMS
FT                   NLEKVHFIVGYAIMRPGLRDEIYCQICKQLSENYKTSSRARGWILLSLCLGCFPPSERF
FT                   MKYLLNFISQGPPSYGPFCAERLQRTFANGVRAEPPTWLELQAVKSKKHIPIQVILATG
FT                   RSLTISVDSASTSREICQHVAQKQGLRDNLGFSLQVAVYDKFWSLGSGCDHLMDAVAQC
FT                   EQLARERGESQRQAPWRIYFRKEFFTPWHDSQEDPVSTELIYHQVLRGVWSGEYNFEKE
FT                   EELVELLARHCYVQLGATVKSNAVQELLPSCVPSKLYRTKSPEKWASLVTAAHAKAQYT
FT                   QSKATPLAVREQTVEAARLLWPLLFSRLFEVTTLSGPRLPKTQLVLAINWKGMYFLDQK
FT                   ERTLLGLSFAEVMGLVANRDAPGGKKLLLATLQEEYEFVSPSSVAIAEMVALFLGGLKE
FT                   RSVFAMALQDRRATDDITLLPFKKGDLLILTKKQGLLASENWALGQNDRTGKTGLVPTA
FT                   CLYTIPSVTKPSTQLLSLLAMSPEKRKLAAQEVRALEPPLEDQLTESPYTLEEFSYQFF
FT                   RAPEKETISRAAMPMARSRGHLWAYSPEPLRQPLLKSVHDKAKLRDAACQIFLAILKYT
FT                   GDYPSRQSWHSLELTDQMFSLALQDPALQDELYCQILKQLTHNSIRFSEERAWQLLWLC
FT                   TGLFPPGKTLLPHAQKFIDSRKKKPLALDCSRRLHRVLRVGPRKQPPHDVEVKAAEQNV
FT                   SKLHHEVYLPNDTSKSMEVGSSSRVRDLCEGIGTRLQLASWDGCSLFIKITDKVISLKE
FT                   GDFFFDSLRQVSDWVKKNRPQKEGASVTLPYQVFFMRKLWLNVTPGKDVNADTILHYHQ
FT                   ELPKYLRGFHKCSREDAIHLGGLICKIQFGSDSSQLASVSKVLKELVPQNLTRLMSSEE
FT                   WKKSLLLECDKNKRKTVAEAKVEFLKYMYRWPTFGSAFFEVKQTSEPSYPDILLIAINQ
FT                   HGLLLIHPKTKELLNTYPFTKISSWSSGNTYFHMALGSLGQGSRLLCETSLGYKMDDLL
FT                   TSYVQQLLNTVNKQRGFRAPAPANP"
FT   gap             15885574..15885716
FT                   /estimated_length=143
FT   gap             15934258..15934410
FT                   /estimated_length=153
FT   gap             15964189..15964208
FT                   /estimated_length=20
FT   gap             15969233..15970289
FT                   /estimated_length=1057
FT   gap             15977940..15977959
FT                   /estimated_length=20
FT   gene            <15980896..16011943
FT                   /gene="Iws1"
FT                   /locus_tag="mCG_127146"
FT                   /note="gene_id=mCG127146.2"
FT   mRNA            join(<15980896..15981196,15983259..15983374,
FT                   15992818..15993724,15996371..15996563,15997284..15997341,
FT                   15997758..15997855,15999414..15999564,16000211..16000293,
FT                   16001397..16001526,16002530..16002647,16003570..16003681,
FT                   16004287..16004343,16006259..16006370,16010649..16011943)
FT                   /gene="Iws1"
FT                   /locus_tag="mCG_127146"
FT                   /product="IWS1 homolog (S. cerevisiae), transcript variant
FT                   mCT188872"
FT                   /note="gene_id=mCG127146.2 transcript_id=mCT188872.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(15980909..15981196,15983259..15983374,
FT                   15992818..15993724,15996374..15996563,15997284..15997341,
FT                   15997758..15997855,15999414..15999564,16000211..16000293,
FT                   16001397..16001526,16002530..16002647,16003570..16003681,
FT                   16004287..16004343,16006259..16006370,16010655..16011173)
FT                   /gene="Iws1"
FT                   /locus_tag="mCG_127146"
FT                   /product="IWS1 homolog (S. cerevisiae), transcript variant
FT                   mCT128427"
FT                   /note="gene_id=mCG127146.2 transcript_id=mCT128427.1
FT                   created on 03-JUN-2002"
FT   CDS             join(<15981115..15981196,15983259..15983374,
FT                   15992818..15993724,15996371..15996563,15997284..15997341,
FT                   15997758..15997855,15999414..15999564,16000211..16000293,
FT                   16001397..16001526,16002530..16002647,16003570..16003681,
FT                   16004287..16004343,16006259..16006370,16010649..16010780)
FT                   /codon_start=1
FT                   /gene="Iws1"
FT                   /locus_tag="mCG_127146"
FT                   /product="IWS1 homolog (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG127146.2 transcript_id=mCT188872.0
FT                   protein_id=mCP109852.0 isoform=CRA_b"
FT                   /protein_id="EDK97052.1"
FT                   /translation="RGRRVARTLPAESPPAMDSEYYSGDQSDDGGATPVQDERDSGSDG
FT                   EDGVTEQHSGSDTGSVDHHSENETSDREDGLAKIHNGTDSENDEPSNANASDSESEELH
FT                   RPKDSDSDSEEHAESPASDSENEPVNQHGSDSENEELLNGHASDSEKEEVSKHAASDSE
FT                   AEDTLQPQVSESDSEDPPRPQASDSENEEPPKPRISDSESEELPKPRVSDSESEDPPRP
FT                   QASDSESEELPKPRVSDSESEDPPRPQASDSESEELPKPRVSDSESEDPQKGPASDSEA
FT                   EDASRHKEKPDSDDSDGENKREDSEVQNESDGHTDRKGLHSSDSEEEEPKRQKIDSDDD
FT                   EEKEGDEEKVAKRKAAVLSDSEDDAGNASAKKSRVVCDADDSDSDVVSDKSGKRETTVA
FT                   SDSEEEAGKEESSVKKKEDKDLFGSDSESGNEEENLIADIFGESGDEEEEEFTGFNQED
FT                   LEEEKNETQLKEAEDSDSDDNIKRGKHMDFLSDFEMMLQRKKSMCGKRRRNRDGGTFIS
FT                   DADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPTVVMHLKKQDLKETFIDSGVM
FT                   SAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESR
FT                   SNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRLSSTGGQTPRRDLE
FT                   KVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEMESSRFQASSKKGISRLDK
FT                   QMRKFTDIRKKSRSAHAVKISIEGNKMPL"
FT   CDS             join(15981163..15981196,15983259..15983374,
FT                   15992818..15993724,15996374..15996563,15997284..15997341,
FT                   15997758..15997855,15999414..15999564,16000211..16000293,
FT                   16001397..16001526,16002530..16002647,16003570..16003681,
FT                   16004287..16004343,16006259..16006370,16010655..16010780)
FT                   /codon_start=1
FT                   /gene="Iws1"
FT                   /locus_tag="mCG_127146"
FT                   /product="IWS1 homolog (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG127146.2 transcript_id=mCT128427.1
FT                   protein_id=mCP69026.1 isoform=CRA_a"
FT                   /protein_id="EDK97051.1"
FT                   /translation="MDSEYYSGDQSDDGGATPVQDERDSGSDGEDGVTEQHSGSDTGSV
FT                   DHHSENETSDREDGLAKIHNGTDSENDEPSNANASDSESEELHRPKDSDSDSEEHAESP
FT                   ASDSENEPVNQHGSDSENEELLNGHASDSEKEEVSKHAASDSEAEDTLQPQVSESDSED
FT                   PPRPQASDSENEEPPKPRISDSESEELPKPRVSDSESEDPPRPQASDSESEELPKPRVS
FT                   DSESEDPPRPQASDSESEELPKPRVSDSESEDPQKGPASDSEAEDASRHKEKPDSDDSD
FT                   GENKREDSEVQNESDGHTDRKGLHSSDSEEEEPKRQKIDSDDDEEKEGDEEKVAKRKAA
FT                   VLSDSEDDAGNASKKSRVVCDADDSDSDVVSDKSGKRETTVASDSEEEAGKEESSVKKK
FT                   EDKDLFGSDSESGNEEENLIADIFGESGDEEEEEFTGFNQEDLEEEKNETQLKEAEDSD
FT                   SDDNIKRGKHMDFLSDFEMMLQRKKSMCGKRRRNRDGGTFISDADDVVSAMIVKMNEAA
FT                   EEDRQLNNQKKPALKKLTLLPTVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPA
FT                   LKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPI
FT                   FGLTSNYKGMTREEREQRDLEQMPQRRRLSSTGGQTPRRDLEKVLTGEEKALRPGDPGF
FT                   CARARVPMPSNKDYVVRPKWNVEMESSRASSKKGISRLDKQMRKFTDIRKKSRSAHAVK
FT                   ISIEGNKMPL"
FT   gap             15997988..15998007
FT                   /estimated_length=20
FT   gap             16009719..16009738
FT                   /estimated_length=20
FT   gene            complement(16025955..16033910)
FT                   /locus_tag="mCG_146818"
FT                   /note="gene_id=mCG146818.0"
FT   mRNA            complement(join(16025955..16026467,16033058..16033910))
FT                   /locus_tag="mCG_146818"
FT                   /product="mCG146818"
FT                   /note="gene_id=mCG146818.0 transcript_id=mCT187081.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(16026105..16026395)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146818"
FT                   /product="mCG146818"
FT                   /note="gene_id=mCG146818.0 transcript_id=mCT187081.0
FT                   protein_id=mCP108174.0"
FT                   /protein_id="EDK97053.1"
FT                   /translation="MRTWSSSMEMHVNDERIVLIEAGDMPRPWGAAMTLSLFIAVLGKE
FT                   KASEEQTQEGTPRLNDVQKTQRSGREETLHSISLPVPTALATAAFSPSQGY"
FT   gap             16034791..16034810
FT                   /estimated_length=20
FT   gene            complement(16036592..16053062)
FT                   /gene="Proc"
FT                   /locus_tag="mCG_127145"
FT                   /note="gene_id=mCG127145.1"
FT   mRNA            complement(join(16036592..16037341,16038620..16038737,
FT                   16040924..16041069,16046676..16046810,16046905..16047042,
FT                   16047162..16047186,16048380..16048543,16049391..16049481,
FT                   16051069..16051132,16051834..16051855,16053015..16053062))
FT                   /gene="Proc"
FT                   /locus_tag="mCG_127145"
FT                   /product="protein C, transcript variant mCT169885"
FT                   /note="gene_id=mCG127145.1 transcript_id=mCT169885.0
FT                   created on 03-JUN-2002"
FT   mRNA            complement(join(16036652..16037341,16038620..16038737,
FT                   16040924..16041069,16046676..16046810,16046905..16047042,
FT                   16047162..16047186,16048380..16048543,16049391..16049481,
FT                   16051069..16051132,16051651..16051721))
FT                   /gene="Proc"
FT                   /locus_tag="mCG_127145"
FT                   /product="protein C, transcript variant mCT128426"
FT                   /note="gene_id=mCG127145.1 transcript_id=mCT128426.1
FT                   created on 03-JUN-2002"
FT   CDS             complement(join(16036755..16037341,16038620..16038737,
FT                   16040924..16041069,16046676..16046810,16046905..16047042,
FT                   16047162..16047186,16048380..16048543,16049391..16049481,
FT                   16051069..16051074))
FT                   /codon_start=1
FT                   /gene="Proc"
FT                   /locus_tag="mCG_127145"
FT                   /product="protein C, isoform CRA_a"
FT                   /note="gene_id=mCG127145.1 transcript_id=mCT128426.1
FT                   protein_id=mCP69007.1 isoform=CRA_a"
FT                   /protein_id="EDK97054.1"
FT                   /translation="METGVSSSRMWQFRVFLLLMSTWGISSIPAHPDPVFSSSEHAHQV
FT                   LRVRRANSFLEEMRPGSLERECMEEICDFEEAQEIFQNVEDTLAFWIKYFDGDQCSAPP
FT                   LDHQCDSPCCGHGTCIDGIGSFSCSCDKGWEGKFCQQELRFQDCRVNNGGCLHYCLEES
FT                   NGRRCACAPGYELADDHMRCKSTVNFPCGKLGRWIEKKRKILKRDTDLEDELEPDPRIV
FT                   NGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCVEGTKKLTVRLGEYDLRR
FT                   RDHWELDLDIKEILVHPNYTRSSSDNDIALLRLAQPATLSKTIVPICLPNNGLAQELTQ
FT                   AGQETVVTGWGYQSDRIKDGRRNRTFILTFIRIPLVARNECVEVMKNVVSENMLCAGII
FT                   GDTRDACDGDSGGPMVVFFRGTWFLVGLVSWGEGCGHTNNYGIYTKVGSYLKWIHSYIG
FT                   EKGVSLKSQKL"
FT   CDS             complement(join(16036755..16037341,16038620..16038737,
FT                   16040924..16041069,16046676..16046810,16046905..16047042,
FT                   16047162..16047186,16048380..16048543,16049391..16049481,
FT                   16051069..16051074))
FT                   /codon_start=1
FT                   /gene="Proc"
FT                   /locus_tag="mCG_127145"
FT                   /product="protein C, isoform CRA_a"
FT                   /note="gene_id=mCG127145.1 transcript_id=mCT169885.0
FT                   protein_id=mCP92525.0 isoform=CRA_a"
FT                   /protein_id="EDK97055.1"
FT                   /translation="METGVSSSRMWQFRVFLLLMSTWGISSIPAHPDPVFSSSEHAHQV
FT                   LRVRRANSFLEEMRPGSLERECMEEICDFEEAQEIFQNVEDTLAFWIKYFDGDQCSAPP
FT                   LDHQCDSPCCGHGTCIDGIGSFSCSCDKGWEGKFCQQELRFQDCRVNNGGCLHYCLEES
FT                   NGRRCACAPGYELADDHMRCKSTVNFPCGKLGRWIEKKRKILKRDTDLEDELEPDPRIV
FT                   NGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCVEGTKKLTVRLGEYDLRR
FT                   RDHWELDLDIKEILVHPNYTRSSSDNDIALLRLAQPATLSKTIVPICLPNNGLAQELTQ
FT                   AGQETVVTGWGYQSDRIKDGRRNRTFILTFIRIPLVARNECVEVMKNVVSENMLCAGII
FT                   GDTRDACDGDSGGPMVVFFRGTWFLVGLVSWGEGCGHTNNYGIYTKVGSYLKWIHSYIG
FT                   EKGVSLKSQKL"
FT   gap             16052571..16052614
FT                   /estimated_length=44
FT   gene            16054224..16055337
FT                   /pseudo
FT                   /locus_tag="mCG_1031660"
FT                   /note="gene_id=mCG1031660.1"
FT   mRNA            16054224..16055337
FT                   /pseudo
FT                   /locus_tag="mCG_1031660"
FT                   /note="gene_id=mCG1031660.1 transcript_id=mCT149364.1
FT                   created on 03-JUN-2002"
FT   gap             16076444..16076463
FT                   /estimated_length=20
FT   gene            16076808..16142184
FT                   /gene="Map3k2"
FT                   /locus_tag="mCG_127139"
FT                   /note="gene_id=mCG127139.1"
FT   mRNA            join(16076808..16077162,16105511..16105580,
FT                   16110340..16110458,16112151..16112191,16113439..16113538,
FT                   16116526..16116639,16117300..16117387,16120908..16121038,
FT                   16122142..16122221,16123229..16123296,16123444..16123536,
FT                   16125462..16125668,16130645..16130793,16131861..16131992,
FT                   16134181..16134310,16140228..16140405,16141799..16142184)
FT                   /gene="Map3k2"
FT                   /locus_tag="mCG_127139"
FT                   /product="mitogen activated protein kinase kinase kinase 2"
FT                   /note="gene_id=mCG127139.1 transcript_id=mCT128420.0
FT                   created on 03-JUN-2002"
FT   CDS             join(16105577..16105580,16110340..16110458,
FT                   16112151..16112191,16113439..16113538,16116526..16116639,
FT                   16117300..16117387,16120908..16121038,16122142..16122221,
FT                   16123229..16123296,16123444..16123536,16125462..16125668,
FT                   16130645..16130793,16131861..16131992,16134181..16134310,
FT                   16140228..16140405,16141799..16142024)
FT                   /codon_start=1
FT                   /gene="Map3k2"
FT                   /locus_tag="mCG_127139"
FT                   /product="mitogen activated protein kinase kinase kinase 2"
FT                   /note="gene_id=mCG127139.1 transcript_id=mCT128420.0
FT                   protein_id=mCP69224.1"
FT                   /db_xref="GOA:G5E8L8"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1346873"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8L8"
FT                   /protein_id="EDK97056.1"
FT                   /translation="MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKPSSPKKQNDVR
FT                   VKFEHRGEKRILQVTRPVKLEDLRSKSKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVE
FT                   LLDRSIHMKSLKILLVVNGSTQATNLEPSPSPEDLNNTPLGAERKKRLSVVGPPNRDRS
FT                   SPPPGYIPDELHQIARNGSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDS
FT                   PLDGESYPKSRMPRAQSYPDNHQEFTDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGR
FT                   KTFPRARRTQGTSFRSPVSFSPTDHSLSTSSGSSVFTPEYDDSRIRRRGSDIDNPTLTV
FT                   TDISPPSRSPRAPTNWRLGKLLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESPETSKE
FT                   VNALECEIQLLKNLLHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTEN
FT                   VTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTICLSGTG
FT                   MKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQ
FT                   PTNPKLPPHVSDYTRDFLKRIFVEAKLRPSAEELLRHMFVHYH"
FT   gap             16107768..16107922
FT                   /estimated_length=155
FT   gap             16132908..16132927
FT                   /estimated_length=20
FT   gene            16153943..16184011
FT                   /gene="Ercc3"
FT                   /locus_tag="mCG_127150"
FT                   /note="gene_id=mCG127150.2"
FT   mRNA            join(16153943..16154097,16154306..16154511,
FT                   16156635..16156871,16158470..16158519,16159350..16159485,
FT                   16159613..16159780,16160428..16160632,16162024..16162338,
FT                   16167942..16168126,16171051..16171253,16175163..16175259,
FT                   16178409..16178526,16179479..16179597,16181025..16181177,
FT                   16183619..16184009)
FT                   /gene="Ercc3"
FT                   /locus_tag="mCG_127150"
FT                   /product="excision repair cross-complementing rodent repair
FT                   deficiency, complementation group 3, transcript variant
FT                   mCT128431"
FT                   /note="gene_id=mCG127150.2 transcript_id=mCT128431.0
FT                   created on 03-JUN-2002"
FT   mRNA            join(<16154030..16154097,16154306..16154511,
FT                   16156635..16156871,16158470..16158519,16159350..16159780,
FT                   16160428..16160632,16162024..16162338,16167942..16168126,
FT                   16171051..16171253,16175163..16175259,16178409..16178526,
FT                   16179479..16179597,16181025..16181177,16183619..16184011)
FT                   /gene="Ercc3"
FT                   /locus_tag="mCG_127150"
FT                   /product="excision repair cross-complementing rodent repair
FT                   deficiency, complementation group 3, transcript variant
FT                   mCT188859"
FT                   /note="gene_id=mCG127150.2 transcript_id=mCT188859.0
FT                   created on 08-MAR-2004"
FT   CDS             join(16154070..16154097,16154306..16154511,
FT                   16156635..16156871,16158470..16158519,16159350..16159485,
FT                   16159613..16159780,16160428..16160632,16162024..16162338,
FT                   16167942..16168126,16171051..16171253,16175163..16175259,
FT                   16178409..16178526,16179479..16179597,16181025..16181177,
FT                   16183619..16183750)
FT                   /codon_start=1
FT                   /gene="Ercc3"
FT                   /locus_tag="mCG_127150"
FT                   /product="excision repair cross-complementing rodent repair
FT                   deficiency, complementation group 3, isoform CRA_b"
FT                   /note="gene_id=mCG127150.2 transcript_id=mCT128431.0
FT                   protein_id=mCP69316.1 isoform=CRA_b"
FT                   /protein_id="EDK97058.1"
FT                   /translation="MGKRDRVDRDKKKSKKRQYEEEEEDEDDIPGNESQEAVPSAAGKQ
FT                   VDESSTKVDEYGAKDYRQQMPLKGDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIA
FT                   EPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIIQFIKLCTVSY
FT                   GKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECRLRNAEGEATELITETFTSKSAISK
FT                   TAAEGSGGPSTSQGVDAQATSDIPKDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEEL
FT                   QKRCICLEYPLLAEYDFRNDTLNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIV
FT                   LPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKD
FT                   KPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPARMFRRVLTI
FT                   VQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSP
FT                   EFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRL
FT                   NKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRR
FT                   QEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKL
FT                   AGMEEEELAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSGQASRRCGTMSSLSG
FT                   ADDTVYMEYHSSRSKASSKHVHPLFKRFRK"
FT   gap             16158573..16158777
FT                   /estimated_length=205
FT   CDS             join(<16159526..16159780,16160428..16160632,
FT                   16162024..16162338,16167942..16168126,16171051..16171253,
FT                   16175163..16175259,16178409..16178526,16179479..16179597,
FT                   16181025..16181177,16183619..16183750)
FT                   /codon_start=1
FT                   /gene="Ercc3"
FT                   /locus_tag="mCG_127150"
FT                   /product="excision repair cross-complementing rodent repair
FT                   deficiency, complementation group 3, isoform CRA_a"
FT                   /note="gene_id=mCG127150.2 transcript_id=mCT188859.0
FT                   protein_id=mCP109854.0 isoform=CRA_a"
FT                   /protein_id="EDK97057.1"
FT                   /translation="DLSFPGPQHSFSSWLVTRCRVWIPTFLSQISKTAAEGSGGPSTSQ
FT                   GVDAQATSDIPKDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCICLEYPLLA
FT                   EYDFRNDTLNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVT
FT                   AACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYS
FT                   MLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPARMFRRVLTIVQAHCKLGLTATL
FT                   VREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKK
FT                   RILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGE
FT                   RMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAK
FT                   KGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEELAFSTK
FT                   EEQQQLLQKVLAATDLDAEEEVVAGEFGSRSGQASRRCGTMSSLSGADDTVYMEYHSSR
FT                   SKASSKHVHPLFKRFRK"
FT   gap             16187253..16187272
FT                   /estimated_length=20
FT   gap             16226239..16226258
FT                   /estimated_length=20
FT   gap             16238894..16239036
FT                   /estimated_length=143
FT   gap             16260825..16260844
FT                   /estimated_length=20
FT   gap             16270190..16270209
FT                   /estimated_length=20
FT   gap             16271733..16271930
FT                   /estimated_length=198
FT   gene            complement(16273182..>16292530)
FT                   /locus_tag="mCG_144471"
FT                   /note="gene_id=mCG144471.0"
FT   mRNA            complement(join(16273182..16273560,16285682..16285835,
FT                   16291933..>16292530))
FT                   /locus_tag="mCG_144471"
FT                   /product="mCG144471"
FT                   /note="gene_id=mCG144471.0 transcript_id=mCT183895.0
FT                   created on 05-JUN-2003"
FT   gap             16273997..16274396
FT                   /estimated_length=400
FT   gap             16281017..16281475
FT                   /estimated_length=459
FT   CDS             complement(join(16285747..16285835,16291933..>16292113))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144471"
FT                   /product="mCG144471"
FT                   /note="gene_id=mCG144471.0 transcript_id=mCT183895.0
FT                   protein_id=mCP105281.0"
FT                   /protein_id="EDK97059.1"
FT                   /translation="DRLPPPPHTSPAWIARLGLEYWGSPPSLLTLGLHGRARVDPASED
FT                   QTGAWASTSLQKSHEGVQVFHCCVRCAPHACLRPKEARRVHHIP"
FT   gene            <16291490..16352091
FT                   /gene="Bin1"
FT                   /locus_tag="mCG_127143"
FT                   /note="gene_id=mCG127143.3"
FT   mRNA            join(<16291490..16291735,16320342..16320422,
FT                   16326977..16327031,16327173..16327267,16327651..16327746,
FT                   16328739..16328846,16334399..16334484,16334625..16334700,
FT                   16336434..16336516,16339372..16339519,16340776..16340904,
FT                   16346222..16346293,16346534..16346644,16346875..16346976,
FT                   16349687..16350288)
FT                   /gene="Bin1"
FT                   /locus_tag="mCG_127143"
FT                   /product="bridging integrator 1, transcript variant
FT                   mCT188864"
FT                   /note="gene_id=mCG127143.3 transcript_id=mCT188864.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<16291490..16291735,16320342..16320422,
FT                   16326977..16327031,16327173..16327267,16327651..16327746,
FT                   16328739..16328846,16334399..16334484,16334625..16334700,
FT                   16336434..16336516,16339372..16339519,16340776..16340904,
FT                   16346222..16346293,16346534..16346644,16346875..16346976,
FT                   16349687..16349794)
FT                   /codon_start=1
FT                   /gene="Bin1"
FT                   /locus_tag="mCG_127143"
FT                   /product="bridging integrator 1, isoform CRA_b"
FT                   /note="gene_id=mCG127143.3 transcript_id=mCT188864.0
FT                   protein_id=mCP109850.0 isoform=CRA_b"
FT                   /protein_id="EDK97061.1"
FT                   /translation="RARSVSVSPLSCSSARRGARAQAGGAAGAGGWECGAHGLPAPLSA
FT                   LASGEAGARMAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQN
FT                   FNKQLTEGTRLQKDLRTYLASVKAMHEASKKLSECLQEVYEPEWPGRDEANKIAENNDL
FT                   LWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDE
FT                   AKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSK
FT                   LNQNLNDVLVSLEKQHGSNTFTVKAQPSDNAPEKGNKSPSPPPDGSPAATPEIRVNHEP
FT                   EPASGASPGATIPKSPSQLRKGPPVPPPPKHTPSKEMKQEQILSLFDDAFVPEISVTTP
FT                   SQPAEASEVVGGAQEPGETAASEATSSSLPAVVVETFSATVNGAVEGSAGTGRLDLPPG
FT                   FMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEK
FT                   CRGVFPENFTERVQ"
FT   mRNA            join(16291509..16291735,16320342..16320422,
FT                   16326977..16327031,16327173..16327267,16327651..16327746,
FT                   16328739..16328846,16329501..16329593,16334399..16334484,
FT                   16334625..16334700,16336434..16336516,16339372..16339519,
FT                   16340776..16340904,16343749..16343856,16344253..16344276,
FT                   16345301..16345408,16346222..16346293,16346534..16346644,
FT                   16346875..16346976,16349687..16352091)
FT                   /gene="Bin1"
FT                   /locus_tag="mCG_127143"
FT                   /product="bridging integrator 1, transcript variant
FT                   mCT128424"
FT                   /note="gene_id=mCG127143.3 transcript_id=mCT128424.1
FT                   created on 02-JUN-2003"
FT   CDS             join(16291652..16291735,16320342..16320422,
FT                   16326977..16327031,16327173..16327267,16327651..16327746,
FT                   16328739..16328846,16329501..16329593,16334399..16334484,
FT                   16334625..16334700,16336434..16336516,16339372..16339519,
FT                   16340776..16340904,16343749..16343856,16344253..16344276,
FT                   16345301..16345408,16346222..16346293,16346534..16346644,
FT                   16346875..16346976,16349687..16349794)
FT                   /codon_start=1
FT                   /gene="Bin1"
FT                   /locus_tag="mCG_127143"
FT                   /product="bridging integrator 1, isoform CRA_a"
FT                   /note="gene_id=mCG127143.3 transcript_id=mCT128424.1
FT                   protein_id=mCP68992.1 isoform=CRA_a"
FT                   /protein_id="EDK97060.1"
FT                   /translation="MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFE
FT                   QCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLSECLQEVYEPEWPGRDEANKIA
FT                   ENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTA
FT                   KKKDEAKIAKPVSLLEKAAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVD
FT                   LQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVSLEKQHGSNTFTV
FT                   KAQPSDNAPEKGNKSPSPPPDGSPAATPEIRVNHEPEPASGASPGATIPKSPSQLRKGP
FT                   PVPPPPKHTPSKEMKQEQILSLFDDAFVPEISVTTPSQFEAPGPFSEQASLLDLDFEPL
FT                   PPVASPVKAPTPSGQSIPWDLWEPTESQAGILPSGEPSSAEGSFAVAWPSQIAEPGPAQ
FT                   PAEASEVVGGAQEPGETAASEATSSSLPAVVVETFSATVNGAVEGSAGTGRLDLPPGFM
FT                   FKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCR
FT                   GVFPENFTERVQ"
FT   gap             16323392..16323719
FT                   /estimated_length=328
FT   gap             16372190..16372633
FT                   /estimated_length=444
FT   gap             16378840..16378859
FT                   /estimated_length=20
FT   gap             16403557..16403576
FT                   /estimated_length=20
FT   gap             16408447..16409555
FT                   /estimated_length=1109
FT   gap             16410162..16411560
FT                   /estimated_length=1399
FT   gap             16418813..16420374
FT                   /estimated_length=1562
FT   gap             16424266..16424314
FT                   /estimated_length=49
FT   gene            complement(16442672..>16474317)
FT                   /gene="Gypc"
FT                   /locus_tag="mCG_127152"
FT                   /note="gene_id=mCG127152.2"
FT   mRNA            complement(join(16442672..16444552,16447085..16447135,
FT                   16474154..>16474317))
FT                   /gene="Gypc"
FT                   /locus_tag="mCG_127152"
FT                   /product="glycophorin C"
FT                   /note="gene_id=mCG127152.2 transcript_id=mCT128433.1
FT                   created on 02-JUN-2003"
FT   CDS             complement(16443958..>16444407)
FT                   /codon_start=1
FT                   /gene="Gypc"
FT                   /locus_tag="mCG_127152"
FT                   /product="glycophorin C"
FT                   /note="gene_id=mCG127152.2 transcript_id=mCT128433.1
FT                   protein_id=mCP69050.2"
FT                   /protein_id="EDK97062.1"
FT                   /translation="PCPPGCWGHQQEGILYLRGSRLDIPARCFWLQERKYPRCVPPLSA
FT                   PGSPQGHPKTLTAEHWVPARKPIQMGGVKAQSTLPGTQWPPSGIGFARKREHLDTQVSL
FT                   GNAGIISPAWKSSSVCMRWSGPGSGTYRSGTSRSCLEMMASSVSH"
FT   gap             16477054..16477366
FT                   /estimated_length=313
FT   gap             16506838..16507079
FT                   /estimated_length=242
FT   gap             16546352..16546376
FT                   /estimated_length=25
FT   gap             16563286..16563439
FT                   /estimated_length=154
FT   gene            complement(16578124..>16740343)
FT                   /locus_tag="mCG_145773"
FT                   /note="gene_id=mCG145773.0"
FT   mRNA            complement(join(16578124..16578286,16657668..16657795,
FT                   16658071..16658137,16735813..16736762,16740034..>16740343))
FT                   /locus_tag="mCG_145773"
FT                   /product="mCG145773"
FT                   /note="gene_id=mCG145773.0 transcript_id=mCT185869.0
FT                   created on 19-JUN-2003"
FT   gap             16596518..16603327
FT                   /estimated_length=6810
FT   gap             16613794..16615825
FT                   /estimated_length=2032
FT   gap             16674142..16674327
FT                   /estimated_length=186
FT   gap             16687520..16689262
FT                   /estimated_length=1743
FT   gap             16694665..16698541
FT                   /estimated_length=3877
FT   gap             16715312..16715365
FT                   /estimated_length=54
FT   gene            16718420..16722824
FT                   /gene="Tslp"
FT                   /locus_tag="mCG_119968"
FT                   /note="gene_id=mCG119968.1"
FT   mRNA            join(16718420..16718440,16718605..16718744,
FT                   16719487..16719522,16720092..16720226,16722031..16722824)
FT                   /gene="Tslp"
FT                   /locus_tag="mCG_119968"
FT                   /product="thymic stromal lymphopoietin"
FT                   /note="gene_id=mCG119968.1 transcript_id=mCT121147.0
FT                   created on 03-JUN-2002"
FT   CDS             join(16718437..16718440,16718605..16718744,
FT                   16719487..16719522,16720092..16720226,16722031..16722138)
FT                   /codon_start=1
FT                   /gene="Tslp"
FT                   /locus_tag="mCG_119968"
FT                   /product="thymic stromal lymphopoietin"
FT                   /note="gene_id=mCG119968.1 transcript_id=mCT121147.0
FT                   protein_id=mCP69034.1"
FT                   /protein_id="EDK97064.1"
FT                   /translation="MVLLRSLFILQVLVRMGLTYNFSNCNFTSITKIYCNIIFHDLTGD
FT                   LKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPET
FT                   ERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE"
FT   CDS             complement(join(16736579..16736762,16740034..>16740107))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145773"
FT                   /product="mCG145773"
FT                   /note="gene_id=mCG145773.0 transcript_id=mCT185869.0
FT                   protein_id=mCP107127.0"
FT                   /protein_id="EDK97063.1"
FT                   /translation="AEETRTGIINGVKPRDHRIFVKKLKSCAAPDKNPSTMKETCAQSP
FT                   THNQEVSAIDIWKRENKSGLDSVMLLCISTMLQGRAYSQE"
FT   gene            16740265..16770032
FT                   /gene="Wdr36"
FT                   /locus_tag="mCG_119970"
FT                   /note="gene_id=mCG119970.1"
FT   mRNA            join(16740265..16740612,16742487..16742514,
FT                   16744098..16744198,16744952..16745069,16746817..16746949,
FT                   16748646..16748700,16749885..16750017,16750197..16750372,
FT                   16750644..16750764,16751351..16751416,16752128..16752214,
FT                   16753442..16753590,16755038..16755152,16755542..16755707,
FT                   16755921..16756029,16757837..16757916,16762277..16762384,
FT                   16764084..16764181,16764559..16764704,16766012..16766131,
FT                   16766268..16766349,16767739..16767926,16768939..16769004,
FT                   16769274..16770032)
FT                   /gene="Wdr36"
FT                   /locus_tag="mCG_119970"
FT                   /product="WD repeat domain 36, transcript variant
FT                   mCT121149"
FT                   /note="gene_id=mCG119970.1 transcript_id=mCT121149.1
FT                   created on 03-JUN-2002"
FT   mRNA            join(<16740307..16740612,16742487..16742514,
FT                   16744098..16744198,16744952..16745069,16746817..16746949,
FT                   16748646..16748700,16749885..16750017,16750197..16750372,
FT                   16750644..16750764,16751351..16751416,16752128..16752214,
FT                   16753442..16753590,16755038..16755152,16755542..16755707,
FT                   16755921..16756029,16757837..16757916,16762277..16762384,
FT                   16764084..16764181,16764559..16764704,16766012..16766131,
FT                   16766268..16766349,16767739..16767926,16768939..16769116)
FT                   /gene="Wdr36"
FT                   /locus_tag="mCG_119970"
FT                   /product="WD repeat domain 36, transcript variant
FT                   mCT188856"
FT                   /note="gene_id=mCG119970.1 transcript_id=mCT188856.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<16740307..16740612,16742487..16742514,
FT                   16744098..16744198,16744952..16745069,16746817..16746949,
FT                   16748646..16748700,16749885..16750017,16750197..16750372,
FT                   16750644..16750764,16751351..16751416,16752128..16752214,
FT                   16753442..16753590,16755038..16755152,16755542..16755707,
FT                   16755921..16756029,16757837..16757916,16762277..16762384,
FT                   16764084..16764181,16764559..16764704,16766012..16766131,
FT                   16766268..16766349,16767739..16767926,16768939..16769088)
FT                   /codon_start=1
FT                   /gene="Wdr36"
FT                   /locus_tag="mCG_119970"
FT                   /product="WD repeat domain 36, isoform CRA_b"
FT                   /note="gene_id=mCG119970.1 transcript_id=mCT188856.0
FT                   protein_id=mCP109823.0 isoform=CRA_b"
FT                   /protein_id="EDK97066.1"
FT                   /translation="VPVPSAPDPGSTPRSPAPARALPGACCGSPGTHSPPGRELSGIPS
FT                   MAEMESAVEGRTASVLFAGFRALGLFSNEVPHVVRYSALKRRFYVTTCVGKSFHTYDVQ
FT                   KLSLVAVSNSVPQDICCMAADGRLVFAAYGNVFSAFARNKEIVHTFKGHKAEIHLLQPF
FT                   GDHVISVDTDSVLIIWHIYSEEEYLQLTFDKSVFKISTILHPSTYLNKVLLGSEQGSLQ
FT                   LWNIKSNKLLYTFPGWKVGVTALQQAPAVDVVAIGLVSGQVVIHNIKYDETLMKFHQDW
FT                   GPITSISFRTDGHPIMAAGSPCGHIGLWDLEDKKLINQMRNAHSTAISGLTFLHREPLL
FT                   VTNGADNALRIWIFDGPAGEGRLLRFRMGHSASLTKIRYYGQNGQQILSASQDGTLQSF
FT                   STVHEKFNKSLGHGLVNKKIVKRKGLQNTMSVRLPPITQFAAEEARQSDWDGIIACHQG
FT                   KRSCSTWNYQRSTIGAYFLKPRGVKTNSNLTATAVDITSCGNFAIIGLSSGAVDVYNMQ
FT                   SGIHRGNFGDDKAHTGSVRGVAVDGLNQLVVTAGSERLLKFWNFKSKVLIHSLGLDSSP
FT                   NMMLLHRDSGILGLAMDDFSIAVLDIETRKIVREFSGHHGQINDMTFSPDGRWLISAAM
FT                   DCSVRTWDLPSGCLIDCFLLDSAPLNVTMSPTGDFLATSHVDHLGIYLWSNISLYSVVS
FT                   LRPLPPDYVPSIVMLPGTCQTQGMEDLEEKTEPSDEMIEYESPEQLSEQLVTLSLLPES
FT                   RWKNLLNLDVIKKKNKPKEPPKVPQSAPFFIPTVPGLVPRFAVPEPSSDPQQSKVVNLG
FT                   ILAQKSNFYLKLEEGLLNNQYEAALNLLKELGPSGIETELRNLSPDDGGSVEVMRSFLS
FT                   MIGMMLDRKRDFELAQAYLALFLKLHLRTLPSEPALLEELVKLSSQVEKDWTHLQSLFN
FT                   QSMCVLNYIKSAFL"
FT   CDS             join(16740442..16740612,16742487..16742514,
FT                   16744098..16744198,16744952..16745069,16746817..16746949,
FT                   16748646..16748700,16749885..16750017,16750197..16750372,
FT                   16750644..16750764,16751351..16751416,16752128..16752214,
FT                   16753442..16753590,16755038..16755152,16755542..16755707,
FT                   16755921..16756029,16757837..16757916,16762277..16762384,
FT                   16764084..16764181,16764559..16764704,16766012..16766131,
FT                   16766268..16766349,16767739..16767926,16768939..16769004,
FT                   16769274..16769309)
FT                   /codon_start=1
FT                   /gene="Wdr36"
FT                   /locus_tag="mCG_119970"
FT                   /product="WD repeat domain 36, isoform CRA_a"
FT                   /note="gene_id=mCG119970.1 transcript_id=mCT121149.1
FT                   protein_id=mCP69248.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TA68"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007319"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="MGI:MGI:1917819"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TA68"
FT                   /protein_id="EDK97065.1"
FT                   /translation="MAEMESAVEGRTASVLFAGFRALGLFSNEVPHVVRYSALKRRFYV
FT                   TTCVGKSFHTYDVQKLSLVAVSNSVPQDICCMAADGRLVFAAYGNVFSAFARNKEIVHT
FT                   FKGHKAEIHLLQPFGDHVISVDTDSVLIIWHIYSEEEYLQLTFDKSVFKISTILHPSTY
FT                   LNKVLLGSEQGSLQLWNIKSNKLLYTFPGWKVGVTALQQAPAVDVVAIGLVSGQVVIHN
FT                   IKYDETLMKFHQDWGPITSISFRTDGHPIMAAGSPCGHIGLWDLEDKKLINQMRNAHST
FT                   AISGLTFLHREPLLVTNGADNALRIWIFDGPAGEGRLLRFRMGHSASLTKIRYYGQNGQ
FT                   QILSASQDGTLQSFSTVHEKFNKSLGHGLVNKKIVKRKGLQNTMSVRLPPITQFAAEEA
FT                   RQSDWDGIIACHQGKRSCSTWNYQRSTIGAYFLKPRGVKTNSNLTATAVDITSCGNFAI
FT                   IGLSSGAVDVYNMQSGIHRGNFGDDKAHTGSVRGVAVDGLNQLVVTAGSERLLKFWNFK
FT                   SKVLIHSLGLDSSPNMMLLHRDSGILGLAMDDFSIAVLDIETRKIVREFSGHHGQINDM
FT                   TFSPDGRWLISAAMDCSVRTWDLPSGCLIDCFLLDSAPLNVTMSPTGDFLATSHVDHLG
FT                   IYLWSNISLYSVVSLRPLPPDYVPSIVMLPGTCQTQGMEDLEEKTEPSDEMIEYESPEQ
FT                   LSEQLVTLSLLPESRWKNLLNLDVIKKKNKPKEPPKVPQSAPFFIPTVPGLVPRFAVPE
FT                   PSSDPQQSKVVNLGILAQKSNFYLKLEEGLLNNQYEAALNLLKELGPSGIETELRNLSP
FT                   DDGGSVEVMRSFLSMIGMMLDRKRDFELAQAYLALFLKLHLRTLPSEPALLEELVKLSS
FT                   QKLCTSRELKTT"
FT   gap             16771091..16771110
FT                   /estimated_length=20
FT   gene            complement(16818882..>16842350)
FT                   /locus_tag="mCG_145774"
FT                   /note="gene_id=mCG145774.0"
FT   mRNA            complement(join(16818882..16819786,16827015..16827097,
FT                   16842039..>16842350))
FT                   /locus_tag="mCG_145774"
FT                   /product="mCG145774"
FT                   /note="gene_id=mCG145774.0 transcript_id=mCT185870.0
FT                   created on 19-JUN-2003"
FT   CDS             complement(16842087..>16842350)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145774"
FT                   /product="mCG145774"
FT                   /note="gene_id=mCG145774.0 transcript_id=mCT185870.0
FT                   protein_id=mCP107128.0"
FT                   /protein_id="EDK97067.1"
FT                   /translation="REHRRRGTRSHRQPAETRQGTAELRRPPPRSRRPTSVPPSRLPCQ
FT                   PPPCALPSRLRLPQGHLKHLPGEATRTPRVHLPPRPRQEPAA"
FT   gene            16842460..17066887
FT                   /gene="Camk4"
FT                   /locus_tag="mCG_140514"
FT                   /note="gene_id=mCG140514.1"
FT   mRNA            join(16842460..16842672,16982273..16982335,
FT                   16984158..16984240,17009733..17009805,17036756..17036770)
FT                   /gene="Camk4"
FT                   /locus_tag="mCG_140514"
FT                   /product="calcium/calmodulin-dependent protein kinase IV,
FT                   transcript variant mCT185121"
FT                   /note="gene_id=mCG140514.1 transcript_id=mCT185121.0
FT                   created on 02-JUN-2003"
FT   mRNA            join(16842487..16842672,16951874..16951952,
FT                   16982273..16982335,16984158..16984240,17009733..17009805,
FT                   17036756..17036846,17038834..17038908,17056166..17056241,
FT                   17059504..17059630,17062244..17062396,17064721..17066887)
FT                   /gene="Camk4"
FT                   /locus_tag="mCG_140514"
FT                   /product="calcium/calmodulin-dependent protein kinase IV,
FT                   transcript variant mCT169876"
FT                   /note="gene_id=mCG140514.1 transcript_id=mCT169876.0
FT                   created on 02-JUN-2003"
FT   CDS             join(16842524..16842672,16951874..16951952,
FT                   16982273..16982335,16984158..16984240,17009733..17009805,
FT                   17036756..17036846,17038834..17038908,17056166..17056241,
FT                   17059504..17059630,17062244..17062396,17064721..17065161)
FT                   /codon_start=1
FT                   /gene="Camk4"
FT                   /locus_tag="mCG_140514"
FT                   /product="calcium/calmodulin-dependent protein kinase IV,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG140514.1 transcript_id=mCT169876.0
FT                   protein_id=mCP92531.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BGR3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:88258"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BGR3"
FT                   /protein_id="EDK97068.1"
FT                   /translation="MLKVTVPSCPSSPCSSVTASTENLVPDYWIDGSNRDPLGDFFEVE
FT                   SELGRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIF
FT                   ETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKP
FT                   ENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWS
FT                   VGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDP
FT                   KKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASS
FT                   SHTSIQENHKASSDPPSTQDAKDSTDLLGKKMQEEDQEEDQVEAEASADEMRKLQSEEV
FT                   EKDAGVKEEETSSMVPQDPEDELETDDPEMKRDSEEKLKSVEEEMDPMTEEEAPDAGLG
FT                   VPQQDAIQPEY"
FT   CDS             join(16842524..16842672,16982273..16982291)
FT                   /codon_start=1
FT                   /gene="Camk4"
FT                   /locus_tag="mCG_140514"
FT                   /product="calcium/calmodulin-dependent protein kinase IV,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG140514.1 transcript_id=mCT185121.0
FT                   protein_id=mCP106379.0 isoform=CRA_b"
FT                   /protein_id="EDK97069.1"
FT                   /translation="MLKVTVPSCPSSPCSSVTASTENLVPDYWIDGSNRDPLGDFFEVE
FT                   SELGRWTRRL"
FT   gene            16862941..16864600
FT                   /locus_tag="mCG_146823"
FT                   /note="gene_id=mCG146823.0"
FT   mRNA            16862941..16864600
FT                   /locus_tag="mCG_146823"
FT                   /product="mCG146823"
FT                   /note="gene_id=mCG146823.0 transcript_id=mCT187086.0
FT                   created on 13-JAN-2004"
FT   CDS             16863265..16863585
FT                   /codon_start=1
FT                   /locus_tag="mCG_146823"
FT                   /product="mCG146823"
FT                   /note="gene_id=mCG146823.0 transcript_id=mCT187086.0
FT                   protein_id=mCP108179.0"
FT                   /protein_id="EDK97070.1"
FT                   /translation="MFKATHKRKPSVDIYGFRGLVSRVTSKDIMAGTAERSHLDSQAGS
FT                   REDLTVYLQGHTSSNKDTPLFNPFLLFHQLQTKWTTIQAYAACSHSNTIGGKEFSLETA
FT                   HH"
FT   gap             16986948..16993078
FT                   /estimated_length=6131
FT   gap             17031975..17032066
FT                   /estimated_length=92
FT   gap             17062438..17062842
FT                   /estimated_length=405
FT   gene            complement(17079101..17094007)
FT                   /gene="Stard4"
FT                   /locus_tag="mCG_119969"
FT                   /note="gene_id=mCG119969.1"
FT   mRNA            complement(join(17079101..17083774,17085243..17085357,
FT                   17086310..17086436,17088366..17088415,17089231..17089345,
FT                   17093822..17094007))
FT                   /gene="Stard4"
FT                   /locus_tag="mCG_119969"
FT                   /product="StAR-related lipid transfer (START) domain
FT                   containing 4"
FT                   /note="gene_id=mCG119969.1 transcript_id=mCT121148.0
FT                   created on 04-JUN-2002"
FT   CDS             complement(join(17083545..17083774,17085243..17085357,
FT                   17086310..17086436,17088366..17088415,17089231..17089345,
FT                   17093822..17093859))
FT                   /codon_start=1
FT                   /gene="Stard4"
FT                   /locus_tag="mCG_119969"
FT                   /product="StAR-related lipid transfer (START) domain
FT                   containing 4"
FT                   /note="gene_id=mCG119969.1 transcript_id=mCT121148.0
FT                   protein_id=mCP69040.1"
FT                   /protein_id="EDK97071.1"
FT                   /translation="MADPESPWSQIGRKIKLEGLSDVASMSTKLQNTLIQYHSIKEDEW
FT                   RVAKKVKDVTVWRKPSEEFNGYLYKAQGVMDDVVNNVIDHIRPGPWRLDWDRLMTSLDV
FT                   LEHFEENCCVMRYTTAGQLLNIISPREFVDFSYTVGYEEGLLSCGVSVEWSETRPEFVR
FT                   GYNHPCGWFCVPLKDSPSQSLLIGYIQTDLRGMIPQSAVDTAMASTLANFYSDLRKALR
FT                   KA"
FT   gap             17109860..17112988
FT                   /estimated_length=3129
FT   gap             17191835..17191945
FT                   /estimated_length=111
FT   gap             17204677..17208640
FT                   /estimated_length=3964
FT   gap             17225879..17225898
FT                   /estimated_length=20
FT   gap             17248098..17248120
FT                   /estimated_length=23
FT   gap             17252006..17252025
FT                   /estimated_length=20
FT   gap             17254740..17254759
FT                   /estimated_length=20
FT   gene            complement(17263777..17264823)
FT                   /pseudo
FT                   /locus_tag="mCG_119972"
FT                   /note="gene_id=mCG119972.1"
FT   mRNA            complement(17263777..17264823)
FT                   /pseudo
FT                   /locus_tag="mCG_119972"
FT                   /note="gene_id=mCG119972.1 transcript_id=mCT121151.1
FT                   created on 04-JUN-2002"
FT   gap             17289315..17289483
FT                   /estimated_length=169
FT   gap             17297043..17300223
FT                   /estimated_length=3181
FT   gap             17303483..17303502
FT                   /estimated_length=20
FT   gene            complement(17316683..17343738)
FT                   /gene="D0H4S114"
FT                   /locus_tag="mCG_119971"
FT                   /note="gene_id=mCG119971.1"
FT   mRNA            complement(join(17316683..17318500,17322483..17322560,
FT                   17341698..17341764,17343699..17343738))
FT                   /gene="D0H4S114"
FT                   /locus_tag="mCG_119971"
FT                   /product="DNA segment, human D4S114, transcript variant
FT                   mCT121150"
FT                   /note="gene_id=mCG119971.1 transcript_id=mCT121150.1
FT                   created on 19-JUN-2003"
FT   mRNA            complement(join(17316818..17318500,17319691..17319751,
FT                   17322483..17322560,17341698..>17341764))
FT                   /gene="D0H4S114"
FT                   /locus_tag="mCG_119971"
FT                   /product="DNA segment, human D4S114, transcript variant
FT                   mCT185871"
FT                   /note="gene_id=mCG119971.1 transcript_id=mCT185871.0
FT                   created on 19-JUN-2003"
FT   CDS             complement(join(17318375..17318500,17319691..17319751,
FT                   17322483..17322560,17341698..>17341762))
FT                   /codon_start=1
FT                   /gene="D0H4S114"
FT                   /locus_tag="mCG_119971"
FT                   /product="DNA segment, human D4S114, isoform CRA_b"
FT                   /note="gene_id=mCG119971.1 transcript_id=mCT185871.0
FT                   protein_id=mCP107129.0 isoform=CRA_b"
FT                   /protein_id="EDK97073.1"
FT                   /translation="WSPWTEGRENRRSPRLLRVSKWFTTQNSWSGSAKNRLHTRKWREV
FT                   LLSVFFPGCQEIVGLSLKNQHTSGRLPVPKEVNRKKMEETGAASLTPPGSREFTSPATS
FT                   YLHPF"
FT   CDS             complement(join(17318375..17318500,17322483..17322560,
FT                   17341698..17341700))
FT                   /codon_start=1
FT                   /gene="D0H4S114"
FT                   /locus_tag="mCG_119971"
FT                   /product="DNA segment, human D4S114, isoform CRA_a"
FT                   /note="gene_id=mCG119971.1 transcript_id=mCT121150.1
FT                   protein_id=mCP69259.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q542Q5"
FT                   /db_xref="InterPro:IPR024417"
FT                   /db_xref="MGI:MGI:99444"
FT                   /db_xref="UniProtKB/TrEMBL:Q542Q5"
FT                   /protein_id="EDK97072.1"
FT                   /translation="MVYYPELLVWVSQEPFAYKEMEGGLIKGRLPVPKEVNRKKMEETG
FT                   AASLTPPGSREFTSPATSYLHPF"
FT   gap             17343066..17343592
FT                   /estimated_length=527
FT   gap             17346333..17346513
FT                   /estimated_length=181
FT   gap             17348756..17348775
FT                   /estimated_length=20
FT   gap             17350216..17350235
FT                   /estimated_length=20
FT   gap             17351510..17351529
FT                   /estimated_length=20
FT   gap             17361714..17361840
FT                   /estimated_length=127
FT   gap             17365739..17365758
FT                   /estimated_length=20
FT   gap             17384405..17384424
FT                   /estimated_length=20
FT   gap             17389903..17390049
FT                   /estimated_length=147
FT   gap             17401389..17401562
FT                   /estimated_length=174
FT   gap             17437876..17437981
FT                   /estimated_length=106
FT   gene            17455273..17456256
FT                   /pseudo
FT                   /locus_tag="mCG_1031608"
FT                   /note="gene_id=mCG1031608.1"
FT   mRNA            17455273..17456256
FT                   /pseudo
FT                   /locus_tag="mCG_1031608"
FT                   /note="gene_id=mCG1031608.1 transcript_id=mCT149312.1
FT                   created on 04-JUN-2002"
FT   gap             17481411..17481550
FT                   /estimated_length=140
FT   gap             17514895..17514941
FT                   /estimated_length=47
FT   gap             17519150..17519589
FT                   /estimated_length=440
FT   gap             17531561..17531713
FT                   /estimated_length=153
FT   gap             17533079..17533098
FT                   /estimated_length=20
FT   gap             17534307..17534520
FT                   /estimated_length=214
FT   gap             17563718..17563986
FT                   /estimated_length=269
FT   gap             17570549..17570568
FT                   /estimated_length=20
FT   gap             17572091..17572110
FT                   /estimated_length=20
FT   gap             17593328..17593361
FT                   /estimated_length=34
FT   gap             17610167..17610268
FT                   /estimated_length=102
FT   gap             17623977..17624078
FT                   /estimated_length=102
FT   gap             17645031..17645050
FT                   /estimated_length=20
FT   gap             17659798..17660014
FT                   /estimated_length=217
FT   gap             17661335..17661874
FT                   /estimated_length=540
FT   gene            <17663626..17664704
FT                   /locus_tag="mCG_121507"
FT                   /note="gene_id=mCG121507.1"
FT   mRNA            join(<17663626..17663831,17664090..17664152,
FT                   17664560..17664704)
FT                   /locus_tag="mCG_121507"
FT                   /product="mCG121507"
FT                   /note="gene_id=mCG121507.1 transcript_id=mCT122713.1
FT                   created on 04-JUN-2002"
FT   CDS             17663626..17663736
FT                   /codon_start=1
FT                   /locus_tag="mCG_121507"
FT                   /product="mCG121507"
FT                   /note="gene_id=mCG121507.1 transcript_id=mCT122713.1
FT                   protein_id=mCP69192.1"
FT                   /protein_id="EDK97074.1"
FT                   /translation="MASPGAGAWEAVVAWDLGCLQRTRRPCEALGPPDPA"
FT   gene            complement(17665035..>17882258)
FT                   /gene="Epb4.1l4a"
FT                   /locus_tag="mCG_121503"
FT                   /note="gene_id=mCG121503.2"
FT   mRNA            complement(join(17665035..17666178,17667216..17667297,
FT                   17667399..17667509,17670273..17670341,17671215..17671262,
FT                   17678919..17679038,17693225..17693302,17694173..17694220,
FT                   17697041..17697154,17697670..17697753,17701535..17701625,
FT                   17723237..17723353,17728243..17728320,17729847..17729938,
FT                   17742885..17742948,17746577..17746665,17748748..17748835,
FT                   17750723..17750843,17751998..17752076,17758069..17758147,
FT                   17793577..17793681,17881324..>17881518))
FT                   /gene="Epb4.1l4a"
FT                   /locus_tag="mCG_121503"
FT                   /product="erythrocyte protein band 4.1-like 4a, transcript
FT                   variant mCT188839"
FT                   /note="gene_id=mCG121503.2 transcript_id=mCT188839.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(17665669..17666178,17667216..17667297,
FT                   17667399..17667509,17670273..17670341,17671215..17671262,
FT                   17678919..17679038,17693225..17693302,17694173..17694220,
FT                   17697041..17697154,17697670..17697753,17701535..17701625,
FT                   17723237..17723359,17728243..17728320,17729847..17729938,
FT                   17742885..17742948,17746577..17746665,17748748..17748835,
FT                   17750723..17750843,17751998..17752095,17758069..17758147,
FT                   17793577..17793681,17881324..17881761,17882108..>17882258))
FT                   /gene="Epb4.1l4a"
FT                   /locus_tag="mCG_121503"
FT                   /product="erythrocyte protein band 4.1-like 4a, transcript
FT                   variant mCT122709"
FT                   /note="gene_id=mCG121503.2 transcript_id=mCT122709.1
FT                   created on 04-JUN-2002"
FT   mRNA            complement(join(17665669..17666178,17667216..17667297,
FT                   17667399..17667509,17670273..17670341,17671215..17671262,
FT                   17678919..17679038,17693225..17693302,17694173..17694220,
FT                   17697041..17697154,17697670..17697753,17701535..17701625,
FT                   17723237..17723353,17728243..17728320,17729847..17729938,
FT                   17742885..17742948,17746577..17746665,17748748..17748835,
FT                   17750723..17750843,17751998..17752095,17758069..17758147,
FT                   17793577..17793681,17881324..>17881473))
FT                   /gene="Epb4.1l4a"
FT                   /locus_tag="mCG_121503"
FT                   /product="erythrocyte protein band 4.1-like 4a, transcript
FT                   variant mCT188838"
FT                   /note="gene_id=mCG121503.2 transcript_id=mCT188838.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(17666050..17666178,17667216..17667297,
FT                   17667399..17667509,17670273..17670341,17671215..17671262,
FT                   17678919..17679038,17693225..17693302,17694173..17694220,
FT                   17697041..17697154,17697670..17697753,17701535..17701625,
FT                   17723237..>17723288))
FT                   /codon_start=1
FT                   /gene="Epb4.1l4a"
FT                   /locus_tag="mCG_121503"
FT                   /product="erythrocyte protein band 4.1-like 4a, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG121503.2 transcript_id=mCT122709.1
FT                   protein_id=mCP69386.1 isoform=CRA_a"
FT                   /protein_id="EDK97075.1"
FT                   /translation="EVEARLTPKRVAQTQPTGSNNINRITANTENGENEGTTKIIAPSP
FT                   VKSFKKAKNENSPDPQRSKSHAPWEENGPQSGLYNSSSDRTKSPKFPCARQRNLSCGSD
FT                   NDSSQLMRRRKAHNSGEDSDLKQRRRSRSRCNTSSGSESENSNREHRKKRNRTRQENDM
FT                   VDSGPQWEAVLRRQKEKNQADPNNRRSRHRSRSRSPDIQAKEELWKHIQKELVDPSGLS
FT                   EEQLKEIPYTKVETQGDPVRIRHSHSPRSYRQYRRSQCSDGERSVLSEVNSKTDLVPPL
FT                   PVTRSSDAQGSGGSTVHQRRNGSKDSLIEEKSQLSTINPAGKPTAKTIKTIQAARLKAE
FT                   T"
FT   CDS             complement(join(17666050..17666178,17667216..17667297,
FT                   17667399..17667509,17670273..17670341,17671215..17671262,
FT                   17678919..17679038,17693225..17693302,17694173..17694220,
FT                   17697041..17697154,17697670..17697753,17701535..17701625,
FT                   17723237..>17723288))
FT                   /codon_start=1
FT                   /gene="Epb4.1l4a"
FT                   /locus_tag="mCG_121503"
FT                   /product="erythrocyte protein band 4.1-like 4a, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG121503.2 transcript_id=mCT188838.0
FT                   protein_id=mCP109825.0 isoform=CRA_a"
FT                   /protein_id="EDK97076.1"
FT                   /translation="EVEARLTPKRVAQTQPTGSNNINRITANTENGENEGTTKIIAPSP
FT                   VKSFKKAKNENSPDPQRSKSHAPWEENGPQSGLYNSSSDRTKSPKFPCARQRNLSCGSD
FT                   NDSSQLMRRRKAHNSGEDSDLKQRRRSRSRCNTSSGSESENSNREHRKKRNRTRQENDM
FT                   VDSGPQWEAVLRRQKEKNQADPNNRRSRHRSRSRSPDIQAKEELWKHIQKELVDPSGLS
FT                   EEQLKEIPYTKVETQGDPVRIRHSHSPRSYRQYRRSQCSDGERSVLSEVNSKTDLVPPL
FT                   PVTRSSDAQGSGGSTVHQRRNGSKDSLIEEKSQLSTINPAGKPTAKTIKTIQAARLKAE
FT                   T"
FT   CDS             complement(join(17666050..17666178,17667216..17667297,
FT                   17667399..17667509,17670273..17670341,17671215..17671262,
FT                   17678919..17679038,17693225..17693302,17694173..17694220,
FT                   17697041..17697154,17697670..17697753,17701535..17701625,
FT                   17723237..>17723288))
FT                   /codon_start=1
FT                   /gene="Epb4.1l4a"
FT                   /locus_tag="mCG_121503"
FT                   /product="erythrocyte protein band 4.1-like 4a, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG121503.2 transcript_id=mCT188839.0
FT                   protein_id=mCP109826.0 isoform=CRA_a"
FT                   /protein_id="EDK97077.1"
FT                   /translation="EVEARLTPKRVAQTQPTGSNNINRITANTENGENEGTTKIIAPSP
FT                   VKSFKKAKNENSPDPQRSKSHAPWEENGPQSGLYNSSSDRTKSPKFPCARQRNLSCGSD
FT                   NDSSQLMRRRKAHNSGEDSDLKQRRRSRSRCNTSSGSESENSNREHRKKRNRTRQENDM
FT                   VDSGPQWEAVLRRQKEKNQADPNNRRSRHRSRSRSPDIQAKEELWKHIQKELVDPSGLS
FT                   EEQLKEIPYTKVETQGDPVRIRHSHSPRSYRQYRRSQCSDGERSVLSEVNSKTDLVPPL
FT                   PVTRSSDAQGSGGSTVHQRRNGSKDSLIEEKSQLSTINPAGKPTAKTIKTIQAARLKAE
FT                   T"
FT   gap             17673831..17673850
FT                   /estimated_length=20
FT   gap             17721249..17721822
FT                   /estimated_length=574
FT   gap             17737786..17739318
FT                   /estimated_length=1533
FT   gap             17743510..17743529
FT                   /estimated_length=20
FT   gap             17744792..17744811
FT                   /estimated_length=20
FT   gap             17746075..17746094
FT                   /estimated_length=20
FT   gap             17756303..17756690
FT                   /estimated_length=388
FT   gap             17762219..17764894
FT                   /estimated_length=2676
FT   gap             17772461..17776701
FT                   /estimated_length=4241
FT   gap             17780502..17780547
FT                   /estimated_length=46
FT   gap             17797019..17797123
FT                   /estimated_length=105
FT   gap             17833437..17833456
FT                   /estimated_length=20
FT   gap             17837352..17837382
FT                   /estimated_length=31
FT   gap             17839092..17841161
FT                   /estimated_length=2070
FT   gap             17864772..17865450
FT                   /estimated_length=679
FT   gap             17869316..17869335
FT                   /estimated_length=20
FT   gap             17871036..17871055
FT                   /estimated_length=20
FT   gap             17872242..17872261
FT                   /estimated_length=20
FT   gap             17901774..17901793
FT                   /estimated_length=20
FT   gap             17916496..17916575
FT                   /estimated_length=80
FT   gene            17919844..17920340
FT                   /pseudo
FT                   /locus_tag="mCG_1031609"
FT                   /note="gene_id=mCG1031609.1"
FT   mRNA            17919844..17920340
FT                   /pseudo
FT                   /locus_tag="mCG_1031609"
FT                   /note="gene_id=mCG1031609.1 transcript_id=mCT149313.1
FT                   created on 04-JUN-2002"
FT   gene            17922184..17922652
FT                   /pseudo
FT                   /locus_tag="mCG_1031610"
FT                   /note="gene_id=mCG1031610.1"
FT   mRNA            17922184..17922652
FT                   /pseudo
FT                   /locus_tag="mCG_1031610"
FT                   /note="gene_id=mCG1031610.1 transcript_id=mCT149314.1
FT                   created on 04-JUN-2002"
FT   gap             17962798..17962831
FT                   /estimated_length=34
FT   gap             18003904..18003966
FT                   /estimated_length=63
FT   gap             18016014..18016033
FT                   /estimated_length=20
FT   gap             18050175..18050194
FT                   /estimated_length=20
FT   gap             18051203..18051222
FT                   /estimated_length=20
FT   gene            complement(18083962..18090577)
FT                   /pseudo
FT                   /locus_tag="mCG_1031611"
FT                   /note="gene_id=mCG1031611.1"
FT   mRNA            complement(join(18083962..18084025,18087489..18087526,
FT                   18090188..18090577))
FT                   /pseudo
FT                   /locus_tag="mCG_1031611"
FT                   /note="gene_id=mCG1031611.1 transcript_id=mCT149315.1
FT                   created on 04-JUN-2002"
FT   gap             18096714..18096733
FT                   /estimated_length=20
FT   gene            18102148..18203701
FT                   /gene="Apc"
FT                   /locus_tag="mCG_121500"
FT                   /note="gene_id=mCG121500.1"
FT   mRNA            join(18102148..18102437,18149649..18149730,
FT                   18150407..18150605,18153974..18154082,18158099..18158212,
FT                   18160764..18160847,18171338..18171442,18177530..18177628,
FT                   18179922..18180300,18182647..18182742,18187264..18187403,
FT                   18188246..18188323,18188943..18189059,18193844..18194058,
FT                   18195156..18203701)
FT                   /gene="Apc"
FT                   /locus_tag="mCG_121500"
FT                   /product="adenomatosis polyposis coli, transcript variant
FT                   mCT169879"
FT                   /note="gene_id=mCG121500.1 transcript_id=mCT169879.0
FT                   created on 02-JUN-2003"
FT   mRNA            join(18102148..18102437,18142353..18142505,
FT                   18149649..18149730,18150407..18150605,18153974..18154082,
FT                   18158099..18158212,18160764..18160847,18171338..18171442,
FT                   18177530..18177628,18179922..18180300,18182647..18182742,
FT                   18187264..18187403,18188246..18188323,18188943..18189059,
FT                   18193844..18194058,18195156..18201759)
FT                   /gene="Apc"
FT                   /locus_tag="mCG_121500"
FT                   /product="adenomatosis polyposis coli, transcript variant
FT                   mCT122706"
FT                   /note="gene_id=mCG121500.1 transcript_id=mCT122706.1
FT                   created on 02-JUN-2003"
FT   CDS             join(18102273..18102437,18149649..18149730,
FT                   18150407..18150605,18153974..18154082,18158099..18158212,
FT                   18160764..18160847,18171338..18171442,18177530..18177628,
FT                   18179922..18180300,18182647..18182742,18187264..18187403,
FT                   18188246..18188323,18188943..18189059,18193844..18194058,
FT                   18195156..18201732)
FT                   /codon_start=1
FT                   /gene="Apc"
FT                   /locus_tag="mCG_121500"
FT                   /product="adenomatosis polyposis coli, isoform CRA_b"
FT                   /note="gene_id=mCG121500.1 transcript_id=mCT169879.0
FT                   protein_id=mCP92519.0 isoform=CRA_b"
FT                   /protein_id="EDK97079.1"
FT                   /translation="MYAFLRSGPVAALPASVPPVTLGARSSGGGRGRVPGEGRRPGGAR
FT                   ACGRGASVWQEVLKQLQGSIEDETMTSGQIDLLERLKEFNLDSNFPGVKLRSKMSLRSY
FT                   GSREGSVSSRSGECSPVPMGSFPRRTFVNGSRESTGYLEELEKERSLLLADLDKEEKEK
FT                   DWYYAQLQNLTKRIDSLPLTENFSLQTDMTRRQLEYEARQIRAAMEEQLGTCQDMEKRA
FT                   QRRIARIQQIEKDILRVRQLLQSQAAEAERSSQSRHDAASHEAGRQHEGHGVAESNTAA
FT                   SSSGQSPATRVDHETASVLSSSGTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSR
FT                   TLLAMSSSQDSCISMRQSGCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNII
FT                   HSQPDDKRGRREIRVLHLLEQIRAYCETCWEWQEAHEQGMDQDKNPMPAPVEHQICPAV
FT                   CVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSVTLRRYAGMALTNLT
FT                   FGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGS
FT                   VKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTN
FT                   TLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWN
FT                   LSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSP
FT                   GSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQNLYGDYAFDAN
FT                   RHDDSRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGIGLSAY
FT                   HPTTENAGTSSKRGLQITTTAAQIAKVMEEVSAIHTSQDDRSSASTTEFHCVADDRSAA
FT                   RRSSASHTHSNTYNFTKSENSNRTCSMPYAKVEYKRSSNDSLNSVTSSDGYGKRGQMKP
FT                   SVESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGR
FT                   QSPSQNERWARPKHVIEDEIKQNEQRQARSQNTSYPVYSENTDDKHLKFQPHFGQQECV
FT                   SPYRSRGTSGSETNRMGSSHAINQNVNQSLCQEDDYEDDKPTNYSERYSEEEQHEEEEE
FT                   RPTNYSIKYNEEKHHVDQPIDYSLKYATDISSSQKPSFSFSKNSSAQSTKPEHLSPSSE
FT                   NTAVPPSNAKRQNQLRPSSAQRNGQTQKGTTCKVPSINQETIQTYCVEDTPICFSRCSS
FT                   LSSLSSADDEIGCDQTTQEADSANTLQTAEVKENDVTRSAEDPATEVPAVSQNARAKPS
FT                   RLQASGLSSESTRHNKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLVFSRCTSVSSL
FT                   DSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTVQAKREV
FT                   PKSKVPAAEKRESGPKQTAVNAAVQRVQVLPDVDTLLHFATESTPDGFSCSSSLSALSL
FT                   DEPFIQKDVELRIMPPVQENDNGNETESEQPEESNENQDKEVEKPDSEKDLLDDSDDDD
FT                   IEILEECIISAMPTKSSRKAKKLAQTASKLPPPVARKPSQLPVYKLLPAQNRLQAQKHV
FT                   SFTPGDDVPRVYCVEGTPINFSTATSLSDLTIESPPNELATGDGVRAGIQSGEFEKRDT
FT                   IPTEGRSTDDAQRGKISSIVTPDLDDNKAEEGDILAECINSAMPKGKSHKPFRVKKIMD
FT                   QVQQASSTSSGANKNQVDTKKKKPTSPVKPMPQNTEYRTRVRKNTDSKVNVNTEETFSD
FT                   NKDSKKPSLQTNAKAFNEKLPNNEDRVRGSFALDSPHHYTPIEGTPYCFSRNDSLSSLD
FT                   FDDDDVDLSREKAELRKGKESKDSEAKVTCRPEPNSSQQAASKSQASIKHPANRAQSKP
FT                   VLQKQPTFPQSSKDGPDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDIDQENNNNKE
FT                   SEPIKEAEPANSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQEC
FT                   ISSAMPKKKRPSRLKSESEKQSPRKVGGILAEDLTLDLKDLQRPDSEHAFSPDSENFDW
FT                   KAIQEGANSIVSSLHQAAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPF
FT                   TSNKGPRILKPGEKSTLEAKKIESENKGIKGGKKVYKSLITGKIRSNSEISSQMKQPLP
FT                   TNMPSISRGRTMIHIPGLRNSSSSTSPVSKKGPPLKTPASKSPSEGPGATTSPRGTKPA
FT                   GKSELSPITRQTSQISGSNKGSSRSGSRDSTPSRPTQQPLSRPMQSPGRNSISPGRNGI
FT                   SPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQLSQQNLTKQASLSKNASSIPRSE
FT                   SASKGLNQMSNGNGSNKKVELSRMSSTKSSGSESDRSERPALVRQSTFIKEAPSPTLRR
FT                   KLEESASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHPSVQAGGWRKLPPNLSP
FT                   TIEYNDGRPTKRHDIARSHSESPSRLPINRAGTWKREHSKHSSSLPRVSTWRRTGSSSS
FT                   ILSASSESSEKAKSEDERHVSSMPAPRQMKENQVPTKGTWRKIKESDISPTGMASQSAS
FT                   SGAASGAESKPLIYQMAPPVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKG
FT                   SSSIKDSKDTHGKQSVGSGSPVQTVGLETRLNSFVQVEAPEQKGTEAKPGQSNPVSIAE
FT                   TAETCIAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPV
FT                   STNTKKRDSKTDSTESSGAQSPKRHSGSYLVTSV"
FT   mRNA            join(18102413..18102437,18147405..18147569,
FT                   18149649..18149730,18150407..18150605,18153974..18154082,
FT                   18158099..>18158142)
FT                   /gene="Apc"
FT                   /locus_tag="mCG_121500"
FT                   /product="adenomatosis polyposis coli, transcript variant
FT                   mCT185123"
FT                   /note="gene_id=mCG121500.1 transcript_id=mCT185123.0
FT                   created on 02-JUN-2003"
FT   gap             18121481..18121706
FT                   /estimated_length=226
FT   mRNA            join(18129050..18129087,18142353..18142505,
FT                   18149649..18149730,18150407..18150605,18153974..18154082,
FT                   18158099..18158212,18160764..18160847,18171338..>18171442)
FT                   /gene="Apc"
FT                   /locus_tag="mCG_121500"
FT                   /product="adenomatosis polyposis coli, transcript variant
FT                   mCT185122"
FT                   /note="gene_id=mCG121500.1 transcript_id=mCT185122.0
FT                   created on 02-JUN-2003"
FT   CDS             join(18142371..18142505,18149649..18149730,
FT                   18150407..18150605,18153974..18154082,18158099..18158212,
FT                   18160764..18160847,18171338..18171442,18177530..18177628,
FT                   18179922..18180300,18182647..18182742,18187264..18187403,
FT                   18188246..18188323,18188943..18189059,18193844..18194058,
FT                   18195156..18201732)
FT                   /codon_start=1
FT                   /gene="Apc"
FT                   /locus_tag="mCG_121500"
FT                   /product="adenomatosis polyposis coli, isoform CRA_a"
FT                   /note="gene_id=mCG121500.1 transcript_id=mCT122706.1
FT                   protein_id=mCP69346.0 isoform=CRA_a"
FT                   /db_xref="GOA:B2RUG9"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR009223"
FT                   /db_xref="InterPro:IPR009224"
FT                   /db_xref="InterPro:IPR009232"
FT                   /db_xref="InterPro:IPR009234"
FT                   /db_xref="InterPro:IPR009240"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR026818"
FT                   /db_xref="InterPro:IPR026831"
FT                   /db_xref="MGI:MGI:88039"
FT                   /db_xref="UniProtKB/TrEMBL:B2RUG9"
FT                   /protein_id="EDK97078.1"
FT                   /translation="MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMK
FT                   EVLKQLQGSIEDETMTSGQIDLLERLKEFNLDSNFPGVKLRSKMSLRSYGSREGSVSSR
FT                   SGECSPVPMGSFPRRTFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNL
FT                   TKRIDSLPLTENFSLQTDMTRRQLEYEARQIRAAMEEQLGTCQDMEKRAQRRIARIQQI
FT                   EKDILRVRQLLQSQAAEAERSSQSRHDAASHEAGRQHEGHGVAESNTAASSSGQSPATR
FT                   VDHETASVLSSSGTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQD
FT                   SCISMRQSGCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGR
FT                   REIRVLHLLEQIRAYCETCWEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDE
FT                   EHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSVTLRRYAGMALTNLTFGDVANKATL
FT                   CSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALE
FT                   VKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGG
FT                   ILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQE
FT                   ALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVR
FT                   KQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQNLYGDYAFDANRHDDSRSDNF
FT                   NTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGIGLSAYHPTTENAGTS
FT                   SKRGLQITTTAAQIAKVMEEVSAIHTSQDDRSSASTTEFHCVADDRSAARRSSASHTHS
FT                   NTYNFTKSENSNRTCSMPYAKVEYKRSSNDSLNSVTSSDGYGKRGQMKPSVESYSEDDE
FT                   SKFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWA
FT                   RPKHVIEDEIKQNEQRQARSQNTSYPVYSENTDDKHLKFQPHFGQQECVSPYRSRGTSG
FT                   SETNRMGSSHAINQNVNQSLCQEDDYEDDKPTNYSERYSEEEQHEEEEERPTNYSIKYN
FT                   EEKHHVDQPIDYSLKYATDISSSQKPSFSFSKNSSAQSTKPEHLSPSSENTAVPPSNAK
FT                   RQNQLRPSSAQRNGQTQKGTTCKVPSINQETIQTYCVEDTPICFSRCSSLSSLSSADDE
FT                   IGCDQTTQEADSANTLQTAEVKENDVTRSAEDPATEVPAVSQNARAKPSRLQASGLSSE
FT                   STRHNKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLVFSRCTSVSSLDSFESRSIAS
FT                   SVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTVQAKREVPKSKVPAAEK
FT                   RESGPKQTAVNAAVQRVQVLPDVDTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVE
FT                   LRIMPPVQENDNGNETESEQPEESNENQDKEVEKPDSEKDLLDDSDDDDIEILEECIIS
FT                   AMPTKSSRKAKKLAQTASKLPPPVARKPSQLPVYKLLPAQNRLQAQKHVSFTPGDDVPR
FT                   VYCVEGTPINFSTATSLSDLTIESPPNELATGDGVRAGIQSGEFEKRDTIPTEGRSTDD
FT                   AQRGKISSIVTPDLDDNKAEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQQASSTSS
FT                   GANKNQVDTKKKKPTSPVKPMPQNTEYRTRVRKNTDSKVNVNTEETFSDNKDSKKPSLQ
FT                   TNAKAFNEKLPNNEDRVRGSFALDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSR
FT                   EKAELRKGKESKDSEAKVTCRPEPNSSQQAASKSQASIKHPANRAQSKPVLQKQPTFPQ
FT                   SSKDGPDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDIDQENNNNKESEPIKEAEPA
FT                   NSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKKKR
FT                   PSRLKSESEKQSPRKVGGILAEDLTLDLKDLQRPDSEHAFSPDSENFDWKAIQEGANSI
FT                   VSSLHQAAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRILK
FT                   PGEKSTLEAKKIESENKGIKGGKKVYKSLITGKIRSNSEISSQMKQPLPTNMPSISRGR
FT                   TMIHIPGLRNSSSSTSPVSKKGPPLKTPASKSPSEGPGATTSPRGTKPAGKSELSPITR
FT                   QTSQISGSNKGSSRSGSRDSTPSRPTQQPLSRPMQSPGRNSISPGRNGISPPNKLSQLP
FT                   RTSSPSTASTKSSGSGKMSYTSPGRQLSQQNLTKQASLSKNASSIPRSESASKGLNQMS
FT                   NGNGSNKKVELSRMSSTKSSGSESDRSERPALVRQSTFIKEAPSPTLRRKLEESASFES
FT                   LSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHPSVQAGGWRKLPPNLSPTIEYNDGRPT
FT                   KRHDIARSHSESPSRLPINRAGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSE
FT                   KAKSEDERHVSSMPAPRQMKENQVPTKGTWRKIKESDISPTGMASQSASSGAASGAESK
FT                   PLIYQMAPPVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKGSSSIKDSKDT
FT                   HGKQSVGSGSPVQTVGLETRLNSFVQVEAPEQKGTEAKPGQSNPVSIAETAETCIAERT
FT                   PFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVSTNTKKRDSK
FT                   TDSTESSGAQSPKRHSGSYLVTSV"
FT   CDS             join(18142371..18142505,18149649..18149730,
FT                   18150407..18150605,18153974..18154082,18158099..18158212,
FT                   18160764..18160847,18171338..>18171442)
FT                   /codon_start=1
FT                   /gene="Apc"
FT                   /locus_tag="mCG_121500"
FT                   /product="adenomatosis polyposis coli, isoform CRA_c"
FT                   /note="gene_id=mCG121500.1 transcript_id=mCT185122.0
FT                   protein_id=mCP106380.0 isoform=CRA_c"
FT                   /protein_id="EDK97080.1"
FT                   /translation="MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMK
FT                   EVLKQLQGSIEDETMTSGQIDLLERLKEFNLDSNFPGVKLRSKMSLRSYGSREGSVSSR
FT                   SGECSPVPMGSFPRRTFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNL
FT                   TKRIDSLPLTENFSLQTDMTRRQLEYEARQIRAAMEEQLGTCQDMEKRAQRRIARIQQI
FT                   EKDILRVRQLLQSQAAEAERSSQSRHDAASHEAGRQHEGHGVAESNTAASSSGQ"
FT   CDS             join(18149691..18149730,18150407..18150605,
FT                   18153974..18154082,18158099..>18158142)
FT                   /codon_start=1
FT                   /gene="Apc"
FT                   /locus_tag="mCG_121500"
FT                   /product="adenomatosis polyposis coli, isoform CRA_d"
FT                   /note="gene_id=mCG121500.1 transcript_id=mCT185123.0
FT                   protein_id=mCP106381.0 isoform=CRA_d"
FT                   /protein_id="EDK97081.1"
FT                   /translation="MTSGQIDLLERLKEFNLDSNFPGVKLRSKMSLRSYGSREGSVSSR
FT                   SGECSPVPMGSFPRRTFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNL
FT                   TKRIDSLPLTENFSLQTDMTRRQLEY"
FT   gap             18181739..18181910
FT                   /estimated_length=172
FT   gap             18190055..18190074
FT                   /estimated_length=20
FT   gene            18214583..18220058
FT                   /gene="Srp19"
FT                   /locus_tag="mCG_121501"
FT                   /note="gene_id=mCG121501.2"
FT   mRNA            join(18214583..18214698,18215189..18217803,
FT                   18217896..18218007,18219538..18219990)
FT                   /gene="Srp19"
FT                   /locus_tag="mCG_121501"
FT                   /product="signal recognition particle 19, transcript
FT                   variant mCT188837"
FT                   /note="gene_id=mCG121501.2 transcript_id=mCT188837.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(18214598..18214698,18215189..18215264,
FT                   18217896..18218007,18219538..18220058)
FT                   /gene="Srp19"
FT                   /locus_tag="mCG_121501"
FT                   /product="signal recognition particle 19, transcript
FT                   variant mCT169880"
FT                   /note="gene_id=mCG121501.2 transcript_id=mCT169880.0
FT                   created on 04-JUN-2002"
FT   mRNA            join(18214621..18214698,18215189..18215264,
FT                   18217732..18217803,18217896..18218007,18219538..18220037)
FT                   /gene="Srp19"
FT                   /locus_tag="mCG_121501"
FT                   /product="signal recognition particle 19, transcript
FT                   variant mCT122707"
FT                   /note="gene_id=mCG121501.2 transcript_id=mCT122707.0
FT                   created on 04-JUN-2002"
FT   CDS             join(18214658..18214698,18215189..18215264,
FT                   18217732..18217803,18217896..18218007,18219538..18219671)
FT                   /codon_start=1
FT                   /gene="Srp19"
FT                   /locus_tag="mCG_121501"
FT                   /product="signal recognition particle 19, isoform CRA_a"
FT                   /note="gene_id=mCG121501.2 transcript_id=mCT122707.0
FT                   protein_id=mCP69358.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D104"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="MGI:MGI:1913634"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D104"
FT                   /protein_id="EDK97082.1"
FT                   /translation="MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPT
FT                   ATEIQDVCSAVGLNAFLEKNKMYSREWNRDVQFRGRVRVQLKQEDGSLCLVQFPSRKSV
FT                   MLYVAEMIPKLKTRTQKSGGADPSLQQGEGSKKGKGKKKK"
FT   CDS             join(18214658..18214698,18215189..18215264,
FT                   18217896..18218007,18219538..18219671)
FT                   /codon_start=1
FT                   /gene="Srp19"
FT                   /locus_tag="mCG_121501"
FT                   /product="signal recognition particle 19, isoform CRA_b"
FT                   /note="gene_id=mCG121501.2 transcript_id=mCT169880.0
FT                   protein_id=mCP92522.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8T3"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="MGI:MGI:1913634"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8T3"
FT                   /protein_id="EDK97083.1"
FT                   /translation="MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKKNKMYS
FT                   REWNRDVQFRGRVRVQLKQEDGSLCLVQFPSRKSVMLYVAEMIPKLKTRTQKSGGADPS
FT                   LQQGEGSKKGKGKKKK"
FT   CDS             join(18217708..18217803,18217896..18218007,
FT                   18219538..18219671)
FT                   /codon_start=1
FT                   /gene="Srp19"
FT                   /locus_tag="mCG_121501"
FT                   /product="signal recognition particle 19, isoform CRA_c"
FT                   /note="gene_id=mCG121501.2 transcript_id=mCT188837.0
FT                   protein_id=mCP109824.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8BZ07"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BZ07"
FT                   /protein_id="EDK97084.1"
FT                   /translation="MFLFLIVQAVENPTATEIQDVCSAVGLNAFLEKNKMYSREWNRDV
FT                   QFRGRVRVQLKQEDGSLCLVQFPSRKSVMLYVAEMIPKLKTRTQKSGGADPSLQQGEGS
FT                   KKGKGKKKK"
FT   gene            complement(18230415..>18256902)
FT                   /gene="Reep5"
FT                   /locus_tag="mCG_121499"
FT                   /note="gene_id=mCG121499.2"
FT   mRNA            complement(join(18230415..18230591,18233058..18233226,
FT                   18240515..18240653,18255828..18255921,18256627..18256766))
FT                   /gene="Reep5"
FT                   /locus_tag="mCG_121499"
FT                   /product="receptor accessory protein 5, transcript variant
FT                   mCT122705"
FT                   /note="gene_id=mCG121499.2 transcript_id=mCT122705.0
FT                   created on 02-JUN-2003"
FT   mRNA            complement(join(18230526..18230591,18233058..18233226,
FT                   18239847..18239944,18240515..18240653,18255828..18255921,
FT                   18256354..>18256594))
FT                   /gene="Reep5"
FT                   /locus_tag="mCG_121499"
FT                   /product="receptor accessory protein 5, transcript variant
FT                   mCT185115"
FT                   /note="gene_id=mCG121499.2 transcript_id=mCT185115.0
FT                   created on 02-JUN-2003"
FT   CDS             complement(join(18230542..18230591,18233058..18233226,
FT                   18240515..18240653,18255828..18255921,18256627..18256744))
FT                   /codon_start=1
FT                   /gene="Reep5"
FT                   /locus_tag="mCG_121499"
FT                   /product="receptor accessory protein 5, isoform CRA_a"
FT                   /note="gene_id=mCG121499.2 transcript_id=mCT122705.0
FT                   protein_id=mCP69170.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3X8R0"
FT                   /db_xref="InterPro:IPR004345"
FT                   /db_xref="MGI:MGI:1270152"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8R0"
FT                   /protein_id="EDK97085.1"
FT                   /translation="MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLV
FT                   ALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSD
FT                   LFLSWFPFYYMLKCGFLLWCMAPSPANGAEMLYRRIIRPIFLKHESQVDSVVKDVKDKA
FT                   KETADAISKEVKKATVNLLGDEKKST"
FT   CDS             complement(join(18239852..18239944,18240515..18240653,
FT                   18255828..18255921,18256354..>18256594))
FT                   /codon_start=1
FT                   /gene="Reep5"
FT                   /locus_tag="mCG_121499"
FT                   /product="receptor accessory protein 5, isoform CRA_b"
FT                   /note="gene_id=mCG121499.2 transcript_id=mCT185115.0
FT                   protein_id=mCP106373.0 isoform=CRA_b"
FT                   /protein_id="EDK97086.1"
FT                   /translation="AGTEDGREAPRAWSGAWEPQTAGRADADVSPLPAASVPGPTALGA
FT                   VSSGVKLAFTSQTPPPLRQPGLACTVLACARAREPGVIGLVALYLVFGYGASLLCNLIG
FT                   FGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWFPFYYMLKLCSDG
FT                   CPSLPQKSGCDVGTASGSQTADFAS"
FT   mRNA            complement(join(<18240588..18240653,18255828..18255921,
FT                   18256627..18256650,18256743..>18256902))
FT                   /gene="Reep5"
FT                   /locus_tag="mCG_121499"
FT                   /product="receptor accessory protein 5, transcript variant
FT                   mCT185114"
FT                   /note="gene_id=mCG121499.2 transcript_id=mCT185114.0
FT                   created on 02-JUN-2003"
FT   CDS             complement(join(<18240588..18240653,18255828..18255921,
FT                   18256627..18256650,18256743..>18256902))
FT                   /codon_start=1
FT                   /gene="Reep5"
FT                   /locus_tag="mCG_121499"
FT                   /product="receptor accessory protein 5, isoform CRA_c"
FT                   /note="gene_id=mCG121499.2 transcript_id=mCT185114.0
FT                   protein_id=mCP106372.0 isoform=CRA_c"
FT                   /protein_id="EDK97087.1"
FT                   /translation="GGTVPAGRRRAWGALPETSCTSRGTARPRPAPVSWVPRPAGCGAS
FT                   RAARTAQPLNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDD
FT                   DTQWLTYWVV"
FT   gap             18257595..18257620
FT                   /estimated_length=26
FT   gap             18286126..18286633
FT                   /estimated_length=508
FT   gap             18287180..18287199
FT                   /estimated_length=20
FT   gap             18289207..18291609
FT                   /estimated_length=2403
FT   gap             18292214..18292233
FT                   /estimated_length=20
FT   gene            18297453..18330763
FT                   /gene="Pkd2l2"
FT                   /locus_tag="mCG_121502"
FT                   /note="gene_id=mCG121502.1"
FT   mRNA            join(18297453..18297527,18297837..18297938,
FT                   18300688..18300821,18302470..18302726,18304833..18305054,
FT                   18312956..18313184,18315257..18315427,18316027..18316208,
FT                   18318167..18318287,18318618..18318719,18321236..18321300,
FT                   18323289..18323340,18326066..18326178,18326695..18326796,
FT                   18330228..18330763)
FT                   /gene="Pkd2l2"
FT                   /locus_tag="mCG_121502"
FT                   /product="polycystic kidney disease 2-like 2"
FT                   /note="gene_id=mCG121502.1 transcript_id=mCT122708.0
FT                   created on 04-JUN-2002"
FT   CDS             join(18297497..18297527,18297837..18297938,
FT                   18300688..18300821,18302470..18302726,18304833..18305054,
FT                   18312956..18313184,18315257..18315427,18316027..18316208,
FT                   18318167..18318287,18318618..18318719,18321236..18321300,
FT                   18323289..18323340,18326066..18326178,18326695..18326779)
FT                   /codon_start=1
FT                   /gene="Pkd2l2"
FT                   /locus_tag="mCG_121502"
FT                   /product="polycystic kidney disease 2-like 2"
FT                   /note="gene_id=mCG121502.1 transcript_id=mCT122708.0
FT                   protein_id=mCP69367.1"
FT                   /protein_id="EDK97088.1"
FT                   /translation="MSEATWWYRGGTSKHDLHYRREAEVNTTLEELLLYFIFLINLCIL
FT                   TFGMVNPHMYYLNKVMSSLFVDTSLPDDERSSFRSIRSITEFWKFMEGPLIDGLYWDSW
FT                   YGNKQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENE
FT                   DFSDFGLKRNPEWTHTPSSRTAPWHWGFVGVYRDGGYIVTLSKSKSETKAKFVDLRLNN
FT                   WISRGTRAVFIDFSLYNANVNLFCIIRLLAEFPATGGLLTSWQFYSVKLLRYVSYYDYF
FT                   IASCEVIFCIFLFVFIIQELRKVNEFKSAYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQ
FT                   SFLLLGQLLKNTDSYPDFYFLAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSST
FT                   LSRCMKDIVGFAIMFFIIFSAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAG
FT                   IQQANWILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRPDFELGKIIQK
FT                   SCFNVLEKLRLKKAQAKEEKKMQTTDLAQRARREGFDESEIQEAEQMKRWKERLEKKYY
FT                   STEIQDDYQPVTQQEFRELFLYAVELEKELHYVSLKLNQLMRKLH"
FT   gene            complement(18328544..>18394868)
FT                   /gene="2610024E20Rik"
FT                   /locus_tag="mCG_121506"
FT                   /note="gene_id=mCG121506.2"
FT   mRNA            complement(join(18328544..18330737,18331874..18331975,
FT                   18333259..18333422,18333514..18333597,18336028..18336123,
FT                   18336370..18336453,18339209..18339438,18342051..18342132,
FT                   18342671..18342800,18345681..18345891,18350065..18350212,
FT                   18350965..18351013,18353160..18353215,18361551..18361686,
FT                   18374991..18375151,18382171..18382312,18382613..18382790,
FT                   18385347..18385559,18385981..18386172,18387698..18387864,
FT                   18394570..18394845))
FT                   /gene="2610024E20Rik"
FT                   /locus_tag="mCG_121506"
FT                   /product="RIKEN cDNA 2610024E20, transcript variant
FT                   mCT122712"
FT                   /note="gene_id=mCG121506.2 transcript_id=mCT122712.1
FT                   created on 04-JUN-2002"
FT   mRNA            complement(join(18330324..18330737,18331874..18331975,
FT                   18333259..18333422,18333514..18333597,18336028..18336123,
FT                   18336370..18336453,18339209..18339438,18342051..18342132,
FT                   18342671..18342800,18345681..18345891,18350065..18350212,
FT                   18350965..18351013,18353160..18353224,18361551..18361686,
FT                   18374991..18375151,18382171..18382312,18382613..18382790,
FT                   18385347..18385559,18385981..18386172,18387698..18387864,
FT                   18394574..>18394868))
FT                   /gene="2610024E20Rik"
FT                   /locus_tag="mCG_121506"
FT                   /product="RIKEN cDNA 2610024E20, transcript variant
FT                   mCT188844"
FT                   /note="gene_id=mCG121506.2 transcript_id=mCT188844.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(18330324..18330737,18331874..18333422,
FT                   18333514..18333597,18336028..18336123,18336370..18336453,
FT                   18339209..18339438,18342051..18342132,18342671..18342800,
FT                   18345681..18345891,18350065..18350212,18350965..18351013,
FT                   18353160..18353224,18361551..18361686,18368462..18368585,
FT                   18374991..18375151,18382171..18382312,18382613..18382790,
FT                   18385347..18385559,18385981..18386172,18387698..18387864,
FT                   18394574..>18394860))
FT                   /gene="2610024E20Rik"
FT                   /locus_tag="mCG_121506"
FT                   /product="RIKEN cDNA 2610024E20, transcript variant
FT                   mCT188845"
FT                   /note="gene_id=mCG121506.2 transcript_id=mCT188845.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(18330614..18330737,18331874..18331975,
FT                   18333259..18333422,18333514..18333597,18336028..18336123,
FT                   18336370..18336453,18339209..18339438,18342051..18342132,
FT                   18342671..18342800,18345681..18345891,18350065..18350212,
FT                   18350965..18351013,18353160..18353224,18361551..18361686,
FT                   18374991..18375151,18382171..18382312,18382613..18382790,
FT                   18385347..18385559,18385981..18386172,18387698..>18387707))
FT                   /codon_start=1
FT                   /gene="2610024E20Rik"
FT                   /locus_tag="mCG_121506"
FT                   /product="RIKEN cDNA 2610024E20, isoform CRA_b"
FT                   /note="gene_id=mCG121506.2 transcript_id=mCT188844.0
FT                   protein_id=mCP109828.0 isoform=CRA_b"
FT                   /protein_id="EDK97090.1"
FT                   /translation="VLKEKTALISGCKKAMRKSSSPSLSNCNSDLASKIFGIPLDELQQ
FT                   GGHPDNEVPFIVRHVVDYIEEHGGLEQQGLFQVNGNAETVEWLRQRYDSGEEVDLVKEA
FT                   DVPSAISLLRFFLQELPEPVIPGSLHIHLLQLSQDYNNEDEFGRKLRFLLQQLPPVNYS
FT                   LLKFLCRFLANVASHHEEIWSANSLAAVFGPDVFHIYTDVEDMKEQEIVSRIMAGLLEN
FT                   YYEFFENEEEDFSSNDLSSITEQVNELSEEEEEDEKLEHIEELPEEGVEKSAGMPEVLQ
FT                   LRMTENLLDSDSVTASTRIDAAAATTTNASDGNIKCSKPVAGTTADNEVMQQDFVFEDQ
FT                   KNNESVGILLEPCSDHGDSEDGCPERKEYLLCDSDKLPHLILDSSSKIRDLNANTELEV
FT                   TEGQSVGVQGEAACIQIAQLDLKNVSDGDKWEEPFPAFKSWQEDCESGEAQLSPQAARM
FT                   THHPLGEDCPPVLSHRSLDFGQSQRFLHDPEALDFSSKALSFTRIRRSSFSSKDEKRED
FT                   RTPYQLVKKLQKKIRQFEEQFERERNSKPSYSDIAANPKVLKWMTELTKLRKQIKDAKH
FT                   KNSDGEFAPQTRPRSNTLPKSFGSSLDHEDGESEGEPRVIQKEKTPSKEATLELITKRL
FT                   KENRAERHLPEDIKKMTKDHLIEEKTSLQKSLLYYESQHGRPVTREERHIVKPLYDRYR
FT                   LVKQMLTRASITPVLGSPSTKRRGQMLQPIIEGETAHFFEEIKEEEEDGVSLSSELGDI
FT                   LSTSVHTQSSLENLESDAEENQEKLARDLCLSSTRAASVPELLEQLWKARAEKKKLRKM
FT                   LREFEEAFYQQNGRNAQKEDRVPVLEEYKEYKRIKAKLRLLEVLISKQDSSKSI"
FT   CDS             complement(join(18330614..18330737,18331874..18331975,
FT                   18333259..18333422,18333514..18333597,18336028..18336123,
FT                   18336370..18336453,18339209..18339438,18342051..18342132,
FT                   18342671..18342800,18345681..18345891,18350065..18350212,
FT                   18350965..18351013,18353160..18353215,18361551..18361686,
FT                   18374991..18375151,18382171..18382312,18382613..18382790,
FT                   18385347..18385559,18385981..18386137))
FT                   /codon_start=1
FT                   /gene="2610024E20Rik"
FT                   /locus_tag="mCG_121506"
FT                   /product="RIKEN cDNA 2610024E20, isoform CRA_a"
FT                   /note="gene_id=mCG121506.2 transcript_id=mCT122712.1
FT                   protein_id=mCP69146.1 isoform=CRA_a"
FT                   /protein_id="EDK97089.1"
FT                   /translation="MRKSSSPSLSNCNSDLASKIFGIPLDELQQGGHPDNEVPFIVRHV
FT                   VDYIEEHGGLEQQGLFQVNGNAETVEWLRQRYDSGEEVDLVKEADVPSAISLLRFFLQE
FT                   LPEPVIPGSLHIHLLQLSQDYNNEDEFGRKLRFLLQQLPPVNYSLLKFLCRFLANVASH
FT                   HEEIWSANSLAAVFGPDVFHIYTDVEDMKEQEIVSRIMAGLLENYYEFFENEEEDFSSN
FT                   DLSSITEQVNELSEEEEEDEKLEHIEELPEEGVEKSAGMPEVLQLRMTENLLDSDSVTA
FT                   STRIDAAAATTTNASDGNIKCSKPVAGTTADNEVMQQDFVFEDQKNNEILLEPCSDHGD
FT                   SEDGCPERKEYLLCDSDKLPHLILDSSSKIRDLNANTELEVTEGQSVGVQGEAACIQIA
FT                   QLDLKNVSDGDKWEEPFPAFKSWQEDCESGEAQLSPQAARMTHHPLGEDCPPVLSHRSL
FT                   DFGQSQRFLHDPEALDFSSKALSFTRIRRSSFSSKDEKREDRTPYQLVKKLQKKIRQFE
FT                   EQFERERNSKPSYSDIAANPKVLKWMTELTKLRKQIKDAKHKNSDGEFAPQTRPRSNTL
FT                   PKSFGSSLDHEDGESEGEPRVIQKEKTPSKEATLELITKRLKENRAERHLPEDIKKMTK
FT                   DHLIEEKTSLQKSLLYYESQHGRPVTREERHIVKPLYDRYRLVKQMLTRASITPVLGSP
FT                   STKRRGQMLQPIIEGETAHFFEEIKEEEEDGVSLSSELGDILSTSVHTQSSLENLESDA
FT                   EENQEKLARDLCLSSTRAASVPELLEQLWKARAEKKKLRKMLREFEEAFYQQNGRNAQK
FT                   EDRVPVLEEYKEYKRIKAKLRLLEVLISKQDSSKSI"
FT   CDS             complement(join(18333093..18333422,18333514..18333597,
FT                   18336028..18336123,18336370..18336453,18339209..18339438,
FT                   18342051..18342132,18342671..18342800,18345681..18345891,
FT                   18350065..18350212,18350965..18351013,18353160..18353224,
FT                   18361551..18361686,18368462..>18368517))
FT                   /codon_start=1
FT                   /gene="2610024E20Rik"
FT                   /locus_tag="mCG_121506"
FT                   /product="RIKEN cDNA 2610024E20, isoform CRA_c"
FT                   /note="gene_id=mCG121506.2 transcript_id=mCT188845.0
FT                   protein_id=mCP109829.0 isoform=CRA_c"
FT                   /protein_id="EDK97091.1"
FT                   /translation="RGIKKSRLRKSKTLFMPVRIDAAAATTTNASDGNIKCSKPVAGTT
FT                   ADNEVMQQDFVFEDQKNNESVGILLEPCSDHGDSEDGCPERKEYLLCDSDKLPHLILDS
FT                   SSKIRDLNANTELEVTEGQSVGVQGEAACIQIAQLDLKNVSDGDKWEEPFPAFKSWQED
FT                   CESGEAQLSPQAARMTHHPLGEDCPPVLSHRSLDFGQSQRFLHDPEALDFSSKALSFTR
FT                   IRRSSFSSKDEKREDRTPYQLVKKLQKKIRQFEEQFERERNSKPSYSDIAANPKVLKWM
FT                   TELTKLRKQIKDAKHKNSDGEFAPQTRPRSNTLPKSFGSSLDHEDGESEGEPRVIQKEK
FT                   TPSKEATLELITKRLKENRAERHLPEDIKKMTKDHLIEEKTSLQKSLLYYESQHGRPVT
FT                   REERHIVKPLYDRYRLVKQMLTRASITPVLGSPSTKRRGQMLQPIIEGETAHFFEEIKE
FT                   EEEDGVSLSSELGDILSTSVHTQSSLENLESDAEENQEKLARDLCLSSTRAASVYVLSL
FT                   YLASLTRGMRADGLSSVPSFFPWCCGWNPGPCVGETSTTSQTPLSHFPS"
FT   gap             18335173..18335238
FT                   /estimated_length=66
FT   gap             18358830..18359079
FT                   /estimated_length=250
FT   gap             18403018..18403037
FT                   /estimated_length=20
FT   gap             18417031..18417059
FT                   /estimated_length=29
FT   gene            18427844..18433798
FT                   /gene="Wnt8a"
FT                   /locus_tag="mCG_121504"
FT                   /note="gene_id=mCG121504.1"
FT   mRNA            join(18427844..18427967,18428053..18428086,
FT                   18428375..18428513,18430318..18430443,18431038..18431180,
FT                   18432619..18433798)
FT                   /gene="Wnt8a"
FT                   /locus_tag="mCG_121504"
FT                   /product="wingless-related MMTV integration site 8A"
FT                   /note="gene_id=mCG121504.1 transcript_id=mCT122710.0
FT                   created on 04-JUN-2002"
FT   CDS             join(18427900..18427967,18428053..18428086,
FT                   18428375..18428513,18430318..18430443,18431038..18431180,
FT                   18432619..18433173)
FT                   /codon_start=1
FT                   /gene="Wnt8a"
FT                   /locus_tag="mCG_121504"
FT                   /product="wingless-related MMTV integration site 8A"
FT                   /note="gene_id=mCG121504.1 transcript_id=mCT122710.0
FT                   protein_id=mCP69105.1"
FT                   /db_xref="GOA:Q0VBT1"
FT                   /db_xref="InterPro:IPR005817"
FT                   /db_xref="InterPro:IPR013301"
FT                   /db_xref="InterPro:IPR018161"
FT                   /db_xref="MGI:MGI:107924"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VBT1"
FT                   /protein_id="EDK97092.1"
FT                   /translation="MGHLLMLWVAAGMCYPALGASAWSVNNFLITGPKAYLTYTASVAL
FT                   GAQIGIEECKFQFAWERWNCPEHAFQFSTHNRLRAATRETSFIHAIRSAAIMYAVTKNC
FT                   SMGDLENCGCDESQNGKTGGHGWIWGGCSDNVEFGEKISRLFVDSLEKGKDARALVNLH
FT                   NNRAGRLAVRASTKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIEMDK
FT                   RQLRAGNRAEGRWALTEAFLPSTEAELIFLEGSPDYCNRNASLSIQGTEGRECLQNARS
FT                   ASRREQRSCGRLCTECGLQVEERRAEAVSSCDCNFQWCCTVKCGQCRRVVSRYYCTRPV
FT                   GSARPRGRGKDSAW"
FT   gap             18446280..18447315
FT                   /estimated_length=1036
FT   gene            complement(18447574..18463563)
FT                   /gene="Nme5"
FT                   /locus_tag="mCG_121505"
FT                   /note="gene_id=mCG121505.1"
FT   mRNA            complement(join(18447574..18447738,18451963..18452081,
FT                   18454726..18454826,18456389..18456594,18463031..18463240,
FT                   18463550..18463563))
FT                   /gene="Nme5"
FT                   /locus_tag="mCG_121505"
FT                   /product="expressed in non-metastatic cells 5, transcript
FT                   variant mCT122711"
FT                   /note="gene_id=mCG121505.1 transcript_id=mCT122711.0
FT                   created on 16-OCT-2002"
FT   mRNA            complement(join(18447575..18447738,18451963..18452081,
FT                   18456389..18456594,18463031..>18463244))
FT                   /gene="Nme5"
FT                   /locus_tag="mCG_121505"
FT                   /product="expressed in non-metastatic cells 5, transcript
FT                   variant mCT188841"
FT                   /note="gene_id=mCG121505.1 transcript_id=mCT188841.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(18447658..18447738,18451963..18452081,
FT                   18454726..18454826,18456389..18456594,18463031..18463159))
FT                   /codon_start=1
FT                   /gene="Nme5"
FT                   /locus_tag="mCG_121505"
FT                   /product="expressed in non-metastatic cells 5, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG121505.1 transcript_id=mCT122711.0
FT                   protein_id=mCP69114.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V2L8"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR007858"
FT                   /db_xref="InterPro:IPR012410"
FT                   /db_xref="MGI:MGI:1922783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V2L8"
FT                   /protein_id="EDK97093.1"
FT                   /translation="MEVSMPLPQIYVEKTLALIKPDVVDKEEEIQDIILGSGFTIIQRR
FT                   KLHLSPEHCSNFYVEQYGKMFFPNLTAYMSSGPLVAMILARHKAISYWKELMGPSNSLV
FT                   AKETHPDSLRAIYGTDELRNALHGSNDFAASEREIRFMFPAVIIEPIPIGQAAKDYINL
FT                   YVAPTLLQGLTELCKEKPPDPYLWLADWLMKNNPNKPKLCHFPVTEEP"
FT   CDS             complement(join(18452072..18452081,18456389..18456594,
FT                   18463031..>18463243))
FT                   /codon_start=1
FT                   /gene="Nme5"
FT                   /locus_tag="mCG_121505"
FT                   /product="expressed in non-metastatic cells 5, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG121505.1 transcript_id=mCT188841.0
FT                   protein_id=mCP109827.0 isoform=CRA_b"
FT                   /protein_id="EDK97094.1"
FT                   /translation="QADFGTRTPVVAVDNWLGDLKIVPENARMEVSMPLPQIYVEKTLA
FT                   LIKPDVVDKEEEIQDIILGSGFTIIQRRKLHLSPEHCSNFYVEQYGKMFFPNLTAYMSS
FT                   GPLVAMILARHKAISYWKELMGPSNSLVAKETHPDSDY"
FT   gap             18459530..18460362
FT                   /estimated_length=833
FT   gene            complement(18464046..18481988)
FT                   /locus_tag="mCG_121508"
FT                   /note="gene_id=mCG121508.2"
FT   mRNA            complement(join(18464046..18464717,18465273..18465450,
FT                   18469312..18469380,18470726..18470815,18477435..18477580,
FT                   18480508..18481988))
FT                   /locus_tag="mCG_121508"
FT                   /product="mCG121508"
FT                   /note="gene_id=mCG121508.2 transcript_id=mCT122714.2
FT                   created on 02-JUN-2003"
FT   CDS             complement(join(18464667..18464717,18465273..18465450,
FT                   18469312..18469380,18470726..18470815,18477435..18477580,
FT                   18480508..18480795))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121508"
FT                   /product="mCG121508"
FT                   /note="gene_id=mCG121508.2 transcript_id=mCT122714.2
FT                   protein_id=mCP69195.2"
FT                   /db_xref="GOA:G3X9B4"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="MGI:MGI:3045347"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9B4"
FT                   /protein_id="EDK97095.1"
FT                   /translation="MCLQAGCEWVWLDSGQDSHDDSELSNDCRSLLSSWDSSLDLDVGS
FT                   WKDTEDAEAEADEPKESSPERGCSELLVGDVESEEAREEAEQGTPQELLSEGEAQQDSK
FT                   EDDQGEGSASDGEDTPPLGEGEGIRVQEAPLVNILYSSSQLNDLSQGDPIQDQFLFKKT
FT                   LLQVWKMIASHRFSSPFLKPVSEKQAPGYKDVVKRPMDLTTLKRNLSKGRIHTMAEFQR
FT                   DLMLMFQNAVMYNDSDHHIYHMAVEMQREVLEQIQVLSTWLDKRKDLSSLE"
FT   gap             18472209..18472228
FT                   /estimated_length=20
FT   gene            complement(18482107..18508913)
FT                   /gene="Brd8"
FT                   /locus_tag="mCG_123921"
FT                   /note="gene_id=mCG123921.2"
FT   mRNA            complement(join(18482107..18484549,18486511..18486555,
FT                   18486980..18487084,18487950..18487984,18488906..18488974,
FT                   18489139..18489231,18489811..18490025,18490768..18490814,
FT                   18491023..18491116,18491387..18491839,18492129..18492409,
FT                   18492772..18492981,18494165..18494309,18494770..18494988,
FT                   18495492..18495628,18497397..18497461,18497576..18497656,
FT                   18498807..18498929,18499107..18499156,18501024..18501093,
FT                   18507779..18507875,18508862..18508913))
FT                   /gene="Brd8"
FT                   /locus_tag="mCG_123921"
FT                   /product="bromodomain containing 8, transcript variant
FT                   mCT176145"
FT                   /note="gene_id=mCG123921.2 transcript_id=mCT176145.1
FT                   created on 28-JUL-2003"
FT   mRNA            complement(join(18482107..18484549,18486511..18486555,
FT                   18486980..18487084,18488015..18488192,18488906..18488974,
FT                   18489139..18489231,18489811..18490025,18490768..18490814,
FT                   18491023..18491116,18491387..18491839,18492129..18492409,
FT                   18492772..18492981,18494165..18494309,18494770..18494988,
FT                   18495492..18495628,18497397..18497461,18497576..18497656,
FT                   18498807..18498929,18499107..18499156,18501024..18501093,
FT                   18507779..18507875,18508862..18508913))
FT                   /gene="Brd8"
FT                   /locus_tag="mCG_123921"
FT                   /product="bromodomain containing 8, transcript variant
FT                   mCT125157"
FT                   /note="gene_id=mCG123921.2 transcript_id=mCT125157.2
FT                   created on 28-JUL-2003"
FT   mRNA            complement(join(18484138..18484549,18486511..18486555,
FT                   18486980..18487084,18488015..18488192,18488906..18488974,
FT                   18489139..18489231,18489811..18490025,18490768..18490814,
FT                   18491023..18491116,18491387..18491839,18492129..18492409,
FT                   18494165..18494309,18494770..18494988,18495492..18495628,
FT                   18497397..18497461,18497576..18497656,18498807..18498929,
FT                   18499107..18499156,18501024..18501093,18507779..18507875,
FT                   18508862..18508892))
FT                   /gene="Brd8"
FT                   /locus_tag="mCG_123921"
FT                   /product="bromodomain containing 8, transcript variant
FT                   mCT186630"
FT                   /note="gene_id=mCG123921.2 transcript_id=mCT186630.0
FT                   created on 28-JUL-2003"
FT   mRNA            complement(join(18484138..18484549,18486511..18486555,
FT                   18486980..18487084,18488015..18488192,18488906..18488974,
FT                   18489139..18489231,18489811..18490025,18491023..18491116,
FT                   18491387..18491839,18492129..18492409,18492772..18494309,
FT                   18494770..18494988,18495492..18495628,18497397..18497461,
FT                   18497576..18497656,18498807..18498929,18499107..18499156,
FT                   18501024..18501093,18507779..18507875,18508862..>18508877))
FT                   /gene="Brd8"
FT                   /locus_tag="mCG_123921"
FT                   /product="bromodomain containing 8, transcript variant
FT                   mCT188869"
FT                   /note="gene_id=mCG123921.2 transcript_id=mCT188869.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(18484490..18484549,18486511..18486555,
FT                   18486980..18487084,18488015..18488192,18488906..18488974,
FT                   18489139..18489231,18489811..18490025,18490768..18490814,
FT                   18491023..18491116,18491387..18491839,18492129..18492409,
FT                   18494165..18494309,18494770..18494988,18495492..18495628,
FT                   18497397..18497461,18497576..18497656,18498807..18498929,
FT                   18499107..18499156,18501024..18501093,18507779..18507875,
FT                   18508862..18508880))
FT                   /codon_start=1
FT                   /gene="Brd8"
FT                   /locus_tag="mCG_123921"
FT                   /product="bromodomain containing 8, isoform CRA_b"
FT                   /note="gene_id=mCG123921.2 transcript_id=mCT186630.0
FT                   protein_id=mCP107865.0 isoform=CRA_b"
FT                   /protein_id="EDK97097.1"
FT                   /translation="MATGTGKHKLLSTGPTEPWSIREKLCLASSVMRSGDQNWVSVSRA
FT                   IKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAER
FT                   VEELKKVIKETQERYRRLKRDAELIQAGHMDSRLDELCNDIAMKKKLEEEEAEVKRKAT
FT                   DAAYQARQAVKTPPRRLPTVMVRSPVDSASPGGDYPLGDLTPTTMEEATSGVTPGTLPS
FT                   TPVTSFPGIPDTLPPGSAPLEAPMTPITDDSPQKKMLGQKATPPPSPLLSELLKKGSLL
FT                   PTSPRLVNESEMPVPPGHLNSTGVLLEVGGVLPMIHGGEIQPTTSAVAASPAASVSQPE
FT                   PCVPLEAVGDPHTVTVSMDSNEISMIINSIKEECFRSGVAEAPGGSKAPSIDGKEDLDL
FT                   AEKMDIAVSYTGEELDFETVGDIIAIIEDKVDDHPEVLDVAAVEAALSFCEENDDPQSL
FT                   PGPWEHPIQQERDKPVPLPAPEMTVKQERLDFEESENKGLHELVDIRDSGVEIKVEPTE
FT                   PEPGMSGAEIVAGVGPVPSMEPPELRSQDSDEEPRSSAAGDIGEADGSSGKGDERPLSA
FT                   VKTEASPESMLSPSHGSNLIEDPLEAETQHKFEMSDSLKEESGTIFGSQIKDAPGDDEE
FT                   EDGVSEAASLEEPKEEDQGEGYLSEMDNEPPVSESDDGFSIHNATLQSHTLADSIPSSP
FT                   ASSQFSVCSEDQEAIQAQKIWKKAIMLVWRAAANHRYANVFLQPVTDDIAPGYHSIVQR
FT                   PMDLSTIKKNIENGLIRSTAEFQRDIMLMFQNAVMYNSSDHDVYHMAVEMQRDVLEQIQ
FT                   QFLATQLIMQTSESGISAKSLRGRDSTRKQDASEKDSVPMGSPAFLLSLFDGGTRGRRC
FT                   AIEADMKMKK"
FT   CDS             complement(join(18484490..18484549,18486511..18486555,
FT                   18486980..18487084,18488015..18488192,18488906..18488974,
FT                   18489139..18489231,18489811..18490025,18490768..18490814,
FT                   18491023..18491116,18491387..18491839,18492129..18492409,
FT                   18492772..18492981,18494165..18494309,18494770..18494988,
FT                   18495492..18495628,18497397..18497461,18497576..18497656,
FT                   18498807..18498929,18499107..18499156,18501024..18501093,
FT                   18507779..18507875,18508862..18508880))
FT                   /codon_start=1
FT                   /gene="Brd8"
FT                   /locus_tag="mCG_123921"
FT                   /product="bromodomain containing 8, isoform CRA_a"
FT                   /note="gene_id=mCG123921.2 transcript_id=mCT125157.2
FT                   protein_id=mCP68973.2 isoform=CRA_a"
FT                   /protein_id="EDK97096.1"
FT                   /translation="MATGTGKHKLLSTGPTEPWSIREKLCLASSVMRSGDQNWVSVSRA
FT                   IKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAER
FT                   VEELKKVIKETQERYRRLKRDAELIQAGHMDSRLDELCNDIAMKKKLEEEEAEVKRKAT
FT                   DAAYQARQAVKTPPRRLPTVMVRSPVDSASPGGDYPLGDLTPTTMEEATSGVTPGTLPS
FT                   TPVTSFPGIPDTLPPGSAPLEAPMTPITDDSPQKKMLGQKATPPPSPLLSELLKKGSLL
FT                   PTSPRLVNESEMPVPPGHLNSTGVLLEVGGVLPMIHGGEIQPTTSAVAASPAASGAPTL
FT                   SRLLEAGPTQFTTPLPSFTTVASEPPVKLVPPPVESVSQATIVMMPALPAPSSAAAVST
FT                   SESGAPVSQPEPCVPLEAVGDPHTVTVSMDSNEISMIINSIKEECFRSGVAEAPGGSKA
FT                   PSIDGKEDLDLAEKMDIAVSYTGEELDFETVGDIIAIIEDKVDDHPEVLDVAAVEAALS
FT                   FCEENDDPQSLPGPWEHPIQQERDKPVPLPAPEMTVKQERLDFEESENKGLHELVDIRD
FT                   SGVEIKVEPTEPEPGMSGAEIVAGVGPVPSMEPPELRSQDSDEEPRSSAAGDIGEADGS
FT                   SGKGDERPLSAVKTEASPESMLSPSHGSNLIEDPLEAETQHKFEMSDSLKEESGTIFGS
FT                   QIKDAPGDDEEEDGVSEAASLEEPKEEDQGEGYLSEMDNEPPVSESDDGFSIHNATLQS
FT                   HTLADSIPSSPASSQFSVCSEDQEAIQAQKIWKKAIMLVWRAAANHRYANVFLQPVTDD
FT                   IAPGYHSIVQRPMDLSTIKKNIENGLIRSTAEFQRDIMLMFQNAVMYNSSDHDVYHMAV
FT                   EMQRDVLEQIQQFLATQLIMQTSESGISAKSLRGRDSTRKQDASEKDSVPMGSPAFLLS
FT                   LFDGGTRGRRCAIEADMKMKK"
FT   CDS             complement(join(18487047..18487084,18487950..18487984,
FT                   18488906..18488974,18489139..18489231,18489811..18490025,
FT                   18490768..18490814,18491023..18491116,18491387..18491839,
FT                   18492129..18492409,18492772..18492981,18494165..18494309,
FT                   18494770..18494988,18495492..18495628,18497397..18497461,
FT                   18497576..18497656,18498807..18498929,18499107..18499156,
FT                   18501024..18501093,18507779..18507875,18508862..18508880))
FT                   /codon_start=1
FT                   /gene="Brd8"
FT                   /locus_tag="mCG_123921"
FT                   /product="bromodomain containing 8, isoform CRA_d"
FT                   /note="gene_id=mCG123921.2 transcript_id=mCT176145.1
FT                   protein_id=mCP99067.1 isoform=CRA_d"
FT                   /protein_id="EDK97099.1"
FT                   /translation="MATGTGKHKLLSTGPTEPWSIREKLCLASSVMRSGDQNWVSVSRA
FT                   IKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAER
FT                   VEELKKVIKETQERYRRLKRDAELIQAGHMDSRLDELCNDIAMKKKLEEEEAEVKRKAT
FT                   DAAYQARQAVKTPPRRLPTVMVRSPVDSASPGGDYPLGDLTPTTMEEATSGVTPGTLPS
FT                   TPVTSFPGIPDTLPPGSAPLEAPMTPITDDSPQKKMLGQKATPPPSPLLSELLKKGSLL
FT                   PTSPRLVNESEMPVPPGHLNSTGVLLEVGGVLPMIHGGEIQPTTSAVAASPAASGAPTL
FT                   SRLLEAGPTQFTTPLPSFTTVASEPPVKLVPPPVESVSQATIVMMPALPAPSSAAAVST
FT                   SESGAPVSQPEPCVPLEAVGDPHTVTVSMDSNEISMIINSIKEECFRSGVAEAPGGSKA
FT                   PSIDGKEDLDLAEKMDIAVSYTGEELDFETVGDIIAIIEDKVDDHPEVLDVAAVEAALS
FT                   FCEENDDPQSLPGPWEHPIQQERDKPVPLPAPEMTVKQERLDFEESENKGLHELVDIRD
FT                   SGVEIKVEPTEPEPGMSGAEIVAGVGPVPSMEPPELRSQDSDEEPRSSAAGDIGEADGS
FT                   SGKGDERPLSAVKTEASPESMLSPSHGSNLIEDPLEAETQHKFEMSDSLKEESGTIFGS
FT                   QIKDAPGDDEEEDGVSEAASLEEPKEEDQGEGYLSEMDNEPPVSESDDGFSIHNATLQS
FT                   HTLADSIPSSPASSQFSVCSEDQEAIQAQKIWKKAIMLVWRAAANHRYANVFLQPVTDD
FT                   IAPGYHSIVQRDEMQRRIDEFIAILGHTVDYANI"
FT   CDS             complement(join(18490012..18490025,18491023..18491116,
FT                   18491387..18491839,18492129..18492409,18492772..>18493045))
FT                   /codon_start=1
FT                   /gene="Brd8"
FT                   /locus_tag="mCG_123921"
FT                   /product="bromodomain containing 8, isoform CRA_e"
FT                   /note="gene_id=mCG123921.2 transcript_id=mCT188869.0
FT                   protein_id=mCP109844.0 isoform=CRA_e"
FT                   /protein_id="EDK97100.1"
FT                   /translation="RGCSLLFIRVLSSLTLCTSLSGAPTLSRLLEAGPTQFTTPLPSFT
FT                   TVASEPPVKLVPPPVESVSQATIVMMPALPAPSSAAAVSTSESGAPVSQPEPCVPLEAV
FT                   GDPHTVTVSMDSNEISMIINSIKEECFRSGVAEAPGGSKAPSIDGKEDLDLAEKMDIAV
FT                   SYTGEELDFETVGDIIAIIEDKVDDHPEVLDVAAVEAALSFCEENDDPQSLPGPWEHPI
FT                   QQERDKPVPLPAPEMTVKQERLDFEESENKGLHELVDIRDSGVEIKVEPTEPEPGMSGA
FT                   EIVAGVGPVPSMEPPELRSQDSDEEPRSSAAGDIGEADGSSGKGDERPLSAVKTEASPE
FT                   SMLSPSHGSNLIEDPLEAETQHKFEMSGCPR"
FT   mRNA            complement(join(18494622..18497461,18497576..18497656,
FT                   18498807..18498929,18499107..18499156,18501024..18501093,
FT                   18507779..18507875,18508862..18508913))
FT                   /gene="Brd8"
FT                   /locus_tag="mCG_123921"
FT                   /product="bromodomain containing 8, transcript variant
FT                   mCT186631"
FT                   /note="gene_id=mCG123921.2 transcript_id=mCT186631.0
FT                   created on 28-JUL-2003"
FT   CDS             complement(join(18497296..18497461,18497576..18497656,
FT                   18498807..18498929,18499107..18499156,18501024..18501093,
FT                   18507779..18507875,18508862..18508880))
FT                   /codon_start=1
FT                   /gene="Brd8"
FT                   /locus_tag="mCG_123921"
FT                   /product="bromodomain containing 8, isoform CRA_c"
FT                   /note="gene_id=mCG123921.2 transcript_id=mCT186631.0
FT                   protein_id=mCP107866.0 isoform=CRA_c"
FT                   /protein_id="EDK97098.1"
FT                   /translation="MATGTGKHKLLSTGPTEPWSIREKLCLASSVMRSGDQNWVSVSRA
FT                   IKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAER
FT                   VEELKKVIKETQERYRRLKRDAELIQAGHMDSRLDELCNDIAMKKKLEEEEAEVKRKAT
FT                   DAAYQGELSLVLLLALTMWFCVLMTALEECDDHCSMES"
FT   gene            18508937..18517613
FT                   /gene="Kif20a"
FT                   /locus_tag="mCG_123913"
FT                   /note="gene_id=mCG123913.2"
FT   mRNA            join(18508937..18509176,18509782..18509965,
FT                   18511041..18511130,18511220..18511339,18511878..18512016,
FT                   18512110..18512297,18512378..18512507,18512711..18512905,
FT                   18513001..18513112,18513211..18513279,18513467..18513610,
FT                   18513751..18513916,18514328..18514492,18514613..18514752,
FT                   18514848..18514950,18515476..18515671,18515851..18515942,
FT                   18516256..18516393,18516631..18517137)
FT                   /gene="Kif20a"
FT                   /locus_tag="mCG_123913"
FT                   /product="kinesin family member 20A, transcript variant
FT                   mCT125149"
FT                   /note="gene_id=mCG123913.2 transcript_id=mCT125149.0
FT                   created on 16-OCT-2002"
FT   mRNA            join(<18509317..18509384,18509782..18509965,
FT                   18511041..18511130,18511220..18511339,18511878..18512016,
FT                   18512110..18512297,18512378..18512507,18512711..18512905,
FT                   18513001..18513112,18513211..18513279,18513467..18513610,
FT                   18513751..18513916,18514328..18514492,18514613..18514752,
FT                   18514848..18514950,18515476..18515671,18515851..18515942,
FT                   18516256..18516393,18516631..18517613)
FT                   /gene="Kif20a"
FT                   /locus_tag="mCG_123913"
FT                   /product="kinesin family member 20A, transcript variant
FT                   mCT188870"
FT                   /note="gene_id=mCG123913.2 transcript_id=mCT188870.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<18509317..18509384,18509782..18509965,
FT                   18511041..18511130,18511220..18511339,18511878..18512016,
FT                   18512110..18512297,18512378..18512507,18512711..18512905,
FT                   18513001..18513112,18513211..18513279,18513467..18513610,
FT                   18513751..18513916,18514328..18514492,18514613..18514752,
FT                   18514848..18514950,18515476..18515671,18515851..18515942,
FT                   18516256..18516393,18516631..18516945)
FT                   /codon_start=1
FT                   /gene="Kif20a"
FT                   /locus_tag="mCG_123913"
FT                   /product="kinesin family member 20A, isoform CRA_a"
FT                   /note="gene_id=mCG123913.2 transcript_id=mCT188870.0
FT                   protein_id=mCP109842.0 isoform=CRA_a"
FT                   /protein_id="EDK97101.1"
FT                   /translation="AGVLLRGWVEAGIREAARQTVFGHRLTLLVMSHRILSPPAGLLSD
FT                   EDVVDSPILESTAADLRSVVRKDLLSDCSVISASLEDKQALLEDTSEKVKVYLRIRPFL
FT                   TSELDRQEDQGCVCIENTETLVLQAPKDSFALKSNERGVGQATHKFTFSQIFGPEVGQV
FT                   AFFNLTMKEMVKDVLKGQNWLIYTYGVTNSGKTYTIQGTSKDAGILPQSLALIFNSLQG
FT                   QLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLIGGLQEEELSTSVKKRVHTESRIG
FT                   ASNSFDSGVAGLSSTSQFTSSSQLDETSQLWAQPDTVPVSVPADIRFSVWISFFEIYNE
FT                   LLYDLLEPPSHQHKRQTLRLCEDQNGNPYVKDLNWIHVRDVEEAWKLLKVGRKNQSFAS
FT                   THMNQQSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKHQKSGERLKEAGN
FT                   INTSLHTLGRCIAALRQNQQNRSKQNLIPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCA
FT                   STYDETLHAAKFSALASQLVHAPPVHLGIPSLHSFIKKHSPQVGPGLEKEDKADSDLED
FT                   SPEDEADVSVYGKEELLQVVEAMKALLLKERQEKLQLEIQLREEICNEMVEQMQQREQW
FT                   CSERLDNQKELMEELYEEKLKILKESLTTFYQEQIQERDEKIEELETLLQEAKQQPAAQ
FT                   QSGGLSLLRRSQRLAASASTQQFQEVKAELEQCKTELSSTTAELHKYQQVLKPPPPAKP
FT                   FTIDVDKKLEEGQKNIRLLRTELQKLGQSLQSAERACCHSTGAGKLRQALTNCDDILIK
FT                   QNQTLAELQNNMVLVKLDLQKKAACIAEQYHTVLKLQGQASAKKRLGANQENQQPNHQP
FT                   PGKKPFLRNLLPRTPTCQSSTDSSPYARILRSRHSPLLKSPFGKKY"
FT   mRNA            join(<18509357..18509587,18509782..18509965,
FT                   18511041..18511130,18511220..18511339,18511878..18512016,
FT                   18512110..18512297,18512378..18512507,18512711..18512905,
FT                   18513001..18513112,18513211..18513279,18513467..18513610,
FT                   18513751..18513916,18514328..18514492,18514613..18514752,
FT                   18514848..18514950,18515476..18515671,18515851..18515942,
FT                   18516256..18516393,18516631..18517137)
FT                   /gene="Kif20a"
FT                   /locus_tag="mCG_123913"
FT                   /product="kinesin family member 20A, transcript variant
FT                   mCT188871"
FT                   /note="gene_id=mCG123913.2 transcript_id=mCT188871.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<18509544..18509587,18509782..18509965,
FT                   18511041..18511130,18511220..18511339,18511878..18512016,
FT                   18512110..18512297,18512378..18512507,18512711..18512905,
FT                   18513001..18513112,18513211..18513279,18513467..18513610,
FT                   18513751..18513916,18514328..18514492,18514613..18514752,
FT                   18514848..18514950,18515476..18515671,18515851..18515942,
FT                   18516256..18516393,18516631..18516945)
FT                   /codon_start=1
FT                   /gene="Kif20a"
FT                   /locus_tag="mCG_123913"
FT                   /product="kinesin family member 20A, isoform CRA_b"
FT                   /note="gene_id=mCG123913.2 transcript_id=mCT188871.0
FT                   protein_id=mCP109843.0 isoform=CRA_b"
FT                   /protein_id="EDK97102.1"
FT                   /translation="TTSVERGLPFCFRTRHRLTLLVMSHRILSPPAGLLSDEDVVDSPI
FT                   LESTAADLRSVVRKDLLSDCSVISASLEDKQALLEDTSEKVKVYLRIRPFLTSELDRQE
FT                   DQGCVCIENTETLVLQAPKDSFALKSNERGVGQATHKFTFSQIFGPEVGQVAFFNLTMK
FT                   EMVKDVLKGQNWLIYTYGVTNSGKTYTIQGTSKDAGILPQSLALIFNSLQGQLHPTPDL
FT                   KPLLSNEVIWLDSKQIRQEEMKKLSLLIGGLQEEELSTSVKKRVHTESRIGASNSFDSG
FT                   VAGLSSTSQFTSSSQLDETSQLWAQPDTVPVSVPADIRFSVWISFFEIYNELLYDLLEP
FT                   PSHQHKRQTLRLCEDQNGNPYVKDLNWIHVRDVEEAWKLLKVGRKNQSFASTHMNQQSS
FT                   RSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKHQKSGERLKEAGNINTSLHTL
FT                   GRCIAALRQNQQNRSKQNLIPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCASTYDETLH
FT                   AAKFSALASQLVHAPPVHLGIPSLHSFIKKHSPQVGPGLEKEDKADSDLEDSPEDEADV
FT                   SVYGKEELLQVVEAMKALLLKERQEKLQLEIQLREEICNEMVEQMQQREQWCSERLDNQ
FT                   KELMEELYEEKLKILKESLTTFYQEQIQERDEKIEELETLLQEAKQQPAAQQSGGLSLL
FT                   RRSQRLAASASTQQFQEVKAELEQCKTELSSTTAELHKYQQVLKPPPPAKPFTIDVDKK
FT                   LEEGQKNIRLLRTELQKLGQSLQSAERACCHSTGAGKLRQALTNCDDILIKQNQTLAEL
FT                   QNNMVLVKLDLQKKAACIAEQYHTVLKLQGQASAKKRLGANQENQQPNHQPPGKKPFLR
FT                   NLLPRTPTCQSSTDSSPYARILRSRHSPLLKSPFGKKY"
FT   CDS             join(18509804..18509965,18511041..18511130,
FT                   18511220..18511339,18511878..18512016,18512110..18512297,
FT                   18512378..18512507,18512711..18512905,18513001..18513112,
FT                   18513211..18513279,18513467..18513610,18513751..18513916,
FT                   18514328..18514492,18514613..18514752,18514848..18514950,
FT                   18515476..18515671,18515851..18515942,18516256..18516393,
FT                   18516631..18516945)
FT                   /codon_start=1
FT                   /gene="Kif20a"
FT                   /locus_tag="mCG_123913"
FT                   /product="kinesin family member 20A, isoform CRA_c"
FT                   /note="gene_id=mCG123913.2 transcript_id=mCT125149.0
FT                   protein_id=mCP69205.1 isoform=CRA_c"
FT                   /protein_id="EDK97103.1"
FT                   /translation="MSHRILSPPAGLLSDEDVVDSPILESTAADLRSVVRKDLLSDCSV
FT                   ISASLEDKQALLEDTSEKVKVYLRIRPFLTSELDRQEDQGCVCIENTETLVLQAPKDSF
FT                   ALKSNERGVGQATHKFTFSQIFGPEVGQVAFFNLTMKEMVKDVLKGQNWLIYTYGVTNS
FT                   GKTYTIQGTSKDAGILPQSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMK
FT                   KLSLLIGGLQEEELSTSVKKRVHTESRIGASNSFDSGVAGLSSTSQFTSSSQLDETSQL
FT                   WAQPDTVPVSVPADIRFSVWISFFEIYNELLYDLLEPPSHQHKRQTLRLCEDQNGNPYV
FT                   KDLNWIHVRDVEEAWKLLKVGRKNQSFASTHMNQQSSRSHSIFSIRILHLQGEGDIVPK
FT                   ISELSLCDLAGSERCKHQKSGERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLIPF
FT                   RDSKLTRVFQGFFTGRGRSCMIVNVNPCASTYDETLHAAKFSALASQLVHAPPVHLGIP
FT                   SLHSFIKKHSPQVGPGLEKEDKADSDLEDSPEDEADVSVYGKEELLQVVEAMKALLLKE
FT                   RQEKLQLEIQLREEICNEMVEQMQQREQWCSERLDNQKELMEELYEEKLKILKESLTTF
FT                   YQEQIQERDEKIEELETLLQEAKQQPAAQQSGGLSLLRRSQRLAASASTQQFQEVKAEL
FT                   EQCKTELSSTTAELHKYQQVLKPPPPAKPFTIDVDKKLEEGQKNIRLLRTELQKLGQSL
FT                   QSAERACCHSTGAGKLRQALTNCDDILIKQNQTLAELQNNMVLVKLDLQKKAACIAEQY
FT                   HTVLKLQGQASAKKRLGANQENQQPNHQPPGKKPFLRNLLPRTPTCQSSTDSSPYARIL
FT                   RSRHSPLLKSPFGKKY"
FT   gene            complement(18515277..18535958)
FT                   /gene="Cdc23"
FT                   /locus_tag="mCG_123924"
FT                   /note="gene_id=mCG123924.2"
FT   mRNA            complement(join(18515277..18515631,18518728..18518847,
FT                   18518923..18519001,18520386..18520447,18520800..18520875,
FT                   18521156..18521275,18521417..18521570,18525186..18525267,
FT                   18525385..18525482,18525563..18525740,18527885..18528017,
FT                   18528111..18528216,18529287..18529329,18531125..18531262,
FT                   18535613..18535685,18535770..18535942))
FT                   /gene="Cdc23"
FT                   /locus_tag="mCG_123924"
FT                   /product="CDC23 (cell division cycle 23, yeast, homolog),
FT                   transcript variant mCT177664"
FT                   /note="gene_id=mCG123924.2 transcript_id=mCT177664.0
FT                   created on 28-JUL-2003"
FT   mRNA            complement(join(18515301..18515631,18518418..18518499,
FT                   18518728..18518847,18518923..18519001,18520386..18520447,
FT                   18520800..18520875,18521156..18521275,18521417..18521570,
FT                   18525186..18525267,18525385..18525482,18525563..18525740,
FT                   18527885..18528017,18528111..18528216,18529287..18529329,
FT                   18531125..18531262,18535613..18535685,18535770..18535958))
FT                   /gene="Cdc23"
FT                   /locus_tag="mCG_123924"
FT                   /product="CDC23 (cell division cycle 23, yeast, homolog),
FT                   transcript variant mCT125160"
FT                   /note="gene_id=mCG123924.2 transcript_id=mCT125160.1
FT                   created on 28-JUL-2003"
FT   CDS             complement(join(18515575..18515631,18518728..18518847,
FT                   18518923..18519001,18520386..18520447,18520800..18520875,
FT                   18521156..18521275,18521417..18521570,18525186..18525267,
FT                   18525385..18525482,18525563..18525740,18527885..18528017,
FT                   18528111..18528216,18529287..18529329,18531125..18531262,
FT                   18535613..18535685,18535770..18535930))
FT                   /codon_start=1
FT                   /gene="Cdc23"
FT                   /locus_tag="mCG_123924"
FT                   /product="CDC23 (cell division cycle 23, yeast, homolog),
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG123924.2 transcript_id=mCT177664.0
FT                   protein_id=mCP100586.0 isoform=CRA_e"
FT                   /protein_id="EDK97108.1"
FT                   /translation="MAANSSVVSVAAAATAVPGVSTVADFSDLQEIKKQLLLIAGLTRE
FT                   RGLLHSSKWSAELAFSLPALPLSELQPPPPLTEEDAQDVDAYTLAKAYFDVKEYDRAAH
FT                   FLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSRKHQ
FT                   ARGLDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFL
FT                   SLPDTWMKEFFLAHIYTELQLIEEALQKYQHLIDVGFSKSSYIVSQIAVAYHNIRDIDK
FT                   ALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNY
FT                   YSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDY
FT                   RAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWR
FT                   AYAVGDVEKMALVKLAKLHEQLTESEQAAQCYIKYIQDIYSCGETVEHLEESTAFRYLA
FT                   QYYFKCKLWDEASTCAQKCCAFNDFSFNFLELLSGGRRCQPL"
FT   CDS             complement(join(18515621..18515631,18518418..18518499,
FT                   18518728..18518847,18518923..18519001,18520386..18520447,
FT                   18520800..18520875,18521156..18521275,18521417..18521570,
FT                   18525186..18525267,18525385..18525482,18525563..18525740,
FT                   18527885..18528017,18528111..18528216,18529287..18529329,
FT                   18531125..18531262,18535613..18535685,18535770..18535930))
FT                   /codon_start=1
FT                   /gene="Cdc23"
FT                   /locus_tag="mCG_123924"
FT                   /product="CDC23 (cell division cycle 23, yeast, homolog),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123924.2 transcript_id=mCT125160.1
FT                   protein_id=mCP69394.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3X8W7"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR007192"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1098815"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8W7"
FT                   /protein_id="EDK97104.1"
FT                   /translation="MAANSSVVSVAAAATAVPGVSTVADFSDLQEIKKQLLLIAGLTRE
FT                   RGLLHSSKWSAELAFSLPALPLSELQPPPPLTEEDAQDVDAYTLAKAYFDVKEYDRAAH
FT                   FLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSRKHQ
FT                   ARGLDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFL
FT                   SLPDTWMKEFFLAHIYTELQLIEEALQKYQHLIDVGFSKSSYIVSQIAVAYHNIRDIDK
FT                   ALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNY
FT                   YSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDY
FT                   RAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWR
FT                   AYAVGDVEKMALVKLAKLHEQLTESEQAAQCYIKYIQDIYSCGETVEHLEESTAFRYLA
FT                   QYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQGETPTSDTPVQL"
FT   mRNA            complement(join(18516013..18518499,18518728..18518847,
FT                   18518923..18519001,18520386..18520447,18520800..18520875,
FT                   18521156..18521275,18521417..18521570,18525186..18525267,
FT                   18525385..18525482,18525563..18525740,18527885..18528017,
FT                   18528111..18528216,18529287..18529329,18531125..18531262,
FT                   18535613..18535685,18535770..18535942))
FT                   /gene="Cdc23"
FT                   /locus_tag="mCG_123924"
FT                   /product="CDC23 (cell division cycle 23, yeast, homolog),
FT                   transcript variant mCT186632"
FT                   /note="gene_id=mCG123924.2 transcript_id=mCT186632.0
FT                   created on 28-JUL-2003"
FT   CDS             complement(join(18518329..18518499,18518728..18518847,
FT                   18518923..18519001,18520386..18520447,18520800..18520875,
FT                   18521156..18521275,18521417..18521570,18525186..18525267,
FT                   18525385..18525482,18525563..18525740,18527885..18528017,
FT                   18528111..18528216,18529287..18529329,18531125..18531262,
FT                   18535613..18535685,18535770..18535930))
FT                   /codon_start=1
FT                   /gene="Cdc23"
FT                   /locus_tag="mCG_123924"
FT                   /product="CDC23 (cell division cycle 23, yeast, homolog),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG123924.2 transcript_id=mCT186632.0
FT                   protein_id=mCP107867.0 isoform=CRA_c"
FT                   /protein_id="EDK97106.1"
FT                   /translation="MAANSSVVSVAAAATAVPGVSTVADFSDLQEIKKQLLLIAGLTRE
FT                   RGLLHSSKWSAELAFSLPALPLSELQPPPPLTEEDAQDVDAYTLAKAYFDVKEYDRAAH
FT                   FLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSRKHQ
FT                   ARGLDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFL
FT                   SLPDTWMKEFFLAHIYTELQLIEEALQKYQHLIDVGFSKSSYIVSQIAVAYHNIRDIDK
FT                   ALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNY
FT                   YSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDY
FT                   RAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWR
FT                   AYAVGDVEKMALVKLAKLHEQLTESEQAAQCYIKYIQDIYSCGETVEHLEESTAFRYLA
FT                   QYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQGETPTSDTPGTFFLPAS
FT                   LSANNTPTRRVSPLNLSSVTP"
FT   mRNA            complement(join(18520154..18520447,18520800..18521275,
FT                   18521417..18521570,18525186..18525267,18525385..18525482,
FT                   18525563..18525740,18527885..18528017,18528111..18528216,
FT                   18529287..18529329,18531125..18531262,18535613..18535942))
FT                   /gene="Cdc23"
FT                   /locus_tag="mCG_123924"
FT                   /product="CDC23 (cell division cycle 23, yeast, homolog),
FT                   transcript variant mCT177665"
FT                   /note="gene_id=mCG123924.2 transcript_id=mCT177665.1
FT                   created on 28-JUL-2003"
FT   CDS             complement(join(18521152..18521275,18521417..18521570,
FT                   18525186..18525267,18525385..18525482,18525563..18525740,
FT                   18527885..18528017,18528111..18528216,18529287..18529329,
FT                   18531125..18531262,18535613..18535708))
FT                   /codon_start=1
FT                   /gene="Cdc23"
FT                   /locus_tag="mCG_123924"
FT                   /product="CDC23 (cell division cycle 23, yeast, homolog),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG123924.2 transcript_id=mCT177665.1
FT                   protein_id=mCP100587.1 isoform=CRA_b"
FT                   /protein_id="EDK97105.1"
FT                   /translation="MRFVWCSRSAELAFSLPALPLSELQPPPPLTEEDAQDVDAYTLAK
FT                   AYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEA
FT                   LRELRVELSRKHQARGLDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLEL
FT                   CNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQHLIDVGFSKSSYIVSQ
FT                   IAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEID
FT                   KYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQ
FT                   AYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLR"
FT   gap             18528619..18528959
FT                   /estimated_length=341
FT   mRNA            complement(join(18531478..18535685,18535770..18535949))
FT                   /gene="Cdc23"
FT                   /locus_tag="mCG_123924"
FT                   /product="CDC23 (cell division cycle 23, yeast, homolog),
FT                   transcript variant mCT186633"
FT                   /note="gene_id=mCG123924.2 transcript_id=mCT186633.0
FT                   created on 28-JUL-2003"
FT   CDS             complement(join(18535353..18535685,18535770..18535772))
FT                   /codon_start=1
FT                   /gene="Cdc23"
FT                   /locus_tag="mCG_123924"
FT                   /product="CDC23 (cell division cycle 23, yeast, homolog),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG123924.2 transcript_id=mCT186633.0
FT                   protein_id=mCP107868.0 isoform=CRA_d"
FT                   /protein_id="EDK97107.1"
FT                   /translation="MVCGVGLLSARLAFVGAAAAAASDRGKGTVTVAIPLTEGCAPGYS
FT                   APCHWRGASCSVGVMSQRRRLLSGASQGGSCVGVVCALKGRCSLRCYRSWGELVSNYCL
FT                   RSQPRRS"
FT   gap             18550705..18550724
FT                   /estimated_length=20
FT   gap             18553653..18553838
FT                   /estimated_length=186
FT   gap             18561290..18561309
FT                   /estimated_length=20
FT   gap             18566444..18566550
FT                   /estimated_length=107
FT   gap             18567890..18567909
FT                   /estimated_length=20
FT   gene            complement(18574908..>18605628)
FT                   /gene="Gfra3"
FT                   /locus_tag="mCG_123915"
FT                   /note="gene_id=mCG123915.1"
FT   mRNA            complement(join(18574908..18575625,18575818..18575906,
FT                   18576267..18576401,18576551..18576654,18580566..18580878,
FT                   18589903..18589996,18605501..>18605628))
FT                   /gene="Gfra3"
FT                   /locus_tag="mCG_123915"
FT                   /product="glial cell line derived neurotrophic factor
FT                   family receptor alpha 3"
FT                   /note="gene_id=mCG123915.1 transcript_id=mCT125151.0
FT                   created on 16-OCT-2002"
FT   CDS             complement(join(18575536..18575625,18575818..18575906,
FT                   18576267..18576401,18576551..18576654,18580566..18580878,
FT                   18589903..>18589996))
FT                   /codon_start=1
FT                   /gene="Gfra3"
FT                   /locus_tag="mCG_123915"
FT                   /product="glial cell line derived neurotrophic factor
FT                   family receptor alpha 3"
FT                   /note="gene_id=mCG123915.1 transcript_id=mCT125151.0
FT                   protein_id=mCP69232.1"
FT                   /protein_id="EDK97109.1"
FT                   /translation="GDYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTL
FT                   HDKCDRLRKAYGEACSGIRCQRHLCLAQLRSFFEKAAESHAQGLLLCPCAPEDAGCGER
FT                   RRNTIAPSCALPSVTPNCLDLRSFCRADPLCRSRLMDFQTHCHPMDILGTCATEQSRCL
FT                   RAYLGLIGTAMTPNFISKVNTTVALSCTCRGSGNLQDECEQLERSFSQNPCLVEAIAAK
FT                   MRFHRQLFSQDWADSTFSVVQQQNSNPALRLQPRLPILSFSILPLILLQTLW"
FT   gap             18583413..18583432
FT                   /estimated_length=20
FT   gap             18596191..18600835
FT                   /estimated_length=4645
FT   gap             18608773..18610153
FT                   /estimated_length=1381
FT   gap             18611692..18614072
FT                   /estimated_length=2381
FT   gap             18617137..18617156
FT                   /estimated_length=20
FT   gap             18618429..18618448
FT                   /estimated_length=20
FT   gene            complement(18619286..18637542)
FT                   /gene="Cdc25c"
FT                   /locus_tag="mCG_123910"
FT                   /note="gene_id=mCG123910.1"
FT   mRNA            complement(join(18619286..18619682,18619866..18619977,
FT                   18621004..18621137,18621656..18621754,18624499..18624561,
FT                   18626362..18626463,18629974..18630099,18630907..18631060,
FT                   18633257..18633346,18633643..18633676,18634948..18634993,
FT                   18635550..18635644,18636771..18637244,18637347..18637542))
FT                   /gene="Cdc25c"
FT                   /locus_tag="mCG_123910"
FT                   /product="cell division cycle 25 homolog C (S. cerevisiae),
FT                   transcript variant mCT125146"
FT                   /note="gene_id=mCG123910.1 transcript_id=mCT125146.0
FT                   created on 04-JUN-2002"
FT   mRNA            complement(join(18619286..18619682,18619866..18619977,
FT                   18621004..18621137,18621656..18621754,18624499..18624561,
FT                   18626362..18626463,18629974..18630099,18630907..18631005,
FT                   18633257..18633346,18633643..18633676,18634948..18634993,
FT                   18635550..18635644,18636771..18636996,18637147..18637244,
FT                   18637347..18637532))
FT                   /gene="Cdc25c"
FT                   /locus_tag="mCG_123910"
FT                   /product="cell division cycle 25 homolog C (S. cerevisiae),
FT                   transcript variant mCT169883"
FT                   /note="gene_id=mCG123910.1 transcript_id=mCT169883.0
FT                   created on 04-JUN-2002"
FT   CDS             complement(join(18619530..18619682,18619866..18619977,
FT                   18621004..18621137,18621656..18621754,18624499..18624561,
FT                   18626362..18626463,18629974..18630099,18630907..18631005,
FT                   18633257..18633346,18633643..18633676,18634948..18634993,
FT                   18635550..18635644,18636771..18636961))
FT                   /codon_start=1
FT                   /gene="Cdc25c"
FT                   /locus_tag="mCG_123910"
FT                   /product="cell division cycle 25 homolog C (S. cerevisiae),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG123910.1 transcript_id=mCT169883.0
FT                   protein_id=mCP92523.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UR74"
FT                   /db_xref="InterPro:IPR000751"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="MGI:MGI:88350"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UR74"
FT                   /protein_id="EDK97111.1"
FT                   /translation="MSTGPIPPASEEGSFVSAPSFRSKQRKILHLLLERNTSFTIRSDF
FT                   PESPKDKLHDSANLSILSGGTPKCCLDLSNLSSGEMSASPLTTSADLEDNGSLDSSGPL
FT                   DRQLTGKDFHQDLMKGIPVQLLCSTPNAMNHGHRKKIAKRSTSAHKENINTSLKALEWE
FT                   APRTPRFRKMPGGPLTSPLCELEMKHLGSPITTVPKLSQNVKLEDQERISEDPMECSLG
FT                   DQDAKGLSLRKMVPLCDMNAIQMEEEESGSELLIGDFSKVCVLPTVPGKHPDLKYISPD
FT                   TVAALLSGKFQSVIERFYIIDCRYPYEYLGGHILGALNLHSQKELHEFFLRKPVVPLDI
FT                   QKRVIIVFLCEFSSERGPRMCRSLREKDRALNQYPALYYPELYILKGGYRDFFPEYMEL
FT                   CDPQSYCPMLHQDHQAELLSWRSQSKAQEGERQLQGQIALLVKGASPQ"
FT   CDS             complement(join(18619530..18619682,18619866..18619977,
FT                   18621004..18621137,18621656..18621754,18624499..18624561,
FT                   18626362..18626463,18629974..18630099,18630907..18630945))
FT                   /codon_start=1
FT                   /gene="Cdc25c"
FT                   /locus_tag="mCG_123910"
FT                   /product="cell division cycle 25 homolog C (S. cerevisiae),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123910.1 transcript_id=mCT125146.0
FT                   protein_id=mCP69161.1 isoform=CRA_a"
FT                   /protein_id="EDK97110.1"
FT                   /translation="MPGGPLTSPLCELEMKHLGSPITTVPKLSQNVKLEDQERISEDPM
FT                   ECSLGDQDAKGLSLRKMVPLCDMNAIQMEEEESGSELLIGDFSKVCVLPTVPGKHPDLK
FT                   YISPDTVAALLSGKFQSVIERFYIIDCRYPYEYLGGHILGALNLHSQKELHEFFLRKPV
FT                   VPLDIQKRVIIVFLCEFSSERGPRMCRSLREKDRALNQYPALYYPELYILKGGYRDFFP
FT                   EYMELCDPQSYCPMLHQDHQAELLSWRSQSKAQEGERQLQGQIALLVKGASPQ"
FT   gene            18623673..18624299
FT                   /locus_tag="mCG_123916"
FT                   /note="gene_id=mCG123916.1"
FT   mRNA            18623673..18624299
FT                   /locus_tag="mCG_123916"
FT                   /product="mCG123916"
FT                   /note="gene_id=mCG123916.1 transcript_id=mCT125152.0
FT                   created on 04-JUN-2002"
FT   CDS             18623700..18624182
FT                   /codon_start=1
FT                   /locus_tag="mCG_123916"
FT                   /product="mCG123916"
FT                   /note="gene_id=mCG123916.1 transcript_id=mCT125152.0
FT                   protein_id=mCP69234.1"
FT                   /db_xref="GOA:W4VSN7"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniProtKB/TrEMBL:W4VSN7"
FT                   /protein_id="EDK97112.1"
FT                   /translation="MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRF
FT                   AKKHNKKGLEKMQASNAKAVSVHAEAIKALVKPQAIKPKMPKGPKLKRLAFIAHPKLGK
FT                   RIRSYMAKGQRLCQPKPKVQTKAGAKAPAKAQASTPAQAPKGAQAPKGAQAPVKAP"
FT   gap             18625797..18626278
FT                   /estimated_length=482
FT   gene            <18637841..18644710
FT                   /locus_tag="mCG_145673"
FT                   /note="gene_id=mCG145673.0"
FT   mRNA            join(<18637841..18638168,18640517..18640602,
FT                   18640709..18642687)
FT                   /locus_tag="mCG_145673"
FT                   /product="mCG145673, transcript variant mCT185098"
FT                   /note="gene_id=mCG145673.0 transcript_id=mCT185098.0
FT                   created on 02-JUN-2003"
FT   mRNA            join(<18637942..18638168,18644257..18644710)
FT                   /locus_tag="mCG_145673"
FT                   /product="mCG145673, transcript variant mCT185099"
FT                   /note="gene_id=mCG145673.0 transcript_id=mCT185099.0
FT                   created on 02-JUN-2003"
FT   CDS             <18641466..18641861
FT                   /codon_start=1
FT                   /locus_tag="mCG_145673"
FT                   /product="mCG145673, isoform CRA_a"
FT                   /note="gene_id=mCG145673.0 transcript_id=mCT185098.0
FT                   protein_id=mCP106356.0 isoform=CRA_a"
FT                   /protein_id="EDK97113.1"
FT                   /translation="AVSAPLFYFPYVPIFSYSLLSAPFRPLTSCLSLSLSLSLSLSLSL
FT                   SPLSLSLSHTNKQNVSKVGYHLYSRASVSFCIITIPLKVSITSEHYSPPFPSLSLRVSQ
FT                   TVSCSLSWPQSLYVVKNDIELASTSEG"
FT   CDS             <18644451..18644657
FT                   /codon_start=1
FT                   /locus_tag="mCG_145673"
FT                   /product="mCG145673, isoform CRA_b"
FT                   /note="gene_id=mCG145673.0 transcript_id=mCT185099.0
FT                   protein_id=mCP106357.0 isoform=CRA_b"
FT                   /protein_id="EDK97114.1"
FT                   /translation="RKESETLPYSDLSMRAFIEKNFSHLRPPIYRRARSLYGLSSLLTS
FT                   TPSLLKKNLKLWLRWEVVIMVQT"
FT   gene            <18644931..18659781
FT                   /gene="2810012G03Rik"
FT                   /locus_tag="mCG_123927"
FT                   /note="gene_id=mCG123927.2"
FT   mRNA            join(<18644931..18645169,18648520..18648749,
FT                   18649098..18649155,18654183..18654967,18656621..18659781)
FT                   /gene="2810012G03Rik"
FT                   /locus_tag="mCG_123927"
FT                   /product="RIKEN cDNA 2810012G03, transcript variant
FT                   mCT188834"
FT                   /note="gene_id=mCG123927.2 transcript_id=mCT188834.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<18645580..18645622,18648520..18648749,
FT                   18649098..18649155,18654183..18654967,18656621..18659761)
FT                   /gene="2810012G03Rik"
FT                   /locus_tag="mCG_123927"
FT                   /product="RIKEN cDNA 2810012G03, transcript variant
FT                   mCT188835"
FT                   /note="gene_id=mCG123927.2 transcript_id=mCT188835.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(18645581..18645619,18648520..18648749,
FT                   18654183..18654967,18656756..18659776)
FT                   /gene="2810012G03Rik"
FT                   /locus_tag="mCG_123927"
FT                   /product="RIKEN cDNA 2810012G03, transcript variant
FT                   mCT125163"
FT                   /note="gene_id=mCG123927.2 transcript_id=mCT125163.1
FT                   created on 04-JUN-2002"
FT   CDS             join(<18648600..18648749,18649098..18649155,
FT                   18654183..18654967,18656621..18656881)
FT                   /codon_start=1
FT                   /gene="2810012G03Rik"
FT                   /locus_tag="mCG_123927"
FT                   /product="RIKEN cDNA 2810012G03, isoform CRA_b"
FT                   /note="gene_id=mCG123927.2 transcript_id=mCT188834.0
FT                   protein_id=mCP109845.0 isoform=CRA_b"
FT                   /protein_id="EDK97116.1"
FT                   /translation="DPGERQGRHPPIAPKCASQVLGRNMITLITEQLQKQTLDELKCTR
FT                   FSVSLPLPDHADIPNCGDPFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRP
FT                   PSRGNSPKEPPLSQVLSPEPPDPEKLPVPPAPPSKRHCRSLSVPVDLSRWQPVWRPAPS
FT                   KLWTPIKHRGNAGGGGPQVPQQSPPKRVSSLRFLQAPSASSQCAPAHRPYSPPFFSLAL
FT                   AQDSAQPCATSPQSGSWESDAESLSPCPPQRRFSLSPSLGPQASRFLPSARSSPASSPE
FT                   LPWRPRGLRNLPRSRSQPCDLDARKTGVKRRHEEDCRRLRPSLDFDKMNQKPYSGGLCL
FT                   QETAREEGSNVSPPWFMACSPPPLSASCSPVEGSSQVLSESEEEEEGSVRWERQALSKR
FT                   TLCQQDFGDLDLNLIEEN"
FT   CDS             join(<18648600..18648749,18649098..18649155,
FT                   18654183..18654967,18656621..18656881)
FT                   /codon_start=1
FT                   /gene="2810012G03Rik"
FT                   /locus_tag="mCG_123927"
FT                   /product="RIKEN cDNA 2810012G03, isoform CRA_b"
FT                   /note="gene_id=mCG123927.2 transcript_id=mCT188835.0
FT                   protein_id=mCP109846.0 isoform=CRA_b"
FT                   /protein_id="EDK97117.1"
FT                   /translation="DPGERQGRHPPIAPKCASQVLGRNMITLITEQLQKQTLDELKCTR
FT                   FSVSLPLPDHADIPNCGDPFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRP
FT                   PSRGNSPKEPPLSQVLSPEPPDPEKLPVPPAPPSKRHCRSLSVPVDLSRWQPVWRPAPS
FT                   KLWTPIKHRGNAGGGGPQVPQQSPPKRVSSLRFLQAPSASSQCAPAHRPYSPPFFSLAL
FT                   AQDSAQPCATSPQSGSWESDAESLSPCPPQRRFSLSPSLGPQASRFLPSARSSPASSPE
FT                   LPWRPRGLRNLPRSRSQPCDLDARKTGVKRRHEEDCRRLRPSLDFDKMNQKPYSGGLCL
FT                   QETAREEGSNVSPPWFMACSPPPLSASCSPVEGSSQVLSESEEEEEGSVRWERQALSKR
FT                   TLCQQDFGDLDLNLIEEN"
FT   CDS             join(18648725..18648749,18654183..18654967,
FT                   18656756..18656881)
FT                   /codon_start=1
FT                   /gene="2810012G03Rik"
FT                   /locus_tag="mCG_123927"
FT                   /product="RIKEN cDNA 2810012G03, isoform CRA_a"
FT                   /note="gene_id=mCG123927.2 transcript_id=mCT125163.1
FT                   protein_id=mCP69411.1 isoform=CRA_a"
FT                   /protein_id="EDK97115.1"
FT                   /translation="MHALQRQSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPS
FT                   RGNSPKEPPLSQVLSPEPPDPEKLPVPPAPPSKRHCRSLSVPVDLSRWQPVWRPAPSKL
FT                   WTPIKHRGNAGGGGPQVPQQSPPKRVSSLRFLQAPSASSQCAPAHRPYSPPFFSLALAQ
FT                   DSAQPCATSPQSGSWESDAESLSPCPPQRRFSLSPSLGPQASRFLPSARSSPASSPELP
FT                   WRPRGLRNLPRSRSQPCDLDARKTGVKRRHEEDCRRLRPSLDFDKMNQVLSESEEEEEG
FT                   SVRWERQALSKRTLCQQDFGDLDLNLIEEN"
FT   gap             18662084..18662306
FT                   /estimated_length=223
FT   gap             18663288..18663839
FT                   /estimated_length=552
FT   gap             18678021..18678040
FT                   /estimated_length=20
FT   gene            <18679253..18725282
FT                   /locus_tag="mCG_123922"
FT                   /note="gene_id=mCG123922.1"
FT   mRNA            join(<18679253..18679420,18680699..18680812,
FT                   18681924..18682029,18683036..18683160,18685533..18685607,
FT                   18689699..18690299,18694491..18695739,18696509..18696710,
FT                   18698609..18698823,18699646..18699798,18706018..18706125,
FT                   18708609..18708736,18709669..18709948,18710939..18711195,
FT                   18713240..18713506,18714315..18714486,18714840..18714930,
FT                   18715069..18715199,18716030..18716149,18717325..18717464,
FT                   18719212..18719388,18720118..18720252,18723503..18725282)
FT                   /locus_tag="mCG_123922"
FT                   /product="mCG123922"
FT                   /note="gene_id=mCG123922.1 transcript_id=mCT125158.1
FT                   created on 04-JUN-2002"
FT   CDS             join(<18689847..18690299,18694491..18695739,
FT                   18696509..18696710,18698609..18698823,18699646..18699798,
FT                   18706018..18706125,18708609..18708736,18709669..18709948,
FT                   18710939..18711195,18713240..18713506,18714315..18714486,
FT                   18714840..18714930,18715069..18715199,18716030..18716149,
FT                   18717325..18717464,18719212..18719388,18720118..18720252,
FT                   18723503..18723583)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123922"
FT                   /product="mCG123922"
FT                   /note="gene_id=mCG123922.1 transcript_id=mCT125158.1
FT                   protein_id=mCP69012.1"
FT                   /protein_id="EDK97118.1"
FT                   /translation="TVMGVMEVRQAEGPGKEVMPVESQGWSREPSSHRLHLFPRLTANI
FT                   RFATYTKENGRTLVVQDEPVGGDTPVPFTPYASATGQTPLAPEVGGAENKEAGKTLEQV
FT                   SQGMVASAAVVTTASSTPTTVRISDTGLASGTGPEKQKGSWSQASGENSRNSSLASSGF
FT                   GVSLSSLSQPLTFGSGRSQSNGVLATDNKPLGFSFSCSSASESQKDSDLSKNLFFQCMS
FT                   QNVPSTNYLSRVSESVADDSSSRDSFTQSLESLTSGLCKGRSVLGADTQPGPKAGSSVD
FT                   RKVPAESMPTLTPAFPRSLLNTRTPENHENLFLQPPKLSREEPSNPFLAFVEKVEHSPF
FT                   SSFVSQASGSSSSATSVTSKATASWPESHSSAESAPLAKKKPLFITTDSSKLVSGVLGS
FT                   ALSTGSPSLSAVGNGRSSSPTNSLTQPIEMPTLSSSPTEERPTVGPGQQDNPLLKTFST
FT                   VFGRHSGSFLSAPAEFAQENKAPFEAVKRFSLDERSLACRQDSDSSTNSDLSDLSDSEE
FT                   QLQAKSGLKGIPEHLMGKLGPNGERSAELLLGKGKGKQAPKGRPRTAPLKVGQSVLKDV
FT                   SKVRKLKQSGEPFLQDGSCINVAPHLHKCRECRLERYRKFKEQEQDDSTVACRFFHFRR
FT                   LVFTRKGVLRVEGFLSPQQSDPDAMNLWIPSSSLAEGIDLETSKYILANVGDQFCQLVM
FT                   SEKEAMMMVEPHQKVAWKRAVRGVREMCDVCETTLFNIHWVCRKCGFGVCLDCYRLRKS
FT                   RPRSETEEMGDEEVFSWLKCAKGQSHEPENLMPTQIIPGTALYNIGDMVHAARGKWGIK
FT                   ANCPCISRQSKSVLRPAVTNGISQLPSVTPSASSGNETTFSSGGGAAAVTNPEPDQVPK
FT                   GAGTDGRSEEPLKAEGSASNSNSELKAIRPPCPDTAPPSSALHWLADLATQKAKEETKD
FT                   AGSLRSVLNKESHSPFGLDSFNSTAKVSPLTPKLFNSLLLGPTASNSKTEGSSLRDLLH
FT                   SGPGKLPQTPLDTGIPFPPVFSSSSAVAKSKASLPDFLDHIIASVVENKKTSDPSKRSC
FT                   NLTDTQKEVKEMAMGLNVLDPHTSHSWLCDGRLLCLHDPSNKNNWKIFRECWKQGQPVL
FT                   VSGVHKKLKSELWKPEAFSQEFGDQDVDLVNCRNCAIISDVKVRDFWDGFEIICKRLRS
FT                   EDGQPMVLKLKDWPPGEDFRDMMPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRP
FT                   DLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPVGEGAHDEEVLKTIDEG
FT                   DADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSW
FT                   YLDQILRKRLFEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVK
FT                   HCFRLTQEFRHLSNTHTNHEDKLQVKNIIYHAVKDAVGTLKAHESKLARS"
FT   gene            18726543..18732517
FT                   /gene="Reep2"
FT                   /locus_tag="mCG_123926"
FT                   /note="gene_id=mCG123926.1"
FT   mRNA            join(18726543..18726700,18728367..18728439,
FT                   18728770..18728846,18731165..18731285,18731488..18731601,
FT                   18731858..18732005,18732102..18732232,18732314..18732517)
FT                   /gene="Reep2"
FT                   /locus_tag="mCG_123926"
FT                   /product="receptor accessory protein 2"
FT                   /note="gene_id=mCG123926.1 transcript_id=mCT125162.0
FT                   created on 04-JUN-2002"
FT   CDS             join(18726669..18726700,18728367..18728439,
FT                   18728770..18728846,18731165..18731285,18731488..18731601,
FT                   18731858..18732005,18732102..18732232,18732314..18732382)
FT                   /codon_start=1
FT                   /gene="Reep2"
FT                   /locus_tag="mCG_123926"
FT                   /product="receptor accessory protein 2"
FT                   /note="gene_id=mCG123926.1 transcript_id=mCT125162.0
FT                   protein_id=mCP69407.1"
FT                   /protein_id="EDK97119.1"
FT                   /translation="MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVF
FT                   AFFTTAETLTDIILSWFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEID
FT                   EYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDLTLIRDED
FT                   ALPLQGPDGRLQPGPVGLLDTIEDLGDEPALSLRSSTSQPDPRTETSEDDLGDKAPKRT
FT                   KPIKKVPRAEPPASKTLKTRPKKKSSGGGDSA"
FT   gene            <18745733..18751088
FT                   /gene="Egr1"
FT                   /locus_tag="mCG_123917"
FT                   /note="gene_id=mCG123917.1"
FT   mRNA            join(<18745733..18746774,18747019..18747893,
FT                   18748572..18751088)
FT                   /gene="Egr1"
FT                   /locus_tag="mCG_123917"
FT                   /product="early growth response 1"
FT                   /note="gene_id=mCG123917.1 transcript_id=mCT125153.1
FT                   created on 04-JUN-2002"
FT   gap             18746788..18747012
FT                   /estimated_length=225
FT   CDS             join(<18747719..18747893,18748572..18749875)
FT                   /codon_start=1
FT                   /gene="Egr1"
FT                   /locus_tag="mCG_123917"
FT                   /product="early growth response 1"
FT                   /note="gene_id=mCG123917.1 transcript_id=mCT125153.1
FT                   protein_id=mCP69410.0"
FT                   /protein_id="EDK97120.1"
FT                   /translation="ATGLPSSSVLPEPQRAAAVIAAAAPAAGAVVGAAATAAAAPSILK
FT                   GSRAEQPYEHLTTESFSDIALNNEKAMVETSYPSQTTRLPPITYTGRFSLEPAPNSGNT
FT                   LWPEPLFSLVSGLVSMTNPPTSSSSAPSPAASSSSSASQSPPLSCAVPSNDSSPIYSAA
FT                   PTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPATKGGFQVPMIPDYLFPQQQGDLS
FT                   LGTPDQKPFQGLENRTQQPSLTPLSTIKAFATQSGSQDLKALNTTYQSQLIKPSRMRKY
FT                   PNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHL
FT                   TTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVASPAASSLSSY
FT                   PSPVATSYPSPATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQ
FT                   VSSFPSAGVSSSFSTSTGLSDMTATFSPRTIEIC"
FT   gap             18770019..18770051
FT                   /estimated_length=33
FT   gap             18773564..18773618
FT                   /estimated_length=55
FT   gene            complement(18790652..18818225)
FT                   /gene="Etf1"
FT                   /locus_tag="mCG_123923"
FT                   /note="gene_id=mCG123923.1"
FT   mRNA            complement(join(18790652..18791279,18792191..18792338,
FT                   18793824..18793888,18794251..18794406,18795352..18795481,
FT                   18795954..18796144,18796325..18796463,18799758..18799897,
FT                   18800226..18800401,18817800..18817903,18818065..18818225))
FT                   /gene="Etf1"
FT                   /locus_tag="mCG_123923"
FT                   /product="eukaryotic translation termination factor 1"
FT                   /note="gene_id=mCG123923.1 transcript_id=mCT125159.1
FT                   created on 04-JUN-2002"
FT   CDS             complement(join(18791197..18791279,18792191..18792338,
FT                   18793824..18793888,18794251..18794406,18795352..18795481,
FT                   18795954..18796144,18796325..18796463,18799758..18799897,
FT                   18800226..18800401,18817800..18817885))
FT                   /codon_start=1
FT                   /gene="Etf1"
FT                   /locus_tag="mCG_123923"
FT                   /product="eukaryotic translation termination factor 1"
FT                   /note="gene_id=mCG123923.1 transcript_id=mCT125159.1
FT                   protein_id=mCP69226.1"
FT                   /protein_id="EDK97121.1"
FT                   /translation="MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQI
FT                   SRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEE
FT                   GKEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSGALFGTLQG
FT                   NTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVA
FT                   GLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNVKFI
FT                   QEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEE
FT                   EKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEG
FT                   SQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY"
FT   gap             18800065..18800130
FT                   /estimated_length=66
FT   gene            complement(18823662..18840538)
FT                   /gene="Hspa9a"
FT                   /locus_tag="mCG_123914"
FT                   /note="gene_id=mCG123914.1"
FT   mRNA            complement(join(18823662..18824624,18824815..18824955,
FT                   18825164..18825256,18825574..18825668,18826427..18826544,
FT                   18827070..18827174,18828095..18828322,18829306..18829515,
FT                   18832175..18832267,18832713..18832875,18834128..18834234,
FT                   18834323..18834396,18835234..18835358,18837441..18837622,
FT                   18838613..18838700,18838892..18838950,18840385..18840538))
FT                   /gene="Hspa9a"
FT                   /locus_tag="mCG_123914"
FT                   /product="heat shock protein 9A"
FT                   /note="gene_id=mCG123914.1 transcript_id=mCT125150.0
FT                   created on 04-JUN-2002"
FT   CDS             complement(join(18824547..18824624,18824815..18824955,
FT                   18825164..18825256,18825574..18825668,18826427..18826544,
FT                   18827070..18827174,18828095..18828322,18829306..18829515,
FT                   18832175..18832267,18832713..18832875,18834128..18834234,
FT                   18834323..18834396,18835234..18835358,18837441..18837622,
FT                   18838613..18838700,18838892..18838950,18840385..18840465))
FT                   /codon_start=1
FT                   /gene="Hspa9a"
FT                   /locus_tag="mCG_123914"
FT                   /product="heat shock protein 9A"
FT                   /note="gene_id=mCG123914.1 transcript_id=mCT125150.0
FT                   protein_id=mCP69216.1"
FT                   /db_xref="GOA:P38647"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="MGI:MGI:96245"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38647"
FT                   /protein_id="EDK97122.1"
FT                   /translation="MISASRAAAARLVGTAASRSPAAARPQDGWNGLSHEAFRFVSRRD
FT                   YASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMP
FT                   AKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDTKNVPFKIVRASNGDAWVEAHGKLYSP
FT                   SQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINE
FT                   PTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQA
FT                   LLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDASGPK
FT                   HLNMKLTRAQFEGIVTDLIKRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTV
FT                   QDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLI
FT                   NRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQ
FT                   IEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKK
FT                   ERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRALLAGKDSETGENIRQ
FT                   AASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ"
FT   gap             18850325..18850608
FT                   /estimated_length=284
FT   gap             18856486..18859782
FT                   /estimated_length=3297
FT   gap             18872715..18872734
FT                   /estimated_length=20
FT   gap             18935824..18935872
FT                   /estimated_length=49
FT   gap             18942006..18942025
FT                   /estimated_length=20
FT   gap             18955956..18955975
FT                   /estimated_length=20
FT   gap             18967094..18967113
FT                   /estimated_length=20
FT   gap             18982395..18982414
FT                   /estimated_length=20
FT   gap             18983849..18983923
FT                   /estimated_length=75
FT   gap             18988265..18989715
FT                   /estimated_length=1451
FT   gap             18991812..18991858
FT                   /estimated_length=47
FT   gene            19006079..19142318
FT                   /gene="Ctnna1"
FT                   /locus_tag="mCG_123912"
FT                   /note="gene_id=mCG123912.2"
FT   mRNA            join(19006079..19006097,19040275..19040381,
FT                   19042019..19042214,19061822..19061988,19062666..19062785,
FT                   19067254..19067523,19069919..19070122,19109638..19109718,
FT                   19110996..19111148,19123149..19123241,19126925..19127081,
FT                   19131497..19131697,19132239..19132390,19137245..19137355,
FT                   19138389..19138570,19138709..19138814,19140159..19140293,
FT                   19141148..19142316)
FT                   /gene="Ctnna1"
FT                   /locus_tag="mCG_123912"
FT                   /product="catenin (cadherin associated protein), alpha 1,
FT                   transcript variant mCT125148"
FT                   /note="gene_id=mCG123912.2 transcript_id=mCT125148.1
FT                   created on 04-JUN-2003"
FT   gap             19006230..19006774
FT                   /estimated_length=545
FT   CDS             join(19040277..19040381,19042019..19042214,
FT                   19061822..19061988,19062666..19062785,19067254..19067523,
FT                   19069919..19070122,19109638..19109718,19110996..19111148,
FT                   19123149..19123241,19126925..19127081,19131497..19131697,
FT                   19132239..19132390,19137245..19137355,19138389..19138570,
FT                   19138709..19138814,19140159..19140293,19141148..19141435)
FT                   /codon_start=1
FT                   /gene="Ctnna1"
FT                   /locus_tag="mCG_123912"
FT                   /product="catenin (cadherin associated protein), alpha 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123912.2 transcript_id=mCT125148.1
FT                   protein_id=mCP69187.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q545R0"
FT                   /db_xref="InterPro:IPR000633"
FT                   /db_xref="InterPro:IPR001033"
FT                   /db_xref="InterPro:IPR006077"
FT                   /db_xref="MGI:MGI:88274"
FT                   /db_xref="UniProtKB/TrEMBL:Q545R0"
FT                   /protein_id="EDK97123.1"
FT                   /translation="MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSK
FT                   GPSNKKRGRSKKAHVLAASVEQATENFLEKGDKIAKESQFLKEELVVAVEDVRKQGDLM
FT                   KSAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILK
FT                   LRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILY
FT                   TASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQATASDDAAQHQGGSGGELAYA
FT                   LNNFDKQIIVDPLSFSEERFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAV
FT                   RQALQDLLSEYMGNAGRKERSDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNV
FT                   PLLVLIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLE
FT                   ALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSEN
FT                   HILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEAT
FT                   KLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTP
FT                   EELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEE
FT                   KSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAG
FT                   SRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGV
FT                   DSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVK
FT                   REKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI"
FT   gap             19042326..19042412
FT                   /estimated_length=87
FT   mRNA            join(<19069977..19070122,19109638..19109718,
FT                   19110996..19111148,19123149..19123188,19142144..19142318)
FT                   /gene="Ctnna1"
FT                   /locus_tag="mCG_123912"
FT                   /product="catenin (cadherin associated protein), alpha 1,
FT                   transcript variant mCT185117"
FT                   /note="gene_id=mCG123912.2 transcript_id=mCT185117.0
FT                   created on 04-JUN-2003"
FT   CDS             join(<19069979..19070122,19109638..19109718,
FT                   19110996..19111148,19123149..19123188,19142144..19142178)
FT                   /codon_start=1
FT                   /gene="Ctnna1"
FT                   /locus_tag="mCG_123912"
FT                   /product="catenin (cadherin associated protein), alpha 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG123912.2 transcript_id=mCT185117.0
FT                   protein_id=mCP106375.0 isoform=CRA_b"
FT                   /protein_id="EDK97124.1"
FT                   /translation="ERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEY
FT                   MGNAGRKERSDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKN
FT                   GNEKEVKEYAQVFREHANKLIEVANLACSISNNEEAKKPDDCIGFA"
FT   gene            complement(19097498..19102490)
FT                   /gene="Lrrtm2"
FT                   /locus_tag="mCG_123920"
FT                   /note="gene_id=mCG123920.1"
FT   mRNA            complement(join(19097498..19101814,19102164..19102490))
FT                   /gene="Lrrtm2"
FT                   /locus_tag="mCG_123920"
FT                   /product="leucine rich repeat transmembrane neuronal 2"
FT                   /note="gene_id=mCG123920.1 transcript_id=mCT125156.0
FT                   created on 04-JUN-2002"
FT   CDS             complement(join(19100271..19101814,19102164..19102167))
FT                   /codon_start=1
FT                   /gene="Lrrtm2"
FT                   /locus_tag="mCG_123920"
FT                   /product="leucine rich repeat transmembrane neuronal 2"
FT                   /note="gene_id=mCG123920.1 transcript_id=mCT125156.0
FT                   protein_id=mCP68972.1"
FT                   /protein_id="EDK97125.1"
FT                   /translation="MGLHFKWPLGAPMLAAIYAMSVVLKMLPALGMACPPKCRCEKLLF
FT                   YCDSQGFHSVPNATDKGSLGLSLRHNHITALERDQFASFSQLTWLHLDHNQISTVKEDA
FT                   FQGLYKLKELILSSNKIFYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLH
FT                   LRSNSLRTIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINF
FT                   AHFLRLSSLHTLFLQWNKISNLTCGMDWTWSTLEKLDLTGNEIKAIDLTVFETMPNLKI
FT                   LLMDNNKLNSLDSKILNSLKSLTTVGLSGNLWECSPRVCALASWLGSFQGRWEHSILCH
FT                   SPDHTQGEDILDAVHGFQLCWNLSTTVTAMATTYRDPTTEYTKISSSSYHVGDKEIPTT
FT                   AGIAVTTEEHFPEPDNAIFTQRVITGTMALLFSFFFIIFIVFISRKCCPPTLRRIRQCS
FT                   MIQNHRQLRSQTRLHMSNMSDQGPYNEYEPTHEGPFIIINGYGQCKCQQLPYKECEV"
FT   gap             19112679..19112732
FT                   /estimated_length=54
FT   gene            complement(19153943..19387076)
FT                   /gene="Sil1"
FT                   /locus_tag="mCG_123911"
FT                   /note="gene_id=mCG123911.1"
FT   mRNA            complement(join(19153943..19154454,19156584..19156748,
FT                   19157159..19157255,19205389..19205510,19212831..19213022,
FT                   19228647..19228746,19236189..19236309,19305764..19305902,
FT                   19326219..19326332,19387001..19387076))
FT                   /gene="Sil1"
FT                   /locus_tag="mCG_123911"
FT                   /product="endoplasmic reticulum chaperone SIL1 homolog (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG123911.1 transcript_id=mCT125147.1
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(19154098..19154454,19156584..19156748,
FT                   19157159..19157255,19205389..19205510,19212831..19213022,
FT                   19228647..19228746,19236189..19236309,19305764..19305902,
FT                   19326219..19326323))
FT                   /codon_start=1
FT                   /gene="Sil1"
FT                   /locus_tag="mCG_123911"
FT                   /product="endoplasmic reticulum chaperone SIL1 homolog (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG123911.1 transcript_id=mCT125147.1
FT                   protein_id=mCP69176.1"
FT                   /protein_id="EDK97126.1"
FT                   /translation="MAPQHLPSTRMASPGMLLGLLLTSCLTLCLSCQNSNNFALTNPEK
FT                   SIHQESDTKETREEEELDTEILEVFHPTQEWQTLQPGQAVPAGSHVRMNLQTGVNEVKL
FT                   QQEDKFQNNLKGFKRGRRLDINANTYTSQDLKSALAKFKEGTEMENSKDELARQATVKQ
FT                   LFRPIEELKKEFDELNVVLETDMQIMVRLINKFNSSSSSLEEKVAALFDLEYYVHQMDN
FT                   AQDLLSFGGLQVVINGLNSTEPLVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVIL
FT                   ATNQPLPAKKKVLFALCSLLRHFPYAQQQFLKLGGLQVLRSLVQEKSAKVLAVRVVTLL
FT                   YDLVTEKMFAEEEAELTQDSSPEKLQQYRQVQLLPGLQEQGWCEITAQLLALPEHDARE
FT                   KVLQTLGALLTTCRDRYRQDLQLSRTLGRLQAEYQALASLELQEGEDDGYFRELLASIN
FT                   SLMKELR"
FT   gap             19270063..19270082
FT                   /estimated_length=20
FT   gap             19277664..19278548
FT                   /estimated_length=885
FT   gap             19283954..19284148
FT                   /estimated_length=195
FT   gap             19314947..19315234
FT                   /estimated_length=288
FT   gap             19319840..19319872
FT                   /estimated_length=33
FT   gap             19324496..19324789
FT                   /estimated_length=294
FT   gap             19333473..19333619
FT                   /estimated_length=147
FT   gap             19341649..19341668
FT                   /estimated_length=20
FT   gap             19359581..19359600
FT                   /estimated_length=20
FT   gap             19374971..19374990
FT                   /estimated_length=20
FT   gene            19383429..19384216
FT                   /pseudo
FT                   /locus_tag="mCG_123919"
FT                   /note="gene_id=mCG123919.1"
FT   mRNA            join(19383429..19383505,19383659..19384216)
FT                   /pseudo
FT                   /locus_tag="mCG_123919"
FT                   /note="gene_id=mCG123919.1 transcript_id=mCT125155.1
FT                   created on 05-JUN-2002"
FT   gap             19395708..19395727
FT                   /estimated_length=20
FT   gene            19424700..19425182
FT                   /locus_tag="mCG_1031578"
FT                   /note="gene_id=mCG1031578.1"
FT   mRNA            19424700..19425182
FT                   /locus_tag="mCG_1031578"
FT                   /product="mCG1031578"
FT                   /note="gene_id=mCG1031578.1 transcript_id=mCT149282.1
FT                   created on 05-JUN-2002"
FT   CDS             19424744..19425112
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031578"
FT                   /product="mCG1031578"
FT                   /note="gene_id=mCG1031578.1 transcript_id=mCT149282.1
FT                   protein_id=mCP69269.1"
FT                   /db_xref="GOA:D3YYZ2"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="MGI:MGI:3648788"
FT                   /db_xref="UniProtKB/TrEMBL:D3YYZ2"
FT                   /protein_id="EDK97127.1"
FT                   /translation="MQIFMKTLTGKTITLEVKPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   TGKQLEDGRTLSDYNIQKESTLHLVLHLPSLRQLAQKYNCDKMICRKCYARLHPHAVNC
FT                   CKKKCGHTNNLRPKKKVK"
FT   gene            19441539..19446389
FT                   /locus_tag="mCG_123925"
FT                   /note="gene_id=mCG123925.1"
FT   mRNA            join(19441539..19441626,19442584..19442618,
FT                   19444773..19444848,19445494..19446389)
FT                   /locus_tag="mCG_123925"
FT                   /product="mCG123925"
FT                   /note="gene_id=mCG123925.1 transcript_id=mCT125161.1
FT                   created on 05-JUN-2002"
FT   CDS             19445814..19445921
FT                   /codon_start=1
FT                   /locus_tag="mCG_123925"
FT                   /product="mCG123925"
FT                   /note="gene_id=mCG123925.1 transcript_id=mCT125161.1
FT                   protein_id=mCP69406.1"
FT                   /protein_id="EDK97128.1"
FT                   /translation="MWMVAILGQLRMFRILLFKSKVLYKGSYNGPDSKY"
FT   gene            19450384..19480121
FT                   /locus_tag="mCG_121979"
FT                   /note="gene_id=mCG121979.1"
FT   mRNA            join(19450384..19450449,19465466..19465524,
FT                   19466321..19466362,19466810..19466922,19467171..19467223,
FT                   19469075..19469200,19469502..19469627,19469824..19469991,
FT                   19470621..19470752,19471783..19471826,19472420..19472786,
FT                   19475536..19475758,19476237..19476358,19478285..19480121)
FT                   /locus_tag="mCG_121979"
FT                   /product="mCG121979, transcript variant mCT123197"
FT                   /note="gene_id=mCG121979.1 transcript_id=mCT123197.1
FT                   created on 05-JUN-2002"
FT   mRNA            join(19450387..19450449,19459748..19460840,
FT                   19465466..19465524,19466321..19466362,19466810..19466922,
FT                   19467171..19467223,19469075..19469200,19469502..19469627,
FT                   19469824..19469991,19470621..19470752,19471783..19471826,
FT                   19472420..19472786,19475536..19475758,19476237..19476358,
FT                   19478285..19479913)
FT                   /locus_tag="mCG_121979"
FT                   /product="mCG121979, transcript variant mCT169959"
FT                   /note="gene_id=mCG121979.1 transcript_id=mCT169959.0
FT                   created on 05-JUN-2002"
FT   mRNA            join(<19450403..19450449,19459748..19460840,
FT                   19465463..19465524,19466321..19466362,19466810..19466922,
FT                   19467171..19467223,19469075..19469200,19469502..19469627,
FT                   19469824..19469991,19470621..19470752,19471783..19471826,
FT                   19472420..19472786,19475536..19475758,19476237..19476358,
FT                   19478285..19478711)
FT                   /locus_tag="mCG_121979"
FT                   /product="mCG121979, transcript variant mCT188840"
FT                   /note="gene_id=mCG121979.1 transcript_id=mCT188840.0
FT                   created on 08-MAR-2004"
FT   gap             19453229..19453248
FT                   /estimated_length=20
FT   gap             19455855..19455956
FT                   /estimated_length=102
FT   CDS             join(<19459911..19460840,19465463..19465524,
FT                   19466321..19466362,19466810..19466922,19467171..19467223,
FT                   19469075..19469200,19469502..19469627,19469824..19469991,
FT                   19470621..19470752,19471783..19471826,19472420..19472786,
FT                   19475536..19475758,19476237..19476358,19478285..19478335)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121979"
FT                   /product="mCG121979, isoform CRA_c"
FT                   /note="gene_id=mCG121979.1 transcript_id=mCT188840.0
FT                   protein_id=mCP109838.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q6ZQ61"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1298379"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZQ61"
FT                   /protein_id="EDK97131.1"
FT                   /translation="TRDSSTMSKSFQQSSLGRDSQGHGRDLSAAGIGLLAAATQSLSMP
FT                   ASLGRMNQGTARLASLMNLGMSSSLNQQGAHSALSSASTSSHNLQSIFNIGSRGPLPLS
FT                   SQHRGDTDQASNILASFGLSARDLDELSRYPEDKITPENLPQILLQLKRRRTEEGPTLS
FT                   YGRDGRSATREPPYRVPRDDWEEKRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDR
FT                   MDYEDDRLRDGERCRDDSFFGETSHNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPS
FT                   SNIEDFHGLLPKGYPHLCSICDLPVHSNKEWSQHINGASHSRRCQLLLEIYPEWNPDND
FT                   TGHTMGDPFMLQQSTNPAPGILGPPPPSFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGR
FT                   VETSRVVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQAAVD
FT                   YYTTTPALVFGKPVRVHLSQKYKRIKKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDS
FT                   AVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSE
FT                   KYKKLVLRIPNRGIDLLKKDKSRKRSYSPDGKESPSDKKSKTDAQKTESPAEGKEQEEK
FT                   SGEDGEKDTKDDQTEQEPSMLLESEDELLVDEEEAAALLESGSSVGDETDLANLGDVSS
FT                   DGKKEPSDKAVKKDPSASATSKKKLKKVDKIEELDQENEAALENGIKNEENTEPGAESA
FT                   ENADDPNKDTSENADGQNDENKEDYTIPDEYRIGPYQPNVPVGIDYVIPKTGFYCKLCS
FT                   LFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEERRQKKET"
FT   CDS             join(19459929..19460840,19465466..19465524,
FT                   19466321..19466362,19466810..19466922,19467171..19467223,
FT                   19469075..19469200,19469502..19469627,19469824..19469991,
FT                   19470621..19470752,19471783..19471826,19472420..19472786,
FT                   19475536..19475758,19476237..19476358,19478285..19478335)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121979"
FT                   /product="mCG121979, isoform CRA_b"
FT                   /note="gene_id=mCG121979.1 transcript_id=mCT169959.0
FT                   protein_id=mCP92521.0 isoform=CRA_b"
FT                   /protein_id="EDK97130.1"
FT                   /translation="MSKSFQQSSLGRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRM
FT                   NQGTARLASLMNLGMSSSLNQQGAHSALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGD
FT                   TDQASNILASFGLSARDLDELSRYPEDKITPENLPQILLQLKRRRTEEGPTLSYGRDGR
FT                   SATREPPYRVPRDDWEEKRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDRMDYEDD
FT                   RLRDGERCRDDSFFGETSHNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIEDF
FT                   HGLLPKGYPHLCSICDLPVHSNKWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTMGD
FT                   PFMLQQSTNPAPGILGPPPPSFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGRVETSRVV
FT                   HIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPA
FT                   LVFGKPVRVHLSQKYKRIKKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAE
FT                   PYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVL
FT                   RIPNRGIDLLKKDKSRKRSYSPDGKESPSDKKSKTDAQKTESPAEGKEQEEKSGEDGEK
FT                   DTKDDQTEQEPSMLLESEDELLVDEEEAAALLESGSSVGDETDLANLGDVSSDGKKEPS
FT                   DKAVKKDPSASATSKKKLKKVDKIEELDQENEAALENGIKNEENTEPGAESAENADDPN
FT                   KDTSENADGQNDENKEDYTIPDEYRIGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEE
FT                   VAKNTHCSSLPHYQKLKKFLNKLAEERRQKKET"
FT   CDS             join(19466361..19466362,19466810..19466922,
FT                   19467171..19467223,19469075..19469200,19469502..19469627,
FT                   19469824..19469991,19470621..19470752,19471783..19471826,
FT                   19472420..19472786,19475536..19475758,19476237..19476358,
FT                   19478285..19478335)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121979"
FT                   /product="mCG121979, isoform CRA_a"
FT                   /note="gene_id=mCG121979.1 transcript_id=mCT123197.1
FT                   protein_id=mCP69159.1 isoform=CRA_a"
FT                   /protein_id="EDK97129.1"
FT                   /translation="MGDPFMLQQSTNPAPGILGPPPPSFHLGGPAVGPRGNLGAGNGNL
FT                   QGPRHMQKGRVETSRVVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMA
FT                   TTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKPEGKPDQKFDQKQELGRVIHLS
FT                   NLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQ
FT                   GRCVKVDLSEKYKKLVLRIPNRGIDLLKKDKSRKRSYSPDGKESPSDKKSKTDAQKTES
FT                   PAEGKEQEEKSGEDGEKDTKDDQTEQEPSMLLESEDELLVDEEEAAALLESGSSVGDET
FT                   DLANLGDVSSDGKKEPSDKAVKKDPSASATSKKKLKKVDKIEELDQENEAALENGIKNE
FT                   ENTEPGAESAENADDPNKDTSENADGQNDENKEDYTIPDEYRIGPYQPNVPVGIDYVIP
FT                   KTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEERRQKKET"
FT   gap             19484637..19484656
FT                   /estimated_length=20
FT   gene            19486566..19505394
FT                   /gene="Paip2"
FT                   /locus_tag="mCG_121965"
FT                   /note="gene_id=mCG121965.1"
FT   mRNA            join(19486566..19486659,19498923..19499086,
FT                   19501375..19501554,19504262..19505248)
FT                   /gene="Paip2"
FT                   /locus_tag="mCG_121965"
FT                   /product="polyadenylate-binding protein-interacting protein
FT                   2, transcript variant mCT123186"
FT                   /note="gene_id=mCG121965.1 transcript_id=mCT123186.0
FT                   created on 05-JUN-2002"
FT   mRNA            join(19486610..19486659,19498923..19499086,
FT                   19504262..19505394)
FT                   /gene="Paip2"
FT                   /locus_tag="mCG_121965"
FT                   /product="polyadenylate-binding protein-interacting protein
FT                   2, transcript variant mCT169881"
FT                   /note="gene_id=mCG121965.1 transcript_id=mCT169881.0
FT                   created on 05-JUN-2002"
FT   mRNA            join(<19487137..19487210,19487613..19487658,
FT                   19487945..19488017,19496789..19496870,19498923..19499086,
FT                   19501375..19501554,19504262..19504417)
FT                   /gene="Paip2"
FT                   /locus_tag="mCG_121965"
FT                   /product="polyadenylate-binding protein-interacting protein
FT                   2, transcript variant mCT188877"
FT                   /note="gene_id=mCG121965.1 transcript_id=mCT188877.0
FT                   created on 08-MAR-2004"
FT   gap             19490631..19490650
FT                   /estimated_length=20
FT   CDS             join(<19498928..19499086,19501375..19501554,
FT                   19504262..19504318)
FT                   /codon_start=1
FT                   /gene="Paip2"
FT                   /locus_tag="mCG_121965"
FT                   /product="polyadenylate-binding protein-interacting protein
FT                   2, isoform CRA_b"
FT                   /note="gene_id=mCG121965.1 transcript_id=mCT188877.0
FT                   protein_id=mCP109833.0 isoform=CRA_b"
FT                   /protein_id="EDK97133.1"
FT                   /translation="KRQRAPTMKDPSRSSTSPSIINDDVIINGHSHEEDNPFAEYMWME
FT                   NEEEFNRQIEEELWEEEFIERCFQEMLEEEEEHEWFIPARDLPQTMDQIQDQFNDLVIS
FT                   DGSSLEDLVVKSNLNPNAKEFVPGVKY"
FT   CDS             join(19498949..19499086,19501375..19501554,
FT                   19504262..19504318)
FT                   /codon_start=1
FT                   /gene="Paip2"
FT                   /locus_tag="mCG_121965"
FT                   /product="polyadenylate-binding protein-interacting protein
FT                   2, isoform CRA_c"
FT                   /note="gene_id=mCG121965.1 transcript_id=mCT123186.0
FT                   protein_id=mCP69138.1 isoform=CRA_c"
FT                   /protein_id="EDK97134.1"
FT                   /translation="MKDPSRSSTSPSIINDDVIINGHSHEEDNPFAEYMWMENEEEFNR
FT                   QIEEELWEEEFIERCFQEMLEEEEEHEWFIPARDLPQTMDQIQDQFNDLVISDGSSLED
FT                   LVVKSNLNPNAKEFVPGVKY"
FT   CDS             join(19498949..19499086,19504262..19504318)
FT                   /codon_start=1
FT                   /gene="Paip2"
FT                   /locus_tag="mCG_121965"
FT                   /product="polyadenylate-binding protein-interacting protein
FT                   2, isoform CRA_a"
FT                   /note="gene_id=mCG121965.1 transcript_id=mCT169881.0
FT                   protein_id=mCP92524.0 isoform=CRA_a"
FT                   /protein_id="EDK97132.1"
FT                   /translation="MKDPSRSSTSPSIINDDVIINGHSHEEDNPFAEYMWMENEEEFNR
FT                   QVKSNLNPNAKEFVPGVKY"
FT   gap             19502976..19503134
FT                   /estimated_length=159
FT   gene            complement(19503163..19515300)
FT                   /gene="Slc23a1"
FT                   /locus_tag="mCG_121967"
FT                   /note="gene_id=mCG121967.1"
FT   mRNA            complement(join(19503163..19503750,19507451..19507715,
FT                   19509830..19509925,19510350..19510493,19510575..19510704,
FT                   19510922..19511027,19511514..19511661,19512134..19512290,
FT                   19512504..19512624,19512758..19512939,19513076..19513143,
FT                   19513264..19513352,19513884..19514041,19514435..19514569,
FT                   19515178..19515300))
FT                   /gene="Slc23a1"
FT                   /locus_tag="mCG_121967"
FT                   /product="solute carrier family 23 (nucleobase
FT                   transporters), member 1"
FT                   /note="gene_id=mCG121967.1 transcript_id=mCT123191.1
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(19507468..19507715,19509830..19509925,
FT                   19510350..19510493,19510575..19510704,19510922..19511027,
FT                   19511514..19511661,19512134..19512290,19512504..19512624,
FT                   19512758..19512939,19513076..19513143,19513264..19513352,
FT                   19513884..19514041,19514435..19514569,19515178..19515213))
FT                   /codon_start=1
FT                   /gene="Slc23a1"
FT                   /locus_tag="mCG_121967"
FT                   /product="solute carrier family 23 (nucleobase
FT                   transporters), member 1"
FT                   /note="gene_id=mCG121967.1 transcript_id=mCT123191.1
FT                   protein_id=mCP69148.0"
FT                   /protein_id="EDK97135.1"
FT                   /translation="MKTPEDPGSPKQHEVVDSAGTSTRDRQAPLPTEPKFDMLYKIEDV
FT                   PPWYLCILLGFQHYLTCFSGTIAVPFLLAEALCVGRDQHMVSQLIGTIFTCVGITTLIQ
FT                   TTVGIRLPLFQASAFAFLVPAKSILALERWKCPSEEEIYGNWSMPLNTSHIWHPRIREV
FT                   QGAIMVSSMVEVVIGLMGLPGALLSYIGPLTVTPTVSLIGLSVFQAAGDRAGSHWGISA
FT                   CSILLIVLFSQYLRNLTFLLPVYRWGKGLTLFRVQIFKMFPIVLAIMTVWLLCYVLTLT
FT                   DVLPADPTVYGFQARTDARGDIMAISPWIRIPYPCQWGLPTVTVAAVLGMFSATLAGII
FT                   ESIGDYYACARLAGAPPPPVHAINRGIFTEGICCIIAGLLGTGNGSTSSSPNIGVLGIT
FT                   KVGSRRVVQYGAGIMLILGAIGKFTALFASLPDPILGGMFCTLFGMITAVGLSNLQFVD
FT                   MNSSRNLFVLGFSMFFGLTLPNYLDSNPGAINTGIPEVDQILTVLLTTEMFVGGCLAFI
FT                   LDNTVPGSPEERGLIQWKAGAHANSETSASLKSYDFPFGMGMVKRTTFFRYIPICPVFR
FT                   GFSKKTQNQPPVLEDTPDNIETGSVCTKV"
FT   gap             19512397..19512416
FT                   /estimated_length=20
FT   gap             19522638..19522732
FT                   /estimated_length=95
FT   gap             19532809..19533571
FT                   /estimated_length=763
FT   gene            complement(19535302..19537416)
FT                   /gene="2010001M09Rik"
FT                   /locus_tag="mCG_121981"
FT                   /note="gene_id=mCG121981.1"
FT   mRNA            complement(join(19535302..19535759,19535857..19535967,
FT                   19536292..19536416,19537193..19537400))
FT                   /gene="2010001M09Rik"
FT                   /locus_tag="mCG_121981"
FT                   /product="RIKEN cDNA 2010001M09, transcript variant
FT                   mCT123198"
FT                   /note="gene_id=mCG121981.1 transcript_id=mCT123198.1
FT                   created on 05-JUN-2002"
FT   mRNA            complement(join(19535337..19535759,19536292..19536416,
FT                   19537193..19537416))
FT                   /gene="2010001M09Rik"
FT                   /locus_tag="mCG_121981"
FT                   /product="RIKEN cDNA 2010001M09, transcript variant
FT                   mCT169882"
FT                   /note="gene_id=mCG121981.1 transcript_id=mCT169882.0
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(19535603..19535759,19536292..19536416,
FT                   19537193..19537366))
FT                   /codon_start=1
FT                   /gene="2010001M09Rik"
FT                   /locus_tag="mCG_121981"
FT                   /product="RIKEN cDNA 2010001M09, isoform CRA_b"
FT                   /note="gene_id=mCG121981.1 transcript_id=mCT169882.0
FT                   protein_id=mCP92526.0 isoform=CRA_b"
FT                   /protein_id="EDK97137.1"
FT                   /translation="MRLPLPLLLLFGCRAILGSAGDRVSLSASAPTLDDEEKYSAHMPA
FT                   HLRCDACRAVAFQMGQRLAKAEAKSHTPDASGLQELSESTYTDVLDQTCSQNWQSLSKT
FT                   CFHYLGEFGEDQIYEAYRQGQANLEALLCGGTHGPCSQEILAQREEL"
FT   CDS             complement(join(19535603..19535759,19535857..19535967,
FT                   19536292..19536416,19537193..19537366))
FT                   /codon_start=1
FT                   /gene="2010001M09Rik"
FT                   /locus_tag="mCG_121981"
FT                   /product="RIKEN cDNA 2010001M09, isoform CRA_a"
FT                   /note="gene_id=mCG121981.1 transcript_id=mCT123198.1
FT                   protein_id=mCP69162.1 isoform=CRA_a"
FT                   /protein_id="EDK97136.1"
FT                   /translation="MRLPLPLLLLFGCRAILGSAGDRVSLSASAPTLDDEEKYSAHMPA
FT                   HLRCDACRAVAFQMGQRLAKAEAKSHTPDASGLQELSESTYTDVLDQTCSQNWQSYGVH
FT                   EVNQMKRLTGPGLSKGPEPRISVMISGGPWPNRLSKTCFHYLGEFGEDQIYEAYRQGQA
FT                   NLEALLCGGTHGPCSQEILAQREEL"
FT   gene            complement(19544726..19550193)
FT                   /gene="5133400G04Rik"
FT                   /locus_tag="mCG_121984"
FT                   /note="gene_id=mCG121984.1"
FT   mRNA            complement(join(19544726..19544877,19544982..19545084,
FT                   19548316..19548386,19548477..19548607,19548825..19548890,
FT                   19550045..19550193))
FT                   /gene="5133400G04Rik"
FT                   /locus_tag="mCG_121984"
FT                   /product="RIKEN cDNA 5133400G04"
FT                   /note="gene_id=mCG121984.1 transcript_id=mCT123200.0
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(19544748..19544877,19544982..19545084,
FT                   19548316..19548386,19548477..19548607,19548825..19548890,
FT                   19550045..19550161))
FT                   /codon_start=1
FT                   /gene="5133400G04Rik"
FT                   /locus_tag="mCG_121984"
FT                   /product="RIKEN cDNA 5133400G04"
FT                   /note="gene_id=mCG121984.1 transcript_id=mCT123200.0
FT                   protein_id=mCP69175.1"
FT                   /protein_id="EDK97138.1"
FT                   /translation="MATPLGWSQGGSGSVCLAFDQLRDVIESQEELIHQLRNVMVLQDE
FT                   NFVSKEEFHEIEKKLVEEKAAHAKTKALLAKEEEKLQFALGEVEVLSKQLEKEKMAFEK
FT                   ALSSVKSRVLQESSKKDQLITKCNEIESHIIKQEDILNGKENEIKELQQVISQQKQNFR
FT                   NHISDFRIQKQQETYMAQVLDQKRKKATGMRRARSRQCSREK"
FT   gap             19551212..19551420
FT                   /estimated_length=209
FT   gap             19552351..19552416
FT                   /estimated_length=66
FT   gap             19553949..19553999
FT                   /estimated_length=51
FT   gene            complement(19561781..19591100)
FT                   /gene="Dnajc18"
FT                   /locus_tag="mCG_121987"
FT                   /note="gene_id=mCG121987.1"
FT   mRNA            complement(join(19561781..19562001,19562874..19563256,
FT                   19568780..19568952,19569934..19570043,19571232..19571338,
FT                   19574663..19574848,19584973..19585118,19588799..19588985,
FT                   19591021..19591100))
FT                   /gene="Dnajc18"
FT                   /locus_tag="mCG_121987"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 18"
FT                   /note="gene_id=mCG121987.1 transcript_id=mCT123201.0
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(19563132..19563256,19568780..19568952,
FT                   19569934..19570043,19571232..19571338,19574663..19574848,
FT                   19584973..19585118,19588799..19588985,19591021..19591060))
FT                   /codon_start=1
FT                   /gene="Dnajc18"
FT                   /locus_tag="mCG_121987"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 18"
FT                   /note="gene_id=mCG121987.1 transcript_id=mCT123201.0
FT                   protein_id=mCP69177.1"
FT                   /protein_id="EDK97139.1"
FT                   /translation="MATTLGSGERWTQAYIDAIRRNKYPEDKRPDSHDPCGCCNCMKAQ
FT                   KEKKSENEWNQTRQGEGNATYTEEQLRGVQRIKKCRNYYDILGVSHNASDEELKKAYKK
FT                   LALKFHPDKNCAPGATEAFKAIGNAFAVLSNPDKRLRYDEYGDEQVTFTVPRARSYHYY
FT                   KDFEADISPEELFNVFFGGHFPSGNIHMFSNVTDDSQYYRRRHRHERTQTHKREEDKSQ
FT                   TPYSAFVQLLPVLVIVTISVITQLLAANPPYSLFYKSTLGYTISRETQNLQVPYFVDKN
FT                   FDKAYRGASLRDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLRQKAESLK
FT                   LENCAKLSKLIGLRRAG"
FT   gap             19572846..19572961
FT                   /estimated_length=116
FT   gene            <19591219..19617755
FT                   /locus_tag="mCG_145678"
FT                   /note="gene_id=mCG145678.0"
FT   mRNA            join(<19591219..19591417,19603468..19603602,
FT                   19616459..19617755)
FT                   /locus_tag="mCG_145678"
FT                   /product="mCG145678"
FT                   /note="gene_id=mCG145678.0 transcript_id=mCT185104.0
FT                   created on 04-JUN-2003"
FT   gene            complement(19601084..19610340)
FT                   /gene="1110006O17Rik"
FT                   /locus_tag="mCG_121983"
FT                   /note="gene_id=mCG121983.1"
FT   mRNA            complement(join(19601084..19601429,19601636..19601732,
FT                   19603174..19603210,19603431..19603529,19603961..19604083,
FT                   19604761..19604820,19605161..19605298,19606356..19606394,
FT                   19610229..19610340))
FT                   /gene="1110006O17Rik"
FT                   /locus_tag="mCG_121983"
FT                   /product="RIKEN cDNA 1110006O17"
FT                   /note="gene_id=mCG121983.1 transcript_id=mCT123199.1
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(19601421..19601429,19601636..19601732,
FT                   19603174..19603210,19603431..19603529,19603961..19604083,
FT                   19604761..19604820,19605161..19605298,19606356..19606394,
FT                   19610229..19610334))
FT                   /codon_start=1
FT                   /gene="1110006O17Rik"
FT                   /locus_tag="mCG_121983"
FT                   /product="RIKEN cDNA 1110006O17"
FT                   /note="gene_id=mCG121983.1 transcript_id=mCT123199.1
FT                   protein_id=mCP69167.1"
FT                   /db_xref="InterPro:IPR026247"
FT                   /db_xref="MGI:MGI:1915795"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVV5"
FT                   /protein_id="EDK97141.1"
FT                   /translation="MDREYTEEPATHPADLGTSGAMRLGSAILGLLLLQGYSSQPTTTQ
FT                   TSQEILQKSSQVSLVSNQPVTPRSSTMDKQSLSLPDLMSFQPQKHTLGPGTGTPERSSS
FT                   SSSSSSSRRGEASLDATPSPETTSLQTKKMTILLTILPTPTSESVLTVAAFGVISFIVI
FT                   LVVVVIILVSVVSLRFKCRKNKESEDPQKPGSSGLSESCSTANGEKDSITLISMRNINV
FT                   NNSKGSMSAEKIL"
FT   gap             19603211..19603271
FT                   /estimated_length=61
FT   CDS             join(<19603582..19603602,19616459..19616833)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145678"
FT                   /product="mCG145678"
FT                   /note="gene_id=mCG145678.0 transcript_id=mCT185104.0
FT                   protein_id=mCP106362.0"
FT                   /protein_id="EDK97140.1"
FT                   /translation="VWSSLAQDDYYPQPSLLVNGSLDQEPQRQLPDMPPRGGDGLPLLA
FT                   AIIAAFVLLAICIVLAVHFGPALHQGQATLLTEPPALKPENGVYLIHWRLLSLQDSHRE
FT                   SQQGLFIPHSGPALDGHRPSIDEVTYL"
FT   gap             19607083..19607541
FT                   /estimated_length=459
FT   gap             19619366..19619411
FT                   /estimated_length=46
FT   gene            complement(19621695..19628530)
FT                   /locus_tag="mCG_121990"
FT                   /note="gene_id=mCG121990.2"
FT   mRNA            complement(join(19621695..19622710,19623115..19623301,
FT                   19623891..19624129,19626693..19626801,19627052..19627232,
FT                   19627363..19627589,19628319..>19628491))
FT                   /locus_tag="mCG_121990"
FT                   /product="mCG121990, transcript variant mCT188833"
FT                   /note="gene_id=mCG121990.2 transcript_id=mCT188833.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(19621733..19622710,19623115..19623301,
FT                   19623891..19624129,19626693..19626801,19627052..19627232,
FT                   19627363..19627589,19627937..19628026,19628319..19628530))
FT                   /locus_tag="mCG_121990"
FT                   /product="mCG121990, transcript variant mCT123208"
FT                   /note="gene_id=mCG121990.2 transcript_id=mCT123208.1
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(19622517..19622710,19623115..19623301,
FT                   19623891..19624129,19626693..19626801,19627052..19627232,
FT                   19627363..19627589,19628319..>19628489))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121990"
FT                   /product="mCG121990, isoform CRA_b"
FT                   /note="gene_id=mCG121990.2 transcript_id=mCT188833.0
FT                   protein_id=mCP109839.0 isoform=CRA_b"
FT                   /protein_id="EDK97143.1"
FT                   /translation="PLPISGGSMIVESFGASGNPVGPCHFWSLYGVLLGVHWSVLHLGT
FT                   FRGIRSAGLWLLMPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYL
FT                   ALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFY
FT                   FLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIG
FT                   YLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDML
FT                   PQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDR
FT                   LEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTM
FT                   NAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI"
FT   CDS             complement(join(19622517..19622710,19623115..19623301,
FT                   19623891..19624129,19626693..19626801,19627052..19627232,
FT                   19627363..19627589))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121990"
FT                   /product="mCG121990, isoform CRA_a"
FT                   /note="gene_id=mCG121990.2 transcript_id=mCT123208.1
FT                   protein_id=mCP69383.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TBT3"
FT                   /db_xref="MGI:MGI:1919762"
FT                   /db_xref="PDB:4JC5"
FT                   /db_xref="PDB:4KBY"
FT                   /db_xref="PDB:4KC0"
FT                   /db_xref="PDB:4LOJ"
FT                   /db_xref="PDB:4LOK"
FT                   /db_xref="PDB:4LOL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TBT3"
FT                   /protein_id="EDK97142.1"
FT                   /translation="MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLK
FT                   YLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSY
FT                   FYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYY
FT                   IGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRD
FT                   MLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSRE
FT                   DRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEV
FT                   TMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI"
FT   gap             19638669..19638890
FT                   /estimated_length=222
FT   gap             19642426..19642505
FT                   /estimated_length=80
FT   gap             19649235..19649254
FT                   /estimated_length=20
FT   gap             19652053..19652513
FT                   /estimated_length=461
FT   gene            <19657864..>19658247
FT                   /locus_tag="mCG_1031612"
FT                   /note="gene_id=mCG1031612.1"
FT   mRNA            <19657864..>19658247
FT                   /locus_tag="mCG_1031612"
FT                   /product="mCG1031612"
FT                   /note="gene_id=mCG1031612.1 transcript_id=mCT149316.0
FT                   created on 05-JUN-2002"
FT   CDS             19657864..19658247
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031612"
FT                   /product="mCG1031612"
FT                   /note="gene_id=mCG1031612.1 transcript_id=mCT149316.0
FT                   protein_id=mCP69179.0"
FT                   /protein_id="EDK97144.1"
FT                   /translation="MPPKDDKKKKNVRKSAKKDKDPVNKSGAKAKKWSKSKVRDKLDNL
FT                   VLFDNLCKEVSNYKLITPSMVSERLKIPGSLARAALQKLLSKGLIKLVSKHRAQMIYTR
FT                   NTKGGDAPAAGEEQVQSAVHLGK"
FT   gap             19658965..19658984
FT                   /estimated_length=20
FT   gene            19659183..19694912
FT                   /locus_tag="mCG_121966"
FT                   /note="gene_id=mCG121966.1"
FT   mRNA            join(19659183..19659593,19681187..19681250,
FT                   19687573..19687604,19687684..19687761,19687842..19687947,
FT                   19689006..19689099,19693267..19694912)
FT                   /locus_tag="mCG_121966"
FT                   /product="mCG121966"
FT                   /note="gene_id=mCG121966.1 transcript_id=mCT123189.0
FT                   created on 05-JUN-2002"
FT   CDS             join(19659570..19659593,19681187..19681250,
FT                   19687573..19687604,19687684..19687761,19687842..19687947,
FT                   19689006..19689099,19693267..19693312)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121966"
FT                   /product="mCG121966"
FT                   /note="gene_id=mCG121966.1 transcript_id=mCT123189.0
FT                   protein_id=mCP69139.1"
FT                   /db_xref="GOA:Q3UT95"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="MGI:MGI:1930715"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UT95"
FT                   /protein_id="EDK97145.1"
FT                   /translation="MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY
FT                   QGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLL
FT                   SICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM"
FT   gene            19717569..19749562
FT                   /gene="Cxxc5"
FT                   /locus_tag="mCG_145679"
FT                   /note="gene_id=mCG145679.0"
FT   mRNA            join(19717569..19717731,19746269..19747332,
FT                   19748528..19749562)
FT                   /gene="Cxxc5"
FT                   /locus_tag="mCG_145679"
FT                   /product="CXXC finger 5, transcript variant mCT185106"
FT                   /note="gene_id=mCG145679.0 transcript_id=mCT185106.0
FT                   created on 01-JUL-2003"
FT   gap             19717732..19718023
FT                   /estimated_length=292
FT   gap             19724109..19724295
FT                   /estimated_length=187
FT   mRNA            join(19742587..19742660,19746269..19747332,
FT                   19748528..19749562)
FT                   /gene="Cxxc5"
FT                   /locus_tag="mCG_145679"
FT                   /product="CXXC finger 5, transcript variant mCT185105"
FT                   /note="gene_id=mCG145679.0 transcript_id=mCT185105.0
FT                   created on 01-JUL-2003"
FT   CDS             join(19746424..19747332,19748528..19748572)
FT                   /codon_start=1
FT                   /gene="Cxxc5"
FT                   /locus_tag="mCG_145679"
FT                   /product="CXXC finger 5, isoform CRA_a"
FT                   /note="gene_id=mCG145679.0 transcript_id=mCT185105.0
FT                   protein_id=mCP106363.0 isoform=CRA_a"
FT                   /protein_id="EDK97146.1"
FT                   /translation="MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAP
FT                   TSVADDAPPPERRNKSGIISEPLNKSLRRSRPLSHYSSFGSSGGGGSMMGVESADKAAA
FT                   AAASLLANGHDLAAAMAVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQS
FT                   TEMLKRVVQEHLPLMSEAGAGLPDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTPAG
FT                   VFLAESALHMAGLAEYPMQGELASAISSGKKKRKRCGMCAPCRRRINCEQCSSCRNRKT
FT                   GHQICKFRKCEELKKKPSAALEKVMLPSGAAFRWFQ"
FT   CDS             join(19746424..19747332,19748528..19748572)
FT                   /codon_start=1
FT                   /gene="Cxxc5"
FT                   /locus_tag="mCG_145679"
FT                   /product="CXXC finger 5, isoform CRA_a"
FT                   /note="gene_id=mCG145679.0 transcript_id=mCT185106.0
FT                   protein_id=mCP106364.0 isoform=CRA_a"
FT                   /protein_id="EDK97147.1"
FT                   /translation="MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAP
FT                   TSVADDAPPPERRNKSGIISEPLNKSLRRSRPLSHYSSFGSSGGGGSMMGVESADKAAA
FT                   AAASLLANGHDLAAAMAVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQS
FT                   TEMLKRVVQEHLPLMSEAGAGLPDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTPAG
FT                   VFLAESALHMAGLAEYPMQGELASAISSGKKKRKRCGMCAPCRRRINCEQCSSCRNRKT
FT                   GHQICKFRKCEELKKKPSAALEKVMLPSGAAFRWFQ"
FT   gap             19756691..19756710
FT                   /estimated_length=20
FT   gap             19773495..19773786
FT                   /estimated_length=292
FT   gap             19795208..19795986
FT                   /estimated_length=779
FT   gap             19798849..19798868
FT                   /estimated_length=20
FT   gene            <19801976..19805592
FT                   /locus_tag="mCG_145675"
FT                   /note="gene_id=mCG145675.0"
FT   mRNA            join(<19801976..19802204,19805144..19805592)
FT                   /locus_tag="mCG_145675"
FT                   /product="mCG145675"
FT                   /note="gene_id=mCG145675.0 transcript_id=mCT185101.0
FT                   created on 03-JUN-2003"
FT   CDS             join(<19802065..19802204,19805144..19805252)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145675"
FT                   /product="mCG145675"
FT                   /note="gene_id=mCG145675.0 transcript_id=mCT185101.0
FT                   protein_id=mCP106359.0"
FT                   /protein_id="EDK97148.1"
FT                   /translation="VGTEIFLREKNPEASGRQRLGLSSVGSWEGMLSPSASCLSVTKII
FT                   LGPCLAHPNFSDCILGSLLSLNLSALRGAEPQVGSGC"
FT   gap             19802271..19802417
FT                   /estimated_length=147
FT   gap             19808269..19808288
FT                   /estimated_length=20
FT   gap             19816738..19817069
FT                   /estimated_length=332
FT   gap             19822025..19822175
FT                   /estimated_length=151
FT   gap             19829451..19829470
FT                   /estimated_length=20
FT   gap             19834811..19835654
FT                   /estimated_length=844
FT   gap             19837702..19838178
FT                   /estimated_length=477
FT   gap             19844412..19844747
FT                   /estimated_length=336
FT   gap             19853618..19853673
FT                   /estimated_length=56
FT   gene            <19853729..19903422
FT                   /gene="Psd2"
FT                   /locus_tag="mCG_121973"
FT                   /note="gene_id=mCG121973.2"
FT   mRNA            join(<19853729..19853886,19866955..19867356,
FT                   19868287..19868736,19868960..19869154,19873198..19873278,
FT                   19876083..19876195,19877075..19877137,19891609..19891698,
FT                   19893392..19893435,19894404..19894594,19894762..19894832,
FT                   19895246..19895403,19896166..19896310,19899321..19899464,
FT                   19901356..19903410)
FT                   /gene="Psd2"
FT                   /locus_tag="mCG_121973"
FT                   /product="pleckstrin and Sec7 domain containing 2,
FT                   transcript variant mCT188881"
FT                   /note="gene_id=mCG121973.2 transcript_id=mCT188881.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(19853737..19853886,19866955..19867356,
FT                   19868287..19868736,19868960..19869154,19873198..19873278,
FT                   19876083..19876195,19877075..19877133,19891609..19891698,
FT                   19893392..19893435,19894404..19894594,19894762..19894832,
FT                   19895246..19895403,19896166..19896310,19899321..19899464,
FT                   19901356..19903422)
FT                   /gene="Psd2"
FT                   /locus_tag="mCG_121973"
FT                   /product="pleckstrin and Sec7 domain containing 2,
FT                   transcript variant mCT123194"
FT                   /note="gene_id=mCG121973.2 transcript_id=mCT123194.0
FT                   created on 19-DEC-2002"
FT   mRNA            join(<19853769..19853886,19866955..19867356,
FT                   19868287..19868736,19868960..19869154,19873198..19873278,
FT                   19876083..19876195,19877075..19877133,19891609..19891698,
FT                   19893392..19893435,19894404..19894594,19894762..19894832,
FT                   19895326..19895403,19896166..19896310,19899321..19899464,
FT                   19901356..19903292)
FT                   /gene="Psd2"
FT                   /locus_tag="mCG_121973"
FT                   /product="pleckstrin and Sec7 domain containing 2,
FT                   transcript variant mCT188880"
FT                   /note="gene_id=mCG121973.2 transcript_id=mCT188880.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<19853772..19853886,19866952..19867356,
FT                   19868287..19868736,19868960..19869154,19873198..19873278,
FT                   19876083..19876195,19877075..19877137,19891609..19891698,
FT                   19893392..19893435,19894404..19894594,19894762..19894832,
FT                   19895246..19895403,19896166..19896310,19899321..19899464,
FT                   19901356..19903385)
FT                   /gene="Psd2"
FT                   /locus_tag="mCG_121973"
FT                   /product="pleckstrin and Sec7 domain containing 2,
FT                   transcript variant mCT188879"
FT                   /note="gene_id=mCG121973.2 transcript_id=mCT188879.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<19853858..19853886,19866955..19867356,
FT                   19868287..19868736,19868960..19869154,19873198..19873278,
FT                   19876083..19876195,19877075..19877133,19891609..19891698,
FT                   19893392..19893435,19894404..19894594,19894762..19894832,
FT                   19895326..19895334)
FT                   /codon_start=1
FT                   /gene="Psd2"
FT                   /locus_tag="mCG_121973"
FT                   /product="pleckstrin and Sec7 domain containing 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG121973.2 transcript_id=mCT188880.0
FT                   protein_id=mCP109835.0 isoform=CRA_b"
FT                   /protein_id="EDK97150.1"
FT                   /translation="EGTQRLGHERPRGWQGRVETVTDMDEEKLPCELHKEGSATQEDHG
FT                   LEPEEEPGLQNGTAASEGLSSHISGPGGEKTLEGTMEPVRGPDVALPGLNLSLTNGLAL
FT                   GQDGNILEDSIEFKTWRSGPAEEEDVPGSPCPDAGDPQLGLDCPGEPDVRDGFSATFEK
FT                   ILESELLRGTQYSSLDSLDVLSLTDESDSCVSFEAPLTPLIQQRARDSPEAGAGLGNGD
FT                   MGPEGDLGATGGCDGELGSPLRRSISSSRSENVLSHLSLTSVPNGFHEDGPGGSGGDDE
FT                   DDEDTDKLLNSASDTSLKDGLSDSDSELSSSEGLEPGSTDPLANGCQGVSEAARRLARR
FT                   LYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLTLDRALRTFLKAFPLMGETQ
FT                   ERERVLTHFSRRYCQCNPDDSTSEDGIHTLTCALMLLNTDLHGHNIGKKMSCQQFIANL
FT                   DQLNDGQDFAKDLLKTLYNSIKNEKLEWAIDEDELRKSLSELVDDKFGTGTKKVTRILD
FT                   GGNPFLDVPQALNATTYKHGVLTRKTHADMDGKRTPRGRRGWKKFYAVLKGTILYLQKG
FT                   F"
FT   CDS             join(<19853858..19853886,19866952..19867356,
FT                   19868287..19868736,19868960..19869154,19873198..19873278,
FT                   19876083..19876195,19877075..19877137,19891609..19891698,
FT                   19893392..19893435,19894404..19894406)
FT                   /codon_start=1
FT                   /gene="Psd2"
FT                   /locus_tag="mCG_121973"
FT                   /product="pleckstrin and Sec7 domain containing 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG121973.2 transcript_id=mCT188879.0
FT                   protein_id=mCP109834.0 isoform=CRA_a"
FT                   /protein_id="EDK97149.1"
FT                   /translation="EGTQRLGHERSPRGWQGRVETVTDMDEEKLPCELHKEGSATQEDH
FT                   GLEPEEEPGLQNGTAASEGLSSHISGPGGEKTLEGTMEPVRGPDVALPGLNLSLTNGLA
FT                   LGQDGNILEDSIEFKTWRSGPAEEEDVPGSPCPDAGDPQLGLDCPGEPDVRDGFSATFE
FT                   KILESELLRGTQYSSLDSLDVLSLTDESDSCVSFEAPLTPLIQQRARDSPEAGAGLGNG
FT                   DMGPEGDLGATGGCDGELGSPLRRSISSSRSENVLSHLSLTSVPNGFHEDGPGGSGGDD
FT                   EDDEDTDKLLNSASDTSLKDGLSDSDSELSSSEGLEPGSTDPLANGCQGVSEAARRLAR
FT                   RLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLTLDRALRTFLKAFPLMGET
FT                   QERERVLTHFSRRYCQCNPDDSTSEDGIHTLTCALMLLNTDLHGHVKHWQEDVLPAIHC
FT                   QLGPAERWPRLCQRPFEDTLQLHQERKAGMGH"
FT   CDS             join(<19853858..19853886,19866955..19867356,
FT                   19868287..19868736,19868960..19869154,19873198..19873278,
FT                   19876083..19876195,19877075..19877137,19891609..19891698,
FT                   19893392..19893435,19894404..19894406)
FT                   /codon_start=1
FT                   /gene="Psd2"
FT                   /locus_tag="mCG_121973"
FT                   /product="pleckstrin and Sec7 domain containing 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG121973.2 transcript_id=mCT188881.0
FT                   protein_id=mCP109836.0 isoform=CRA_c"
FT                   /protein_id="EDK97151.1"
FT                   /translation="EGTQRLGHERPRGWQGRVETVTDMDEEKLPCELHKEGSATQEDHG
FT                   LEPEEEPGLQNGTAASEGLSSHISGPGGEKTLEGTMEPVRGPDVALPGLNLSLTNGLAL
FT                   GQDGNILEDSIEFKTWRSGPAEEEDVPGSPCPDAGDPQLGLDCPGEPDVRDGFSATFEK
FT                   ILESELLRGTQYSSLDSLDVLSLTDESDSCVSFEAPLTPLIQQRARDSPEAGAGLGNGD
FT                   MGPEGDLGATGGCDGELGSPLRRSISSSRSENVLSHLSLTSVPNGFHEDGPGGSGGDDE
FT                   DDEDTDKLLNSASDTSLKDGLSDSDSELSSSEGLEPGSTDPLANGCQGVSEAARRLARR
FT                   LYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLTLDRALRTFLKAFPLMGETQ
FT                   ERERVLTHFSRRYCQCNPDDSTSEDGIHTLTCALMLLNTDLHGHVKHWQEDVLPAIHCQ
FT                   LGPAERWPRLCQRPFEDTLQLHQERKAGMGH"
FT   CDS             join(19866995..19867356,19868287..19868736,
FT                   19868960..19869154,19873198..19873278,19876083..19876195,
FT                   19877075..19877133,19891609..19891698,19893392..19893435,
FT                   19894404..19894594,19894762..19894832,19895246..19895403,
FT                   19896166..19896310,19899321..19899464,19901356..19901565)
FT                   /codon_start=1
FT                   /gene="Psd2"
FT                   /locus_tag="mCG_121973"
FT                   /product="pleckstrin and Sec7 domain containing 2, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG121973.2 transcript_id=mCT123194.0
FT                   protein_id=mCP69168.1 isoform=CRA_d"
FT                   /protein_id="EDK97152.1"
FT                   /translation="MDEEKLPCELHKEGSATQEDHGLEPEEEPGLQNGTAASEGLSSHI
FT                   SGPGGEKTLEGTMEPVRGPDVALPGLNLSLTNGLALGQDGNILEDSIEFKTWRSGPAEE
FT                   EDVPGSPCPDAGDPQLGLDCPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDVLSL
FT                   TDESDSCVSFEAPLTPLIQQRARDSPEAGAGLGNGDMGPEGDLGATGGCDGELGSPLRR
FT                   SISSSRSENVLSHLSLTSVPNGFHEDGPGGSGGDDEDDEDTDKLLNSASDTSLKDGLSD
FT                   SDSELSSSEGLEPGSTDPLANGCQGVSEAARRLARRLYHLEGFQRCDVARQLGKNNEFS
FT                   RLVAGEYLSFFDFSGLTLDRALRTFLKAFPLMGETQERERVLTHFSRRYCQCNPDDSTS
FT                   EDGIHTLTCALMLLNTDLHGHNIGKKMSCQQFIANLDQLNDGQDFAKDLLKTLYNSIKN
FT                   EKLEWAIDEDELRKSLSELVDDKFGTGTKKVTRILDGGNPFLDVPQALNATTYKHGVLT
FT                   RKTHADMDGKRTPRGRRGWKKFYAVLKGTILYLQKDEYRPDKALSEGDLKNAIRVHHAL
FT                   ATRASDYSKKSNVLKLKTADWRVFLFQAPSKEEMLSWILRINLVAAIFSAPAFPAAVSS
FT                   MKKFCRPLLPSCTTRLCQEEQLRSHENKLRQVTAELAEHRCHPLERGLKSKEAEEYRLK
FT                   EHYLTFEKSRYETYIHLLAVKIKVGSDDLERIEARLATIEGDDPALRKTHSSPALSLGH
FT                   GPVTGSKATKDTSASDT"
FT   gap             19871355..19871374
FT                   /estimated_length=20
FT   gap             19875286..19875305
FT                   /estimated_length=20
FT   gene            complement(<19906626..>19940979)
FT                   /locus_tag="mCG_121975"
FT                   /note="gene_id=mCG121975.1"
FT   mRNA            complement(join(<19906626..19907394,19909770..19909997,
FT                   19910565..19910692,19911018..19911141,19913019..19913121,
FT                   19921043..19921119,19926916..19927036,19934756..19934874,
FT                   19940808..>19940979))
FT                   /locus_tag="mCG_121975"
FT                   /product="mCG121975"
FT                   /note="gene_id=mCG121975.1 transcript_id=mCT123195.1
FT                   created on 19-DEC-2002"
FT   CDS             complement(join(19906626..19907394,19909770..19909997,
FT                   19910565..19910692,19911018..19911141,19913019..19913121,
FT                   19921043..19921119,19926916..19927036,19934756..19934874,
FT                   19940808..>19940977))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121975"
FT                   /product="mCG121975"
FT                   /note="gene_id=mCG121975.1 transcript_id=mCT123195.1
FT                   protein_id=mCP69185.1"
FT                   /protein_id="EDK97153.1"
FT                   /translation="TRPKLKKMKSQTGEVGEKQSLKCEAAAGNPQPSYRWFKDGKELNR
FT                   SRDIRIKYGNGRKNSRLQFNKVRVEDAGEYVCEAENILGKDTVRGRLHVNSVSTTLSSW
FT                   SGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQK
FT                   AEELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQRRQMHHHLRQNMCPAHQNRSLAN
FT                   GPSHPRLDPEEIQMADYISKNVPATDHVIRREAETTFSGSHSCSPSHHCSTATPTSSHR
FT                   HESHTWSLERSESLTSDSQSGIMLSSVGTSKCNSPACVEARARRAAAYSQEERRRAAMP
FT                   PYHDSIDSLRDSPHSERYVSALTTPARLSPVDFHYSLATQVPTFEITSPNSAHAVSLPP
FT                   AAPISYRLAEQQPLLRHPAPPGPGPGSGPGADMQRSYDSYYYPAAGPGPRRSACALGGS
FT                   LGSLPASPFRIPEDDEYETTQECAPPPPPRPRTRGASRRTSAGPRRWRRSRLNGLAAQR
FT                   ARAARDSLSLSSGSGCGSASASDDDADDADGALAAESTPFLGLRAAHDALRSDSPPLCP
FT                   AADSRTYYSLDSHSTRASSRHSRGPPTRAKQDSGPL"
FT   gap             19927899..19927918
FT                   /estimated_length=20
FT   gap             19939868..19939887
FT                   /estimated_length=20
FT   gap             19983866..19983908
FT                   /estimated_length=43
FT   gene            19994054..19997856
FT                   /locus_tag="mCG_121989"
FT                   /note="gene_id=mCG121989.1"
FT   mRNA            join(19994054..19994204,19997290..19997856)
FT                   /locus_tag="mCG_121989"
FT                   /product="mCG121989"
FT                   /note="gene_id=mCG121989.1 transcript_id=mCT123206.1
FT                   created on 19-DEC-2002"
FT   CDS             19997536..19997748
FT                   /codon_start=1
FT                   /locus_tag="mCG_121989"
FT                   /product="mCG121989"
FT                   /note="gene_id=mCG121989.1 transcript_id=mCT123206.1
FT                   protein_id=mCP69371.1"
FT                   /protein_id="EDK97154.1"
FT                   /translation="MPTPSWQFCLLSLLIHLSRYGWIPSILPTSCSGTGHDFSTSQLNC
FT                   TSGLSVNVLCGFASWTSSRPPPMVL"
FT   gap             20034906..20035052
FT                   /estimated_length=147
FT   gap             20040835..20040871
FT                   /estimated_length=37
FT   gap             20044274..20044293
FT                   /estimated_length=20
FT   gap             20054492..20054535
FT                   /estimated_length=44
FT   gap             20074251..20074270
FT                   /estimated_length=20
FT   gap             20084203..20084222
FT                   /estimated_length=20
FT   gene            complement(<20084435..>20084767)
FT                   /locus_tag="mCG_1031613"
FT                   /note="gene_id=mCG1031613.1"
FT   mRNA            complement(<20084435..>20084767)
FT                   /locus_tag="mCG_1031613"
FT                   /product="mCG1031613"
FT                   /note="gene_id=mCG1031613.1 transcript_id=mCT149317.1
FT                   created on 19-DEC-2002"
FT   CDS             complement(<20084435..>20084767)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031613"
FT                   /product="mCG1031613"
FT                   /note="gene_id=mCG1031613.1 transcript_id=mCT149317.1
FT                   protein_id=mCP69357.1"
FT                   /protein_id="EDK97155.1"
FT                   /translation="RPQPQPQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVSL
FT                   ACYSPSLKSVQDQAYKAPVVVEGKVQGLAPAGGSSSNSTREPPASGRVALVKVLDKWPL
FT                   RSGGLQR"
FT   gap             20094515..20094624
FT                   /estimated_length=110
FT   gap             20097846..20097865
FT                   /estimated_length=20
FT   gap             20111254..20111598
FT                   /estimated_length=345
FT   gap             20112115..20112385
FT                   /estimated_length=271
FT   gap             20121637..20122074
FT                   /estimated_length=438
FT   gap             20129003..20129285
FT                   /estimated_length=283
FT   gap             20135205..20135224
FT                   /estimated_length=20
FT   gap             20137564..20137847
FT                   /estimated_length=284
FT   gap             20149688..20149707
FT                   /estimated_length=20
FT   gap             20152975..20152994
FT                   /estimated_length=20
FT   gap             20168861..20169584
FT                   /estimated_length=724
FT   gap             20174607..20174649
FT                   /estimated_length=43
FT   gene            20174828..20176050
FT                   /locus_tag="mCG_121964"
FT                   /note="gene_id=mCG121964.1"
FT   mRNA            20174828..20176050
FT                   /locus_tag="mCG_121964"
FT                   /product="mCG121964"
FT                   /note="gene_id=mCG121964.1 transcript_id=mCT123184.0
FT                   created on 16-OCT-2002"
FT   CDS             20174965..20175930
FT                   /codon_start=1
FT                   /locus_tag="mCG_121964"
FT                   /product="mCG121964"
FT                   /note="gene_id=mCG121964.1 transcript_id=mCT123184.0
FT                   protein_id=mCP69129.1"
FT                   /protein_id="EDK97156.1"
FT                   /translation="MADRDSGSEQGGAALGSGGSLGHPGSGSGSGGGGGGGGGGGGSGG
FT                   GGGAPGGLQHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMS
FT                   VAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYMDLKENQR
FT                   GRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTS
FT                   LTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQ
FT                   EKQREKRAACEQLHQQQQQQQEETTAATLLLQGEEEGEED"
FT   gap             20192507..20192630
FT                   /estimated_length=124
FT   gap             20200537..20200556
FT                   /estimated_length=20
FT   gap             20217388..20217449
FT                   /estimated_length=62
FT   gene            20236464..20290682
FT                   /locus_tag="mCG_121988"
FT                   /note="gene_id=mCG121988.1"
FT   mRNA            join(20236464..20236576,20254266..20254492,
FT                   20290200..20290682)
FT                   /locus_tag="mCG_121988"
FT                   /product="mCG121988"
FT                   /note="gene_id=mCG121988.1 transcript_id=mCT123204.1
FT                   created on 19-DEC-2002"
FT   CDS             join(20254285..20254492,20290200..20290306)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121988"
FT                   /product="mCG121988"
FT                   /note="gene_id=mCG121988.1 transcript_id=mCT123204.1
FT                   protein_id=mCP69189.1"
FT                   /protein_id="EDK97157.1"
FT                   /translation="MNPENPPPYPGPGPTAPYPPYPQQPMGPMGPMGAPPPQGYPYPPP
FT                   QGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDDLGPSTCLTACWTALCCCCLWDMLT
FT                   "
FT   gap             20261732..20261751
FT                   /estimated_length=20
FT   gene            complement(20291382..20342763)
FT                   /gene="Pfdn1"
FT                   /locus_tag="mCG_121970"
FT                   /note="gene_id=mCG121970.1"
FT   mRNA            complement(join(20291382..20292163,20320570..20320654,
FT                   20339357..20339523,20342719..20342763))
FT                   /gene="Pfdn1"
FT                   /locus_tag="mCG_121970"
FT                   /product="prefoldin 1"
FT                   /note="gene_id=mCG121970.1 transcript_id=mCT123192.0
FT                   created on 16-OCT-2002"
FT   CDS             complement(join(20292080..20292163,20320570..20320654,
FT                   20339357..20339523,20342719..20342751))
FT                   /codon_start=1
FT                   /gene="Pfdn1"
FT                   /locus_tag="mCG_121970"
FT                   /product="prefoldin 1"
FT                   /note="gene_id=mCG121970.1 transcript_id=mCT123192.0
FT                   protein_id=mCP69155.1"
FT                   /db_xref="GOA:Q9CQF7"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="MGI:MGI:1914449"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CQF7"
FT                   /protein_id="EDK97158.1"
FT                   /translation="MAASVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAH
FT                   LTDTEIMTLVDETNMYEGVGRMFILQSKEVIHNQLLEKQKIAEEKIKELEQKKSYLERS
FT                   VKEAEDNIREMLMARRAQ"
FT   gap             20292955..20292974
FT                   /estimated_length=20
FT   gap             20317419..20317438
FT                   /estimated_length=20
FT   gap             20319869..20319888
FT                   /estimated_length=20
FT   gap             20362654..20362673
FT                   /estimated_length=20
FT   gene            complement(20386477..20397356)
FT                   /gene="Hbegf"
FT                   /locus_tag="mCG_121963"
FT                   /note="gene_id=mCG121963.1"
FT   mRNA            complement(join(20386477..20387909,20388180..20388270,
FT                   20388994..20389149,20394138..20394315,20396668..20396841,
FT                   20397050..20397356))
FT                   /gene="Hbegf"
FT                   /locus_tag="mCG_121963"
FT                   /product="heparin-binding EGF-like growth factor"
FT                   /note="gene_id=mCG121963.1 transcript_id=mCT123182.0
FT                   created on 05-NOV-2002"
FT   CDS             complement(join(20388198..20388270,20388994..20389149,
FT                   20394138..20394315,20396668..20396841,20397050..20397095))
FT                   /codon_start=1
FT                   /gene="Hbegf"
FT                   /locus_tag="mCG_121963"
FT                   /product="heparin-binding EGF-like growth factor"
FT                   /note="gene_id=mCG121963.1 transcript_id=mCT123182.0
FT                   protein_id=mCP69126.1"
FT                   /db_xref="GOA:Q5FW64"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR015497"
FT                   /db_xref="MGI:MGI:96070"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FW64"
FT                   /protein_id="EDK97159.1"
FT                   /translation="MKLLPSVMLKLFLAAVLSALVTGESLERLRRGLAAATSNPDPPTG
FT                   STNQLLPTGGDRAQGVQDLEGTDLNLFKVAFSSKPQGLATPSKERNGKKKKKGKGLGKK
FT                   RDPCLRKYKDYCIHGECRYLQEFRTPSCKCLPGYHGHRCHGLTLPVENPLYTYDHTTVL
FT                   AVVAVVLSSVCLLVIVGLLMFRYHRRGGYDLESEEKVKLGVASSH"
FT   gap             20407875..20408127
FT                   /estimated_length=253
FT   gene            20409402..20425869
FT                   /gene="Slc4a9"
FT                   /locus_tag="mCG_121977"
FT                   /note="gene_id=mCG121977.1"
FT   mRNA            join(20409402..20409657,20409896..20410056,
FT                   20410469..20410582,20410940..20410989,20411126..20411283,
FT                   20411529..20411616,20411967..20412121,20412353..20412469,
FT                   20412605..20412779,20412931..20413064,20413223..20413485,
FT                   20414438..20414496,20414830..20415015,20415142..20415255,
FT                   20416535..20416696,20416776..20416954,20418100..20418172,
FT                   20420555..20420623,20420849..20421022,20421984..20422139,
FT                   20422447..20422539,20425642..20425857)
FT                   /gene="Slc4a9"
FT                   /locus_tag="mCG_121977"
FT                   /product="solute carrier family 4, sodium bicarbonate
FT                   cotransporter, member 9, transcript variant mCT181748"
FT                   /note="gene_id=mCG121977.1 transcript_id=mCT181748.0
FT                   created on 04-JUN-2003"
FT   mRNA            join(20409405..20409657,20409896..20410056,
FT                   20410469..20410582,20410940..20410989,20411126..20411283,
FT                   20411529..20411616,20411967..20412121,20412353..20412469,
FT                   20412687..20412779,20413223..20413485,20414438..20414496,
FT                   20414830..20415015,20415142..20415255,20416535..20416696,
FT                   20416776..20416954,20418100..20418172,20420555..20420623,
FT                   20420849..20421022,20421984..20422139,20422447..20422539,
FT                   20425642..20425869)
FT                   /gene="Slc4a9"
FT                   /locus_tag="mCG_121977"
FT                   /product="solute carrier family 4, sodium bicarbonate
FT                   cotransporter, member 9, transcript variant mCT123196"
FT                   /note="gene_id=mCG121977.1 transcript_id=mCT123196.1
FT                   created on 04-JUN-2003"
FT   CDS             join(20409440..20409657,20409896..20410056,
FT                   20410469..20410582,20410940..20410989,20411126..20411283,
FT                   20411529..20411616,20411967..20412121,20412353..20412469,
FT                   20412605..20412779,20412931..20413064,20413223..20413485,
FT                   20414438..20414496,20414830..20415015,20415142..20415255,
FT                   20416535..20416696,20416776..20416954,20418100..20418172,
FT                   20420555..20420623,20420849..20421022,20421984..20422139,
FT                   20422447..20422500)
FT                   /codon_start=1
FT                   /gene="Slc4a9"
FT                   /locus_tag="mCG_121977"
FT                   /product="solute carrier family 4, sodium bicarbonate
FT                   cotransporter, member 9, isoform CRA_a"
FT                   /note="gene_id=mCG121977.1 transcript_id=mCT181748.0
FT                   protein_id=mCP104670.0 isoform=CRA_a"
FT                   /protein_id="EDK97160.1"
FT                   /translation="MKLPGQGDFESSDAHENAHSEEPDSGLGPGPGLNGPSGIDIGESQ
FT                   VSKDPLLFIQLNELLGWPQALEWRETGRWLLFEEKLDMGAGRWSAPHVPTLELPSLQKL
FT                   RSLLAEGIVLLDCQAQSLLELVEQVVSGESLSPELRGQLQALLLQRPQHHIQTMGIRPC
FT                   RESNAFRKASRDEDAPLKHQNPLRQKLPAGAEAAAVLAGELGFLEQPLGAFVRLRNPIV
FT                   LEPLTEMILPSRFFCLLLGPPTLGRSYHEMGRAAAVLLSDPQFQWSVRRASHLPDLLAA
FT                   LDAFLQEVTALPPGRWDRTARIPPPKYLPSQHKRFPSKLQEVTSLSRQSAALAEDKHHH
FT                   GPHTPIPELQRTGRLFGGLIQDVRRKACWYTSDFLDALHPQCFSAVFYIYLATVTNAIT
FT                   FGGLLGDATEGAQGVLESFLGTAVAGAAFCLMAGQPLTILSSTGPVLVFERLLFSFSRD
FT                   YSLDYLPFRLWVGIWVTAFCLALVATEASLLVRYFTRFTEEGFCALISLIFIYDAMGKM
FT                   LNLIRAYPIQRPGSSAYGCFCQYPGTGGNTSEWTSAKLKDTEDILSVPGLVNASFLPPP
FT                   ECIRQGGHPLGPSCHTVPDIAFFSLLLFFTSFLCAIALKHIKNSRFFPSVVRKVLGDFS
FT                   SVLAILLGCGLDTFLGLATPKLLVPTEFKPTLSGRGWLVSPFGANPWWLSVAAALPALL
FT                   LSILIFMDQQITAVILNRAEYRLQKGAGFHLDLFCVAVLMLFTSALGLPWYVSATVISL
FT                   AHIDSLRRESKACIPGEAPNFLGIREQRLTGLVVFVLTGVSIFLAPVLKFIPMPVLYGI
FT                   FLYMGVAALSSIQFVKRVQLLLMPRKHQPDMLLLRHVPLSRVHLFTAIQLACLGLLWVV
FT                   KSTPAAIVFPLMLLGLVAIRKALEWVFSPQELLWLDELMPEEEETIPENRSEPEHLFSG
FT                   NDSEDSELMYQPKAPEINISVN"
FT   CDS             join(20409440..20409657,20409896..20410056,
FT                   20410469..20410582,20410940..20410989,20411126..20411283,
FT                   20411529..20411616,20411967..20412121,20412353..20412469,
FT                   20412687..20412779,20413223..20413485,20414438..20414496,
FT                   20414830..20415015,20415142..20415255,20416535..20416696,
FT                   20416776..20416954,20418100..20418172,20420555..20420623,
FT                   20420849..20421022,20421984..20422139,20422447..20422500)
FT                   /codon_start=1
FT                   /gene="Slc4a9"
FT                   /locus_tag="mCG_121977"
FT                   /product="solute carrier family 4, sodium bicarbonate
FT                   cotransporter, member 9, isoform CRA_c"
FT                   /note="gene_id=mCG121977.1 transcript_id=mCT123196.1
FT                   protein_id=mCP69197.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q8BUG8"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="InterPro:IPR013769"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="MGI:MGI:2443384"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BUG8"
FT                   /protein_id="EDK97162.1"
FT                   /translation="MKLPGQGDFESSDAHENAHSEEPDSGLGPGPGLNGPSGIDIGESQ
FT                   VSKDPLLFIQLNELLGWPQALEWRETGRWLLFEEKLDMGAGRWSAPHVPTLELPSLQKL
FT                   RSLLAEGIVLLDCQAQSLLELVEQVVSGESLSPELRGQLQALLLQRPQHHIQTMGIRPC
FT                   RESNAFRKASRDEDAPLKHQNPLRQKLPAGAEAAAVLAGELGFLEQPLGAFVRLRNPIV
FT                   LEPLTEMILPSRFFCLLLGPPTLGRSYHEMGRAAAVLLSDPQFQWSVRRASHLPDLLAA
FT                   LDAFLQEVTALPPGRWDRTARIPPPKYLPSQHKRFPSKLQEVTSLSRQSAALAEDKHHH
FT                   GPHTPIPELQRTGSVSQLCSTFTWPQSQTPSLLGVFWEMPLKVPRDYSLDYLPFRLWVG
FT                   IWVTAFCLALVATEASLLVRYFTRFTEEGFCALISLIFIYDAMGKMLNLIRAYPIQRPG
FT                   SSAYGCFCQYPGTGGNTSEWTSAKLKDTEDILSVPGLVNASFLPPPECIRQGGHPLGPS
FT                   CHTVPDIAFFSLLLFFTSFLCAIALKHIKNSRFFPSVVRKVLGDFSSVLAILLGCGLDT
FT                   FLGLATPKLLVPTEFKPTLSGRGWLVSPFGANPWWLSVAAALPALLLSILIFMDQQITA
FT                   VILNRAEYRLQKGAGFHLDLFCVAVLMLFTSALGLPWYVSATVISLAHIDSLRRESKAC
FT                   IPGEAPNFLGIREQRLTGLVVFVLTGVSIFLAPVLKFIPMPVLYGIFLYMGVAALSSIQ
FT                   FVKRVQLLLMPRKHQPDMLLLRHVPLSRVHLFTAIQLACLGLLWVVKSTPAAIVFPLML
FT                   LGLVAIRKALEWVFSPQELLWLDELMPEEEETIPENRSEPEHLFSGNDSEDSELMYQPK
FT                   APEINISVN"
FT   mRNA            join(<20410479..20410582,20410940..20410989,
FT                   20411126..20411283,20411529..20411616,20411967..20412121,
FT                   20412353..20412469,20412605..20412779,20412931..20413064,
FT                   20413223..20413485,20414438..20414496,20414830..20415015,
FT                   20415142..20415255,20416535..20416696,20416779..20416954,
FT                   20418100..20418172,20420555..20420623,20420849..20421022,
FT                   20421984..20422139,20422447..20422539,20425642..20425869)
FT                   /gene="Slc4a9"
FT                   /locus_tag="mCG_121977"
FT                   /product="solute carrier family 4, sodium bicarbonate
FT                   cotransporter, member 9, transcript variant mCT188836"
FT                   /note="gene_id=mCG121977.1 transcript_id=mCT188836.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<20410480..20410582,20410940..20410989,
FT                   20411126..20411283,20411529..20411616,20411967..20412121,
FT                   20412353..20412469,20412605..20412779,20412931..20413064,
FT                   20413223..20413485,20414438..20414496,20414830..20415015,
FT                   20415142..20415255,20416535..20416696,20416779..20416954,
FT                   20418100..20418172,20420555..20420623,20420849..20421022,
FT                   20421984..20422139,20422447..20422500)
FT                   /codon_start=1
FT                   /gene="Slc4a9"
FT                   /locus_tag="mCG_121977"
FT                   /product="solute carrier family 4, sodium bicarbonate
FT                   cotransporter, member 9, isoform CRA_b"
FT                   /note="gene_id=mCG121977.1 transcript_id=mCT188836.0
FT                   protein_id=mCP109837.0 isoform=CRA_b"
FT                   /protein_id="EDK97161.1"
FT                   /translation="SGESLSPELRGQLQALLLQRPQHHIQTMGIRPCRESNAFRKASRD
FT                   EDAPLKHQNPLRQKLPAGAEAAAVLAGELGFLEQPLGAFVRLRNPIVLEPLTEMILPSR
FT                   FFCLLLGPPTLGRSYHEMGRAAAVLLSDPQFQWSVRRASHLPDLLAALDAFLQEVTALP
FT                   PGRWDRTARIPPPKYLPSQHKRFPSKLQEVTSLSRQSAALAEDKHHHGPHTPIPELQRT
FT                   GRLFGGLIQDVRRKACWYTSDFLDALHPQCFSAVFYIYLATVTNAITFGGLLGDATEGA
FT                   QGVLESFLGTAVAGAAFCLMAGQPLTILSSTGPVLVFERLLFSFSRDYSLDYLPFRLWV
FT                   GIWVTAFCLALVATEASLLVRYFTRFTEEGFCALISLIFIYDAMGKMLNLIRAYPIQRP
FT                   GSSAYGCFCQYPGTGGNTSEWTSAKLKDTEDILSVPGLVNASFLPPPECIRQGGHPLGP
FT                   SCHTVPDIAFFSLLLFFTSFLCAIALKHIKNSRFFPSVVRKVLGDFSSVLAILLGCGLD
FT                   TFLGLATPKLLVPTEFKPTLSGRGWLVSPFGANPWWLSVAAALPALLLSILIFMDQQIT
FT                   AVILNRAEYRLQGAGFHLDLFCVAVLMLFTSALGLPWYVSATVISLAHIDSLRRESKAC
FT                   IPGEAPNFLGIREQRLTGLVVFVLTGVSIFLAPVLKFIPMPVLYGIFLYMGVAALSSIQ
FT                   FVKRVQLLLMPRKHQPDMLLLRHVPLSRVHLFTAIQLACLGLLWVVKSTPAAIVFPLML
FT                   LGLVAIRKALEWVFSPQELLWLDELMPEEEETIPENRSEPEHLFSGNDSEDSELMYQPK
FT                   APEINISVN"
FT   mRNA            join(<20411138..20411283,20411529..20411616,
FT                   20411967..20412064,20412308..20412469,20412605..20412779,
FT                   20412931..20413064,20413223..20413489,20414904..20415015,
FT                   20416457..20416696,20416776..20416954,20418100..20418172,
FT                   20420555..20420623,20420849..>20421025)
FT                   /gene="Slc4a9"
FT                   /locus_tag="mCG_121977"
FT                   /product="solute carrier family 4, sodium bicarbonate
FT                   cotransporter, member 9, transcript variant mCT185124"
FT                   /note="gene_id=mCG121977.1 transcript_id=mCT185124.0
FT                   created on 04-JUN-2003"
FT   CDS             join(<20411138..20411283,20411529..20411616,
FT                   20411967..20412064,20412308..20412469,20412605..20412779,
FT                   20412931..20413064,20413223..20413489,20414904..20415015,
FT                   20416457..20416696,20416776..20416954,20418100..20418172,
FT                   20420555..20420623,20420849..>20421025)
FT                   /codon_start=1
FT                   /gene="Slc4a9"
FT                   /locus_tag="mCG_121977"
FT                   /product="solute carrier family 4, sodium bicarbonate
FT                   cotransporter, member 9, isoform CRA_d"
FT                   /note="gene_id=mCG121977.1 transcript_id=mCT185124.0
FT                   protein_id=mCP106382.0 isoform=CRA_d"
FT                   /protein_id="EDK97163.1"
FT                   /translation="LRQKLPAGAEAAAVLAGELGFLEQPLGAFVRLRNPIVLEPLTEMI
FT                   LPSRFFCLLLGPPTLGRSYHEMGRAAAVLLSDPQFQWSVRRASHLPDLLAALDAFLQEV
FT                   TALPPGRSAGDGSPSEAPILPRFPSKLQEVTSLSRQSAALAEDKHHHGPHTPIPELQRT
FT                   GRLFGGLIQDVRRKACWYTSDFLDALHPQCFSAVFYIYLATVTNAITFGGLLGDATEGA
FT                   QGVLESFLGTAVAGAAFCLMAGQPLTILSSTGPVLVFERLLFSFSRDYSLDYLPFRLWV
FT                   GIWVTAFCLALVATEASLLVRYFTRFTEEGFCALISLIFIYDAMGKMLNLIRAYPIQRP
FT                   GSSAYGCFCQYPGTGGSCHTVPDIAFFSLLLFFTSFLCAIALKHIKNSRFFPSVTVIVV
FT                   EVCCRGVPGRHFHPAHGISPQPTLSGRGWLVSPFGANPWWLSVAAALPALLLSILIFMD
FT                   QQITAVILNRAEYRLQKGAGFHLDLFCVAVLMLFTSALGLPWYVSATVISLAHIDSLRR
FT                   ESKACIPGEAPNFLGIREQRLTGLVVFVLTGVSIFLAPVLKFIPMPVLYGIFLYMGVAA
FT                   LSSIQFVKRVQLLLMPRKHQPDMLLLRHVPLSRVHLFTAIQLACLGLLWVVKSTPAAIV
FT                   FPLMV"
FT   gap             20424013..20424172
FT                   /estimated_length=160
FT   gap             20426726..20427357
FT                   /estimated_length=632
FT   gene            20442294..20523173
FT                   /locus_tag="mCG_142699"
FT                   /note="gene_id=mCG142699.0"
FT   mRNA            join(20442294..20442738,20456703..20456853,
FT                   20460302..20460458,20462752..20462899,20465295..20465442,
FT                   20471031..20471264,20473130..20473224,20475769..20476006,
FT                   20476486..20476677,20482454..20482563,20493497..20493584,
FT                   20494790..20494917,20495530..20495673,20496412..20496514,
FT                   20513763..20513908,20514046..20514157,20514405..20514550,
FT                   20515924..20516066,20516289..20516502,20519892..20520067,
FT                   20520236..20520398,20521955..20522050,20523060..20523173)
FT                   /locus_tag="mCG_142699"
FT                   /product="mCG142699, transcript variant mCT181754"
FT                   /note="gene_id=mCG142699.0 transcript_id=mCT181754.0
FT                   created on 25-APR-2003"
FT   mRNA            join(<20442421..20442738,20456703..20456853,
FT                   20460302..20460458,20462752..20462899,20465295..20465442,
FT                   20471031..20471264,20473130..20473224,20475769..20476006,
FT                   20476486..20476677,20482454..20482563,20493497..20493584,
FT                   20494790..20494917,20495530..20495673,20496412..20496514,
FT                   20506204..20506962,20513763..20513908,20514046..20514157,
FT                   20514405..20514550,20515924..20516066,20516289..20516502,
FT                   20519892..20520067,20520236..20520398,20521955..20522050,
FT                   20523060..20523173)
FT                   /locus_tag="mCG_142699"
FT                   /product="mCG142699, transcript variant mCT181755"
FT                   /note="gene_id=mCG142699.0 transcript_id=mCT181755.0
FT                   created on 25-APR-2003"
FT   CDS             join(20442421..20442738,20456703..20456853,
FT                   20460302..20460458,20462752..20462899,20465295..20465442,
FT                   20471031..20471264,20473130..20473224,20475769..20476006,
FT                   20476486..20476677,20482454..20482563,20493497..20493584,
FT                   20494790..20494917,20495530..20495673,20496412..20496514,
FT                   20506204..20506962,20513763..20513908,20514046..20514157,
FT                   20514405..20514550,20515924..20516066,20516289..20516502,
FT                   20519892..20520067,20520236..20520398,20521955..20522050,
FT                   20523060..20523077)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142699"
FT                   /product="mCG142699, isoform CRA_b"
FT                   /note="gene_id=mCG142699.0 transcript_id=mCT181755.0
FT                   protein_id=mCP104677.0 isoform=CRA_b"
FT                   /protein_id="EDK97165.1"
FT                   /translation="MLTDSGGGGTSFEEDLDSVAPRSAPAGASEPPPPGGVGLGIRTVR
FT                   LFGEAGPAPGVGGGGGGGGGSSSSSSAGGGDAALDFKLAAAVLRTGGGGGASGSDEDEV
FT                   SEVESFILDQEDLDNPVLKTSEIFLSSTAEGADLRTVDPETQARLEALLEAAGIGKLST
FT                   ADGKAFADPEVLRRLTSSVSCALDEAAAALTRMRAENTHSTGQVDTRSLAEACSDGDVN
FT                   AVRKLLDEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMA
FT                   ASSGGYLDIVKLLLLHDADVNSQSATGNTALTYACAGGFIDIVKVLLNEGANIEDHNEN
FT                   GHTPLMEAASAGHVEVARVLLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGA
FT                   DQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAA
FT                   LLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACC
FT                   GGFSEVADFLIKAGADIELGCSTPLMEASQEGHLELVKYLLAAGANVHATTATGDTALT
FT                   YACENGHTDVADVLLQAGAHLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRATA
FT                   NNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSYLLDYP
FT                   NNVLSVPTTDVSQLTSPSQDESQVPRVPIHTLAMVVPPQEPDRTSQETSTALLGVQKGA
FT                   SKQKSSSLQVADQDLLPPFHPYQPLECIVEETEGKLNELGQRISAIEKAQLKSLELIQG
FT                   EPLNKDKIEELKKNREEQVQKKKKILKELQKVERQLQMKTQQQFTKEYLETKGQRDTES
FT                   PHQQCSNRGVFMAGEEDGSLPQDHSSESPQLDTVLFKDHDIDDKQQSPPSAEQIDFVPV
FT                   QPLSSPQCNFFSDLGSNGTNSLVLQKVSGNQQIVGQPQIAIAGHEQGLLVQEPDGLMVA
FT                   TPAQTLTDTLDDLIAAVSTRVPVGSNNPSQTTECPTPESCYQTPSNMATPSTPPVYPSV
FT                   DIDAHTESNHDTALTLACAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHVGVV
FT                   EILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAA
FT                   SGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIET
FT                   NRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGA
FT                   DVNAPPVPSSRDTALTIAADKGHYKFCELLINRGAHIDVRNKKGNTPLWLASNGGHFDV
FT                   VQLLVQAGADVDAADNRKITPLMSAFRKGHVKVVQYLVKEVSQFPSDIECMRYIATITD
FT                   KVFSLL"
FT   CDS             join(20442421..20442738,20456703..20456853,
FT                   20460302..20460458,20462752..20462899,20465295..20465442,
FT                   20471031..20471264,20473130..20473224,20475769..20476006,
FT                   20476486..20476677,20482454..20482563,20493497..20493584,
FT                   20494790..20494917,20495530..20495673,20496412..20496514,
FT                   20513763..20513908,20514046..20514157,20514405..20514550,
FT                   20515924..20516066,20516289..20516502,20519892..20520067,
FT                   20520236..20520398,20521955..20522050,20523060..20523077)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142699"
FT                   /product="mCG142699, isoform CRA_a"
FT                   /note="gene_id=mCG142699.0 transcript_id=mCT181754.0
FT                   protein_id=mCP104676.0 isoform=CRA_a"
FT                   /protein_id="EDK97164.1"
FT                   /translation="MLTDSGGGGTSFEEDLDSVAPRSAPAGASEPPPPGGVGLGIRTVR
FT                   LFGEAGPAPGVGGGGGGGGGSSSSSSAGGGDAALDFKLAAAVLRTGGGGGASGSDEDEV
FT                   SEVESFILDQEDLDNPVLKTSEIFLSSTAEGADLRTVDPETQARLEALLEAAGIGKLST
FT                   ADGKAFADPEVLRRLTSSVSCALDEAAAALTRMRAENTHSTGQVDTRSLAEACSDGDVN
FT                   AVRKLLDEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMA
FT                   ASSGGYLDIVKLLLLHDADVNSQSATGNTALTYACAGGFIDIVKVLLNEGANIEDHNEN
FT                   GHTPLMEAASAGHVEVARVLLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGA
FT                   DQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAA
FT                   LLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACC
FT                   GGFSEVADFLIKAGADIELGCSTPLMEASQEGHLELVKYLLAAGANVHATTATGDTALT
FT                   YACENGHTDVADVLLQAGAHLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRATA
FT                   NNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSYLLDYP
FT                   NNVLSVPTTDVSQLTSPSQDESQVPRVPIHTLAMVVPPQEPDRTSQETSTALLGVQKAV
FT                   STRVPVGSNNPSQTTECPTPESCYQTPSNMATPSTPPVYPSVDIDAHTESNHDTALTLA
FT                   CAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERT
FT                   KDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAE
FT                   INSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEV
FT                   VSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTI
FT                   AADKGHYKFCELLINRGAHIDVRNKKGNTPLWLASNGGHFDVVQLLVQAGADVDAADNR
FT                   KITPLMSAFRKGHVKVVQYLVKEVSQFPSDIECMRYIATITDKVFSLL"
FT   gene            20491601..20492613
FT                   /pseudo
FT                   /locus_tag="mCG_124891"
FT                   /note="gene_id=mCG124891.1"
FT   mRNA            20491601..20492613
FT                   /pseudo
FT                   /locus_tag="mCG_124891"
FT                   /note="gene_id=mCG124891.1 transcript_id=mCT126142.1
FT                   created on 06-JUN-2002"
FT   gap             20523207..20525892
FT                   /estimated_length=2686
FT   gene            <20526172..20546909
FT                   /gene="Eif4ebp3"
FT                   /locus_tag="mCG_142697"
FT                   /note="gene_id=mCG142697.0"
FT   mRNA            join(<20526172..20526305,20527683..20527832,
FT                   20528123..20529732,20535089..20535262,20536420..20536674,
FT                   20537683..20537831,20538971..20539135,20541998..20542107,
FT                   20546283..20546456,20546592..20546909)
FT                   /gene="Eif4ebp3"
FT                   /locus_tag="mCG_142697"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   binding protein 3"
FT                   /note="gene_id=mCG142697.0 transcript_id=mCT181747.0
FT                   created on 01-APR-2003"
FT   CDS             join(<20526172..20526305,20527683..20527832,
FT                   20528123..20529732,20535089..20535262,20536420..20536674,
FT                   20537683..20537831,20538971..20539135,20541998..20542107,
FT                   20546283..20546456,20546592..20546595)
FT                   /codon_start=1
FT                   /gene="Eif4ebp3"
FT                   /locus_tag="mCG_142697"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   binding protein 3"
FT                   /note="gene_id=mCG142697.0 transcript_id=mCT181747.0
FT                   protein_id=mCP104669.0"
FT                   /protein_id="EDK97166.1"
FT                   /translation="LDGEVNSMSTSYKSLPLSSPTMKLNLTSPKRGQKREEGWKEVVRR
FT                   SKKLSVPASVVSRIMGRGGCNITAIQDVTGAHIDVDKQKDKNGERMITIRGGTESTRYA
FT                   VQLINALIQDPAKELEDLIPKNHIRTPASTKSIHTNFSSGVGTTATSSKNAFPLGAPAL
FT                   VTSQATTLSTFQPTNKLSKNVPTNVRSPFPVSLPLAYPHPHFALLAAQTMQQIRHPRLP
FT                   MAQFGGTFSPSPNTWGPFPVRPVNPGNTSSSPKHNNTARLPNQNGPVLPSESPGLATTG
FT                   CPITVSSVVAASQQLCMTNSRTPSSVRKQLFACVPKTSPPATVISSVTSTSSSLPSVSS
FT                   TSITSGHVTTTFMPAPTQVPLSSQKVESFSVIPPPKEKVSTQDQPLTNLCTPSPAATSC
FT                   NSSASNTSGAPEAHPSSTPPPPPGNTQEEGQPSKASDLSPVSMPFASNSETAPLTLASP
FT                   RLVAADNRDTGSLPQLTVPAPRVSHRMQPRGSFYSVVPNATMHQDPQSIFVTNPVPLTP
FT                   PQGPPAAVQLSSAVNIMNGSQVHINPANKSLQPTFGPATLFNHFSSLFDSGQVPANQGW
FT                   GDGPLPSRVAADASFTVQSAFLSNSVLGHLENVHPDNSKAPGFRPPSQRVSTSPVGLPS
FT                   IDPSGNSPSAAAPLTSFSGIPGTRVFLQGPAPVGTPSFNRQHFSPHPWTSASNTCDSPI
FT                   PSVSSGSSSPLSATSAPPTLGQQPKGNSASQDRKIPPPIGTERLARIRQGGSVAQAPVG
FT                   TSFVAPVGHGGIWSFGVNAMSEGLSGWSQSVIGNHPMHQQLSDPSTFSQHQPMERDDSG
FT                   MVAPTNIFHQPMGLPISMYGGTIIPSHPQLADVPGGPLFNGLHNPDPAWNPMIKVIQNS
FT                   AECTEAQQASVLSSVPALKGEIPSPQLTRPKKRVGQPMVSSSNQRHQDHLRQKVPAGVQ
FT                   ELTHCPDTSLLPPSDSRGHNSSSSTTLQVGVAEGTEADRGRNNR"
FT   gene            complement(20548248..20551305)
FT                   /gene="Sra1"
FT                   /locus_tag="mCG_124887"
FT                   /note="gene_id=mCG124887.1"
FT   mRNA            complement(join(20548248..20548660,20548792..20548900,
FT                   20549653..20549849,20551011..20551136,20551255..20551305))
FT                   /gene="Sra1"
FT                   /locus_tag="mCG_124887"
FT                   /product="steroid receptor RNA activator 1"
FT                   /note="gene_id=mCG124887.1 transcript_id=mCT126138.0
FT                   created on 06-JUN-2002"
FT   CDS             complement(join(20548455..20548660,20548792..20548900,
FT                   20549653..20549849,20551011..20551136,20551255..20551279))
FT                   /codon_start=1
FT                   /gene="Sra1"
FT                   /locus_tag="mCG_124887"
FT                   /product="steroid receptor RNA activator 1"
FT                   /note="gene_id=mCG124887.1 transcript_id=mCT126138.0
FT                   protein_id=mCP69166.1"
FT                   /protein_id="EDK97167.1"
FT                   /translation="MAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLTKRVAAPQ
FT                   DGSPRAPETSGPPPVDHPPPSSKASRPPPMGSCPATGVEPPSSPVIESETLIEDVLRPL
FT                   EQALEDCHGHTKKQVCDDISRRLALLREQWAGGKLSIPVKKRMALLVQELLHHQWDAAD
FT                   DIHRSLMVDHVTEVSQWMVGVKRLIAEKKSLSSEETKEEKFTVEPENQTIPGFQQPS"
FT   gene            complement(20552172..20560383)
FT                   /gene="Apbb3"
FT                   /locus_tag="mCG_124901"
FT                   /note="gene_id=mCG124901.1"
FT   mRNA            complement(join(20552172..20552688,20555993..20556184,
FT                   20556324..20556439,20556706..20556789,20557214..20557298,
FT                   20557406..20557520,20557908..20558035,20558153..20558299,
FT                   20558488..20558548,20559438..20559514,20559594..20559757,
FT                   20560041..20560383))
FT                   /gene="Apbb3"
FT                   /locus_tag="mCG_124901"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family B, member 3"
FT                   /note="gene_id=mCG124901.1 transcript_id=mCT126152.1
FT                   created on 06-JUN-2002"
FT   CDS             complement(join(20552452..20552688,20555993..20556184,
FT                   20556324..20556439,20556706..20556789,20557214..20557298,
FT                   20557406..20557520,20557908..20558035,20558153..20558299,
FT                   20558488..20558548,20559438..20559514,20559594..20559757,
FT                   20560041..20560089))
FT                   /codon_start=1
FT                   /gene="Apbb3"
FT                   /locus_tag="mCG_124901"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family B, member 3"
FT                   /note="gene_id=mCG124901.1 transcript_id=mCT126152.1
FT                   protein_id=mCP69172.1"
FT                   /protein_id="EDK97168.1"
FT                   /translation="MLGKDYMLAIILVNCDDDLWGDQNLEGETGLPPGWRKIRDAAGTY
FT                   YWHVPSGSTQWQRPTWELPGAEDPGRGTEGIWELPPPKGRSFSSLDSSLNRSNSLTWYS
FT                   EDSYVRSLEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRNRSQPHDGT
FT                   WGEGQNMLMILKKDAMSLLNPLDHSLIHCQPLVHIRVWGVGSSKGRDFAFVAGDKDSCM
FT                   LKCHVFHCDVPAKAIASALQGLCAQILSERVGVSGEAACCSPDPISPEDLPRQVELLDA
FT                   VSQAAQKYEALYMGILPVTKAMGMDVLNEAIGTLTARGDRKTWVPAMLSVSDSLMTAHA
FT                   IQAEAGAEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGCQSFQCAAFWCEPHAGGLSE
FT                   AVQAACMVQYQKCLVASAARGKAWGAQARARLRLKRTSSMDSPGGPLPPPLLKGGAGGA
FT                   GAAPRKRGVFSFLDAFRLKPSLLHMS"
FT   gene            20560635..20564989
FT                   /locus_tag="mCG_124893"
FT                   /note="gene_id=mCG124893.1"
FT   mRNA            join(20560635..20560667,20561574..20561672,
FT                   20562581..20564910)
FT                   /locus_tag="mCG_124893"
FT                   /product="mCG124893, transcript variant mCT126144"
FT                   /note="gene_id=mCG124893.1 transcript_id=mCT126144.0
FT                   created on 06-JUN-2002"
FT   mRNA            join(20560650..20560667,20561574..20561672,
FT                   20562581..20562818,20562927..20564989)
FT                   /locus_tag="mCG_124893"
FT                   /product="mCG124893, transcript variant mCT169884"
FT                   /note="gene_id=mCG124893.1 transcript_id=mCT169884.0
FT                   created on 06-JUN-2002"
FT   CDS             20563172..20564146
FT                   /codon_start=1
FT                   /locus_tag="mCG_124893"
FT                   /product="mCG124893, isoform CRA_a"
FT                   /note="gene_id=mCG124893.1 transcript_id=mCT126144.0
FT                   protein_id=mCP69203.1 isoform=CRA_a"
FT                   /protein_id="EDK97169.1"
FT                   /translation="MSVEDGGVPGLARPRQARWTLLLFLSTAMYGAHAPFLALCHVDGR
FT                   VPFRPSSAVLLTELTKLLLCAFSLLVGWQTWPQGTPPWRQAVPFALSALLYGANNNLVI
FT                   YLQRYMDPSTYQVLSNLKIGSTALLYCLCLGHRLSARQGLALLLLMAAGACYASGGFQE
FT                   PVNTLPGPASAAGAHPMPLHITPLGLLLLILYCLISGLSSVYTELIMKRQRLPLALQNL
FT                   FLYTFGVILNFGLYAGSGPGPGFLEGFSGWAVLVVLNQAVNGLLMSAVMKHGSSITRLF
FT                   IVSCSLVVNAVLSAVLLQLQLTAIFFLAALLIGLAVCLYYGSP"
FT   CDS             20563172..20564146
FT                   /codon_start=1
FT                   /locus_tag="mCG_124893"
FT                   /product="mCG124893, isoform CRA_a"
FT                   /note="gene_id=mCG124893.1 transcript_id=mCT169884.0
FT                   protein_id=mCP92527.0 isoform=CRA_a"
FT                   /protein_id="EDK97170.1"
FT                   /translation="MSVEDGGVPGLARPRQARWTLLLFLSTAMYGAHAPFLALCHVDGR
FT                   VPFRPSSAVLLTELTKLLLCAFSLLVGWQTWPQGTPPWRQAVPFALSALLYGANNNLVI
FT                   YLQRYMDPSTYQVLSNLKIGSTALLYCLCLGHRLSARQGLALLLLMAAGACYASGGFQE
FT                   PVNTLPGPASAAGAHPMPLHITPLGLLLLILYCLISGLSSVYTELIMKRQRLPLALQNL
FT                   FLYTFGVILNFGLYAGSGPGPGFLEGFSGWAVLVVLNQAVNGLLMSAVMKHGSSITRLF
FT                   IVSCSLVVNAVLSAVLLQLQLTAIFFLAALLIGLAVCLYYGSP"
FT   gene            complement(20565976..20576970)
FT                   /gene="E230025N22"
FT                   /locus_tag="mCG_145676"
FT                   /note="gene_id=mCG145676.0"
FT   mRNA            complement(join(20565976..20566621,20566700..20566858,
FT                   20567742..20567906,20568299..20568369,20569211..20569268,
FT                   20569938..20570015,20570087..20570295,20572484..20572617,
FT                   20573441..20573527,20574080..20574162,20575726..20575803,
FT                   20576583..20576702,20576841..20576970))
FT                   /gene="E230025N22"
FT                   /locus_tag="mCG_145676"
FT                   /product="hypothetical protein E230025N22"
FT                   /note="gene_id=mCG145676.0 transcript_id=mCT185102.0
FT                   created on 04-JUN-2003"
FT   CDS             complement(join(20566379..20566621,20566700..20566858,
FT                   20567742..20567906,20568299..20568369,20569211..20569268,
FT                   20569938..20570015,20570087..20570295,20572484..20572617,
FT                   20573441..20573527,20574080..20574162,20575726..20575803,
FT                   20576583..20576666))
FT                   /codon_start=1
FT                   /gene="E230025N22"
FT                   /locus_tag="mCG_145676"
FT                   /product="hypothetical protein E230025N22"
FT                   /note="gene_id=mCG145676.0 transcript_id=mCT185102.0
FT                   protein_id=mCP106360.0"
FT                   /db_xref="GOA:G5E8S3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:3687212"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8S3"
FT                   /protein_id="EDK97171.1"
FT                   /translation="MLASVGQGYNTTLLLQGQETEAPRFVPQVLQMLFEEALPLCSSGP
FT                   VLCTLSLVQINRIGQARDLLSPCVEDLPVLDVAPLGLVVKDASEVEVSDARAASELYLK
FT                   AAVGEGRDCPLLRVLAGAAAGEEVEGSLPWIISWLLEANSYRGVLLRLDPRGSSLSLLQ
FT                   NALLGASRKRMQVNDVKPTLWSAVEEMGARRATLKMLRLGLLGDTLTYSGLNQLGRALW
FT                   ELQVVKAWGPRSHTHKGTRDETVRLLEPQVKGEPLNYCKQGRHSAHLSEAGRRGFLGSG
FT                   LRLKHPLGHCEEQAHQAPDVALQFSLAQARRQRLREEHQIRIQEELKHLEHWKEVATCE
FT                   QIKGTVAEEACMGRESQRKEQAVLKLQVDTLQAERDVAEQDLVVLYDLYVQATRARTCH
FT                   LLQVFQAWQRMWEEKAMATEHHYRSLLAGILQGSIDLALKNQQLQSQNQQLEQSADRAS
FT                   HAGVLPGETSDPEHSGATFLCPHS"
FT   gap             20590722..20590741
FT                   /estimated_length=20
FT   gap             20591888..20591907
FT                   /estimated_length=20
FT   gap             20593259..20593278
FT                   /estimated_length=20
FT   gene            complement(20609055..20610639)
FT                   /gene="Cd14"
FT                   /locus_tag="mCG_124892"
FT                   /note="gene_id=mCG124892.1"
FT   mRNA            complement(join(20609055..20610385,20610477..20610639))
FT                   /gene="Cd14"
FT                   /locus_tag="mCG_124892"
FT                   /product="CD14 antigen"
FT                   /note="gene_id=mCG124892.1 transcript_id=mCT126143.1
FT                   created on 06-JUN-2002"
FT   CDS             complement(join(20609288..20610385,20610477..20610479))
FT                   /codon_start=1
FT                   /gene="Cd14"
FT                   /locus_tag="mCG_124892"
FT                   /product="CD14 antigen"
FT                   /note="gene_id=mCG124892.1 transcript_id=mCT126143.1
FT                   protein_id=mCP69202.1"
FT                   /db_xref="GOA:Q4FJP7"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR016337"
FT                   /db_xref="MGI:MGI:88318"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJP7"
FT                   /protein_id="EDK97172.1"
FT                   /translation="MERVLGLLLLLLVHASPAPPEPCELDEESCSCNFSDPKPDWSSAF
FT                   NCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFG
FT                   ALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQW
FT                   LKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQV
FT                   LALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTG
FT                   LKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVV
FT                   TAGAPSSQAVALSGTLALLLGDRLFV"
FT   gene            20619019..20626375
FT                   /gene="2410015B03Rik"
FT                   /locus_tag="mCG_124900"
FT                   /note="gene_id=mCG124900.1"
FT   mRNA            join(20619019..20619240,20619372..20619484,
FT                   20621441..20621556,20621653..20621836,20622080..20622184,
FT                   20622346..20622431,20622612..20622728,20622937..20623048,
FT                   20623139..20623325,20625029..20625123,20625638..20625805,
FT                   20626023..20626375)
FT                   /gene="2410015B03Rik"
FT                   /locus_tag="mCG_124900"
FT                   /product="RIKEN cDNA 2410015B03"
FT                   /note="gene_id=mCG124900.1 transcript_id=mCT126151.1
FT                   created on 06-JUN-2002"
FT   CDS             join(20619156..20619240,20619372..20619484,
FT                   20621441..20621556,20621653..20621836,20622080..20622184,
FT                   20622346..20622431,20622612..20622728,20622937..20623048,
FT                   20623139..20623325,20625029..20625123,20625638..20625805,
FT                   20626023..20626139)
FT                   /codon_start=1
FT                   /gene="2410015B03Rik"
FT                   /locus_tag="mCG_124900"
FT                   /product="RIKEN cDNA 2410015B03"
FT                   /note="gene_id=mCG124900.1 transcript_id=mCT126151.1
FT                   protein_id=mCP68984.1"
FT                   /protein_id="EDK97173.1"
FT                   /translation="MWNRRQGRLRTLAFGVEELRRRRREREAALRKARREQQLVSKRLL
FT                   REDAPEEVGGQSAAVLLGEAEVQQFLRLAQRGTDEKEREKALVSLRRGLQHPDTQQTFI
FT                   RLEGSMRTLVGILTSNRALLQLEAARCLHELSHSEQSAVAEACLPATSYLLTYLSGHSS
FT                   DFIELCLYTLGNLIVESEAVRKQLLPQGIVPAFAACIQSPHVAVLEALGYALSQLLQAK
FT                   EAPEKIIPSILDSSLPQQMLRLMQPGPKLNLGVAMEFAWCLHYIICSQVNNAVLLTHGA
FT                   LPTLALLLLDLAGTVQRMDDVGLELLACPVLRCLSNLLTEVPAEVMGQQMELRDERLVA
FT                   ALFIFLQFFLQKQPALLPEGLWLLNNLTANSPTFCTSLLSLDLIEPLLQLLPLSNAVCM
FT                   LVLTVLCNVVEKGPAYCQRLWPGPLLSCVLNTLALSDTEVVGQSLELLQLLFLHQPEAA
FT                   RAFLQQSGLQALEKLQEETQLQERIHALQQIAATHG"
FT   gene            complement(20626311..20628515)
FT                   /gene="Ndufa2"
FT                   /locus_tag="mCG_124890"
FT                   /note="gene_id=mCG124890.1"
FT   mRNA            complement(join(20626311..20626634,20628157..20628263,
FT                   20628396..20628515))
FT                   /gene="Ndufa2"
FT                   /locus_tag="mCG_124890"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 2"
FT                   /note="gene_id=mCG124890.1 transcript_id=mCT126141.1
FT                   created on 06-JUN-2002"
FT   CDS             complement(join(20626543..20626634,20628157..20628263,
FT                   20628396..20628496))
FT                   /codon_start=1
FT                   /gene="Ndufa2"
FT                   /locus_tag="mCG_124890"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 2"
FT                   /note="gene_id=mCG124890.1 transcript_id=mCT126141.1
FT                   protein_id=mCP69194.1"
FT                   /protein_id="EDK97174.1"
FT                   /translation="MAAAAASRAVGAKLGLREIRVHLCQRSPGSQGVRDFIVQRYVELK
FT                   KAHPNLPILIRECSEVQPKLWARYAFGQEKTVSLNNLSADEVTRAMQNVLSGKA"
FT   gene            20628676..20641609
FT                   /gene="Ik"
FT                   /locus_tag="mCG_124897"
FT                   /note="gene_id=mCG124897.1"
FT   mRNA            join(20628676..20628764,20629587..20629653,
FT                   20631324..20631416,20632130..20632189,20632517..20632684,
FT                   20632837..20632951,20633180..20633250,20633357..20633403,
FT                   20635072..20635235,20636325..20636433,20637230..20637269,
FT                   20637395..20637620,20637865..20637883,20638526..20638611,
FT                   20639399..20639478,20639670..20639727,20640522..20640610,
FT                   20640796..20640904,20641258..20641292,20641381..20641609)
FT                   /gene="Ik"
FT                   /locus_tag="mCG_124897"
FT                   /product="IK cytokine"
FT                   /note="gene_id=mCG124897.1 transcript_id=mCT126148.1
FT                   created on 06-JUN-2002"
FT   CDS             join(20628749..20628764,20629587..20629653,
FT                   20631324..20631416,20632130..20632189,20632517..20632684,
FT                   20632837..20632951,20633180..20633250,20633357..20633403,
FT                   20635072..20635235,20636325..20636433,20637230..20637269,
FT                   20637395..20637620,20637865..20637883,20638526..20638611,
FT                   20639399..20639478,20639670..20639727,20640522..20640610,
FT                   20640796..20640904,20641258..20641292,20641381..20641408)
FT                   /codon_start=1
FT                   /gene="Ik"
FT                   /locus_tag="mCG_124897"
FT                   /product="IK cytokine"
FT                   /note="gene_id=mCG124897.1 transcript_id=mCT126148.1
FT                   protein_id=mCP69403.1"
FT                   /protein_id="EDK97175.1"
FT                   /translation="MPERDSEPFSNPLAPDGHDVDDPHSFHQSKLTNEDFRKLLMTPRA
FT                   APTSAPPSKSRHHEMPREYNEDEDPAARRRKKKSYYAKLRQQEIERERELAEKYRDRAK
FT                   ERRDGVNKDYEETELISTTANYRAVGPTAEADKSAAEKRRQLIQESKFLGGDMEHTHLV
FT                   KGLDFALLQKVRAEIASKEKEEEELMEKPQKETKKDEDPENKIEFKTRLGRNVYRMLFK
FT                   SKSYERNELFLPGRMAYVVDLDDEYADTDIPTTLIRSKADCPTMEAQTTLTTNDIVISK
FT                   LTQILSYLRQGTRNKKLKKKDKGKLEEKKPPEADMNIFEDIGDYVPSTTKTPRDKERER
FT                   YRERERDRERDRDRERDRERDRERERERDREREREEEKKRHSYFEKPKVDDEPMDVDKG
FT                   PGSAKELIKSINEKFAGSAGWEGTESYPLKKPEDKKQLGDFFGMSNSYAECYPATMDDM
FT                   AVDSDEEVDYSKMDQGNKKGPLGRWDFDTQEEYSEYMNNKEALPKAAFQYGIKMSEGRK
FT                   TRRFKETNDKAELDRQWKKISAIIEKRKRMEADGVEVKRPKY"
FT   gene            20644209..20648126
FT                   /gene="Wdr55"
FT                   /locus_tag="mCG_124898"
FT                   /note="gene_id=mCG124898.1"
FT   mRNA            join(20644209..20644455,20645952..20646052,
FT                   20646141..20646228,20646330..20646509,20646633..20646732,
FT                   20646824..20646993,20647067..20648126)
FT                   /gene="Wdr55"
FT                   /locus_tag="mCG_124898"
FT                   /product="WD repeat domain 55"
FT                   /note="gene_id=mCG124898.1 transcript_id=mCT126149.0
FT                   created on 06-JUN-2002"
FT   CDS             join(20644262..20644455,20645952..20646052,
FT                   20646141..20646228,20646330..20646509,20646633..20646732,
FT                   20646824..20646993,20647067..20647400)
FT                   /codon_start=1
FT                   /gene="Wdr55"
FT                   /locus_tag="mCG_124898"
FT                   /product="WD repeat domain 55"
FT                   /note="gene_id=mCG124898.1 transcript_id=mCT126149.0
FT                   protein_id=mCP68961.1"
FT                   /db_xref="GOA:Q9CX97"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017422"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="MGI:MGI:1915186"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CX97"
FT                   /protein_id="EDK97176.1"
FT                   /translation="MDPTCEESPAEDSNNEEEDLDSTKAAPRIRDTPEDIVLEAPASGL
FT                   AFHPTRDLLAAGDVDGDVFVFAYSCQEGETKELWSSGHHLKSCRAVVFSEDGQKLVTVS
FT                   KDKAIHILDVEQGQLERRISKAHSAPINSVLLVDENALVTGDDTGGIRLWDQRKEGPLM
FT                   DMRQHEEYIADMALDPAKKLLLTASGDGCLGVFNIKRRRFELLSEPQSGDLTSVALMKY
FT                   GKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCIVPVTENLLCTGSTDGIIRAVN
FT                   ILPNRVVGTVGQHAGEPVEALALSHCGHFLASSGHDQRLKFWDMTQLRTVVVDDYRRRK
FT                   KKGGPLRALSSKAWSTDDFFAGLREDEEDAKAPEEVVRESDDDDDDSD"
FT   gene            complement(20647642..20650189)
FT                   /gene="Dnd1"
FT                   /locus_tag="mCG_124896"
FT                   /note="gene_id=mCG124896.1"
FT   mRNA            complement(join(20647642..20648462,20649071..20649532,
FT                   20649868..20649985,20650118..20650188))
FT                   /gene="Dnd1"
FT                   /locus_tag="mCG_124896"
FT                   /product="dead end homolog 1 (zebrafish), transcript
FT                   variant mCT126147"
FT                   /note="gene_id=mCG124896.1 transcript_id=mCT126147.0
FT                   created on 01-APR-2003"
FT   mRNA            complement(join(20647647..20648462,20649071..20649985,
FT                   20650118..20650189))
FT                   /gene="Dnd1"
FT                   /locus_tag="mCG_124896"
FT                   /product="dead end homolog 1 (zebrafish), transcript
FT                   variant mCT181753"
FT                   /note="gene_id=mCG124896.1 transcript_id=mCT181753.0
FT                   created on 01-APR-2003"
FT   CDS             complement(join(20648008..20648462,20649071..20649532,
FT                   20649868..20649985,20650118..20650141))
FT                   /codon_start=1
FT                   /gene="Dnd1"
FT                   /locus_tag="mCG_124896"
FT                   /product="dead end homolog 1 (zebrafish), isoform CRA_a"
FT                   /note="gene_id=mCG124896.1 transcript_id=mCT126147.0
FT                   protein_id=mCP69396.1 isoform=CRA_a"
FT                   /protein_id="EDK97177.1"
FT                   /translation="MQSKRECEQWCERVNPENKAALEAWVRETGIRLVQVNGQRKYGGP
FT                   PPGWVGSPPPSGSEVYIGRLPQDVYEHQLIPLFQRVGRLYEFRLMMTFSGLNRGFAYAR
FT                   YSSRRGAQAAIATLHNHQLRPSCQLLVCRSTEKCELTVDGLPLSLNRRALLLALQPFGP
FT                   CLQETLLLPSPGSAPSQIALLKFSTHRAAAMAKKALVEGQSRLCGEQVAVEWLKPDLKQ
FT                   HFRQQLAGPSLRFLRPDVSQLTQTREKLGSQGARAALQLLCQRMKLGSPVFLTKCLGTG
FT                   PAGWHRFWYQVVIPGHPVPFSGLIWVVLASDWQDGHEVAKDAVSAQLLEALSEPRTSLW
FT                   SPGAEAGTMVKQ"
FT   CDS             complement(join(20648008..20648462,20649071..20649638))
FT                   /codon_start=1
FT                   /gene="Dnd1"
FT                   /locus_tag="mCG_124896"
FT                   /product="dead end homolog 1 (zebrafish), isoform CRA_b"
FT                   /note="gene_id=mCG124896.1 transcript_id=mCT181753.0
FT                   protein_id=mCP104675.0 isoform=CRA_b"
FT                   /protein_id="EDK97178.1"
FT                   /translation="MVSLPSPPLPPPPSFILELKNILVDHSNQQNPFPPGWVGSPPPSG
FT                   SEVYIGRLPQDVYEHQLIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIA
FT                   TLHNHQLRPSCQLLVCRSTEKCELTVDGLPLSLNRRALLLALQPFGPCLQETLLLPSPG
FT                   SAPSQIALLKFSTHRAAAMAKKALVEGQSRLCGEQVAVEWLKPDLKQHFRQQLAGPSLR
FT                   FLRPDVSQLTQTREKLGSQGARAALQLLCQRMKLGSPVFLTKCLGTGPAGWHRFWYQVV
FT                   IPGHPVPFSGLIWVVLASDWQDGHEVAKDAVSAQLLEALSEPRTSLWSPGAEAGTMVKQ
FT                   "
FT   gene            complement(20650847..20667112)
FT                   /gene="Hars"
FT                   /locus_tag="mCG_124889"
FT                   /note="gene_id=mCG124889.1"
FT   mRNA            complement(join(20650847..20650931,20651168..20651314,
FT                   20652041..20652157,20654023..20654265,20654358..20654485,
FT                   20654718..20654811,20655009..20655107,20655241..20655348,
FT                   20656179..20656304,20657439..20657534,20660096..20660215,
FT                   20666607..20666696,20666938..20667112))
FT                   /gene="Hars"
FT                   /locus_tag="mCG_124889"
FT                   /product="histidyl-tRNA synthetase"
FT                   /note="gene_id=mCG124889.1 transcript_id=mCT126140.0
FT                   created on 16-OCT-2002"
FT   CDS             complement(join(20650860..20650931,20651168..20651314,
FT                   20652041..20652157,20654023..20654265,20654358..20654485,
FT                   20654718..20654811,20655009..20655107,20655241..20655348,
FT                   20656179..20656304,20657439..20657534,20660096..20660215,
FT                   20666607..20666696,20666938..20667027))
FT                   /codon_start=1
FT                   /gene="Hars"
FT                   /locus_tag="mCG_124889"
FT                   /product="histidyl-tRNA synthetase"
FT                   /note="gene_id=mCG124889.1 transcript_id=mCT126140.0
FT                   protein_id=mCP69183.1"
FT                   /protein_id="EDK97179.1"
FT                   /translation="MADRAALEELVRLQGAHVRGLKEQKASAEQIEEEVTKLLKLKAQL
FT                   GQDEGKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLT
FT                   GKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAM
FT                   TRGRYREFYQCDFDIAGQFDPMIPDAECLKIMCEILSSLQIGNFLVKVNDRRILDGMFA
FT                   VCGVPDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVE
FT                   QLLQDPKLSQNKQAVEGLGDLKLLFEYLILFGIDDKISFDLSLARGLDYYTGVIYEAVL
FT                   LQMPTQAGEEPLGVGSIAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEA
FT                   SEEKVRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEA
FT                   GIPLVAIIGEQELKDGVIKLRSVASREEVDVQREDLVEEIRRRTNQPLSIC"
FT   gene            20667156..20676196
FT                   /gene="Harsl"
FT                   /locus_tag="mCG_124899"
FT                   /note="gene_id=mCG124899.1"
FT   mRNA            join(20667156..20667421,20669508..20669585,
FT                   20669812..20669931,20670054..20670149,20671447..20671572,
FT                   20671844..20671951,20672111..20672209,20672522..20672615,
FT                   20673102..20673229,20673312..20673554,20674079..20674195,
FT                   20674414..20674560,20675015..20676196)
FT                   /gene="Harsl"
FT                   /locus_tag="mCG_124899"
FT                   /product="histidyl-tRNA synthetase-like, transcript variant
FT                   mCT126150"
FT                   /note="gene_id=mCG124899.1 transcript_id=mCT126150.1
FT                   created on 03-JUN-2003"
FT   mRNA            join(20667157..20667421,20669508..20669585,
FT                   20669812..20669931,20670054..20670149,20671447..20671572,
FT                   20671844..20671951,20672111..20672209,20672522..20672615,
FT                   20673102..20673229,20674079..20674195,20674414..20674560,
FT                   20675015..20675639)
FT                   /gene="Harsl"
FT                   /locus_tag="mCG_124899"
FT                   /product="histidyl-tRNA synthetase-like, transcript variant
FT                   mCT185118"
FT                   /note="gene_id=mCG124899.1 transcript_id=mCT185118.0
FT                   created on 03-JUN-2003"
FT   mRNA            join(20667159..20667421,20669508..20669585,
FT                   20669812..20669931,20670054..20670114,20674414..20674563)
FT                   /gene="Harsl"
FT                   /locus_tag="mCG_124899"
FT                   /product="histidyl-tRNA synthetase-like, transcript variant
FT                   mCT175534"
FT                   /note="gene_id=mCG124899.1 transcript_id=mCT175534.0
FT                   created on 03-JUN-2003"
FT   CDS             join(20667320..20667421,20669508..20669585,
FT                   20669812..20669931,20670054..20670149,20671447..20671572,
FT                   20671844..20671951,20672111..20672209,20672522..20672615,
FT                   20673102..20673229,20673312..20673554,20674079..20674195,
FT                   20674414..20674560,20675015..20675074)
FT                   /codon_start=1
FT                   /gene="Harsl"
FT                   /locus_tag="mCG_124899"
FT                   /product="histidyl-tRNA synthetase-like, isoform CRA_b"
FT                   /note="gene_id=mCG124899.1 transcript_id=mCT126150.1
FT                   protein_id=mCP68977.1 isoform=CRA_b"
FT                   /protein_id="EDK97181.1"
FT                   /translation="MPHLGPLRRRAWAALLGQLLRPPSTVCTRGCHSQVAKAVLTSEQL
FT                   KSHQEKPNFVIKVPKGTRDLSPQQMVVREKILDKIISCFKRHGAKGLDTPAFELKEMLT
FT                   EKYEDNFGLMYDLKDQGGELLSLRYDLTVPFARYLAMNKLKKMKRYQVGKVWRRESPAI
FT                   AQGRYREFCQCDFDIAGEFDPMIPDAECLRIMCEILSGLQLGDFLIKVNDRRVVDGIFA
FT                   VCGVPESKLRTICSSMDKLDKMSWEGVRHEMVAKKGLAPEVADRIGDFVQYHGGISLVE
FT                   DLFKDPRLSQSQLALQGLGDLKLLFEYLRLFGIADKISLDLSLARGLDYYTGVIYEAVL
FT                   LESPAQAGKETLSVGSVAAGGRYDNLVAQFDPKGHHVPCVGLSIGVERIFYLVEQKMKM
FT                   SGEKVRTTETQVFVATPQKNFLQERLKIIAELWDAGIKAEMLYKNNPKLLTQLHYCEKA
FT                   DIPLMVIIGEQERNEGVIKLRSVASREEVTINRESLVAEIQKRLSES"
FT   CDS             join(20667320..20667421,20669508..20669585,
FT                   20669812..20669931,20670054..20670149,20671447..20671572,
FT                   20671844..20671951,20672111..20672209,20672522..20672615,
FT                   20673102..20673229,20674079..20674195,20674414..20674560,
FT                   20675015..20675074)
FT                   /codon_start=1
FT                   /gene="Harsl"
FT                   /locus_tag="mCG_124899"
FT                   /product="histidyl-tRNA synthetase-like, isoform CRA_a"
FT                   /note="gene_id=mCG124899.1 transcript_id=mCT185118.0
FT                   protein_id=mCP106376.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E823"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="MGI:MGI:1918041"
FT                   /db_xref="UniProtKB/TrEMBL:G5E823"
FT                   /protein_id="EDK97180.1"
FT                   /translation="MPHLGPLRRRAWAALLGQLLRPPSTVCTRGCHSQVAKAVLTSEQL
FT                   KSHQEKPNFVIKVPKGTRDLSPQQMVVREKILDKIISCFKRHGAKGLDTPAFELKEMLT
FT                   EKYEDNFGLMYDLKDQGGELLSLRYDLTVPFARYLAMNKLKKMKRYQVGKVWRRESPAI
FT                   AQGRYREFCQCDFDIAGEFDPMIPDAECLRIMCEILSGLQLGDFLIKVNDRRVVDGIFA
FT                   VCGVPESKLRTICSSMDKLDKMSWEGVRHEMVAKKGLAPEVADRIGDFVQYHGGISLVE
FT                   DLFKDPRLSQSQLALQGLGDLKLLFEYLRLFGIADKMSGEKVRTTETQVFVATPQKNFL
FT                   QERLKIIAELWDAGIKAEMLYKNNPKLLTQLHYCEKADIPLMVIIGEQERNEGVIKLRS
FT                   VASREEVTINRESLVAEIQKRLSES"
FT   CDS             join(20667320..20667421,20669508..20669585,
FT                   20669812..20669931,20670054..20670114,20674414..20674430)
FT                   /codon_start=1
FT                   /gene="Harsl"
FT                   /locus_tag="mCG_124899"
FT                   /product="histidyl-tRNA synthetase-like, isoform CRA_c"
FT                   /note="gene_id=mCG124899.1 transcript_id=mCT175534.0
FT                   protein_id=mCP98456.0 isoform=CRA_c"
FT                   /protein_id="EDK97182.1"
FT                   /translation="MPHLGPLRRRAWAALLGQLLRPPSTVCTRGCHSQVAKAVLTSEQL
FT                   KSHQEKPNFVIKVPKGTRDLSPQQMVVREKILDKIISCFKRHGAKGLDTPAFELKEMLT
FT                   EKYEDNFGLMYDLKDQGRDAL"
FT   gene            20677872..20683350
FT                   /gene="Zmat2"
FT                   /locus_tag="mCG_124888"
FT                   /note="gene_id=mCG124888.2"
FT   mRNA            join(20677872..20677904,20678242..20678335,
FT                   20678989..20679112,20679985..20680058,20680447..20680592,
FT                   20681826..20683350)
FT                   /gene="Zmat2"
FT                   /locus_tag="mCG_124888"
FT                   /product="zinc finger, matrin type 2"
FT                   /note="gene_id=mCG124888.2 transcript_id=mCT126139.1
FT                   created on 03-JUN-2003"
FT   CDS             join(20677887..20677904,20678242..20678335,
FT                   20678989..20679112,20679985..20680058,20680447..20680592,
FT                   20681826..20681969)
FT                   /codon_start=1
FT                   /gene="Zmat2"
FT                   /locus_tag="mCG_124888"
FT                   /product="zinc finger, matrin type 2"
FT                   /note="gene_id=mCG124888.2 transcript_id=mCT126139.1
FT                   protein_id=mCP69174.1"
FT                   /protein_id="EDK97183.1"
FT                   /translation="MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVK
FT                   RELLRHRDYKVDLESKLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKH
FT                   QRNLGMSMRVERSTLDQVKKRFEVNKKKMEEKQKDYDFEERMKELREEEEKAKAYKKEK
FT                   QKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY"
FT   gap             20701561..20701580
FT                   /estimated_length=20
FT   gap             20739998..20740017
FT                   /estimated_length=20
FT   gap             20740252..20740271
FT                   /estimated_length=20
FT   gap             20742005..20742024
FT                   /estimated_length=20
FT   gene            20808851..>20811355
FT                   /locus_tag="mCG_124895"
FT                   /note="gene_id=mCG124895.2"
FT   mRNA            20808851..>20811355
FT                   /locus_tag="mCG_124895"
FT                   /product="mCG124895"
FT                   /note="gene_id=mCG124895.2 transcript_id=mCT126146.2
FT                   created on 23-APR-2004"
FT   CDS             20808968..>20811355
FT                   /codon_start=1
FT                   /locus_tag="mCG_124895"
FT                   /product="mCG124895"
FT                   /note="gene_id=mCG124895.2 transcript_id=mCT126146.2
FT                   protein_id=mCP69377.2"
FT                   /protein_id="EDK97184.1"
FT                   /translation="MLFSRLRGLRARRLLLFSLLFLAAWEAGSGQIHYSVPEEAKHGTF
FT                   VGRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECS
FT                   IHLEVIVDRPLQVFHVEVKVKDINDNPPVFKGAEQRIFIPENRQLDSRFPLEGAVDADV
FT                   GANSLLTYTLSPTDYFSLKVETTDELSKSLSLELRKSLDREETPELQLLLTATDGGKPE
FT                   LEGTVRLQITVLDVNDNAPLFDQAIYRAQLVESTVNGTLVTTLNATDADEGVNGEVVFS
FT                   FGNDVSLDIQEKFNVDSLSGEIRVIGDLDYEKTKSYEIQIKAVDKGTPSMSNHCKVLVK
FT                   VLDINDNAPELSITSLSLPIKEDTPLNTIIALIKVSDIDSGVNGQVTCSLTPHVPFKLV
FT                   STFKNYYSLVLDSTLDRETTADYKVVVTARDGGSPSLWATASVSVEVADVNDNAPVFAQ
FT                   PEYTVFVKENNPPGAHIFTVSAMDADAQENALVSYSLVERRVGERLLSSYVSVHAESGK
FT                   VFALQPLDHEELELLQFQVSARDAGVPALGSNVTLQVFVLDENDNPPTLLGPHAGSAVS
FT                   ELVSRTMGAGHVVTKVRAVDADSGYNAWLSYELQPPTGGARNPFRVGLYTGEISTTRSL
FT                   DEVDVPRQRLLVLVKDHGEPMLTATATVLVSLVESSPIQKASLPVLTGAVGSKASLVDV
FT                   NVYLIIAICAVSSLLVLTLLLYTALRCSATPTDGACAPGKPMLVCSSAVGSWSYSQQRR
FT                   QKVCSGEGPPKTDLMAFSPGLAPGLNIAERSDHAEVNSDLSGN"
FT   gene            20817887..>20820387
FT                   /locus_tag="mCG_140834"
FT                   /note="gene_id=mCG140834.1"
FT   mRNA            20817887..>20820387
FT                   /locus_tag="mCG_140834"
FT                   /product="mCG140834"
FT                   /note="gene_id=mCG140834.1 transcript_id=mCT171718.1
FT                   created on 23-APR-2004"
FT   CDS             20818000..>20820387
FT                   /codon_start=1
FT                   /locus_tag="mCG_140834"
FT                   /product="mCG140834"
FT                   /note="gene_id=mCG140834.1 transcript_id=mCT171718.1
FT                   protein_id=mCP94637.1"
FT                   /protein_id="EDK97185.1"
FT                   /translation="MPSLRGGPEVRQCLLLLLPFLAAWEAGNGQLHYSVPEEAKHGTFV
FT                   GRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSI
FT                   HLEVIVDRPLQVFHVEVEVRDINDNPPRFPMTEKTIQFSESRSLDSRFPLEGASDADIG
FT                   VNALLSYKLSPSELFFLDVQTSDELSQSLFLVLGKSLDREEDAEVKLLLVATDGGKPEL
FT                   TGTVQILIKVLDVNDNEPTFPQSVYKVQLLENTANGTLVMKLNASDADEGSNSEIVYSL
FT                   GSDVSSTTRTKFQIDPNSGEVRTKGELDYEERTSYEIQVIASDKGTPAMSGHCKISVKL
FT                   VDINDNTPEVSITSLSLPVQENAPLGAVIALISVSDRDSGVNGQVTCSLSPHVPFKLVS
FT                   TFKNYYSLVLDSALDREATADYKVMVTARDGGSPSLRATASVSVEVADVNDNAPVFAQP
FT                   EYTVFVKENNPPGAHIFTVSAMDADAQENALVSYSLVERRVGERLLSSYVSVHAESGKV
FT                   FALQPLDHEELELLQFQVTARDAGVPALGSNVTLQVFVLDENDNAPLLLPQGAVGVGGS
FT                   VSELVPRSVGSGHVVTKVRAVDADSGYNAWLSYELQSTVGMRSLFRVGLYTGEISTTRA
FT                   LDEVDAPRQRLLVLVKDHGEPSLTATATVLVSLVENSQAPKTSSRALVDAAGQEASLVT
FT                   VNVYLVIAICAVSSLLVLTLLLYTALRCSAMPTDGACAPGRPMLVCSSAVGSWSYSQQR
FT                   RQRVCSGEGPPKTDLMAFSPSLSQGPESAEERQPPLEAEYLGK"
FT   gene            20824779..>20827250
FT                   /gene="Pcdha3"
FT                   /locus_tag="mCG_140837"
FT                   /note="gene_id=mCG140837.1"
FT   mRNA            20824779..>20827250
FT                   /gene="Pcdha3"
FT                   /locus_tag="mCG_140837"
FT                   /product="protocadherin alpha 3"
FT                   /note="gene_id=mCG140837.1 transcript_id=mCT171721.1
FT                   created on 23-APR-2004"
FT   CDS             20824881..>20827250
FT                   /codon_start=1
FT                   /gene="Pcdha3"
FT                   /locus_tag="mCG_140837"
FT                   /product="protocadherin alpha 3"
FT                   /note="gene_id=mCG140837.1 transcript_id=mCT171721.1
FT                   protein_id=mCP94640.1"
FT                   /protein_id="EDK97186.1"
FT                   /translation="MVFSQREDRHLLLWLLLFAAWEAGSGQLHYSVPEEAKHGTFVGRI
FT                   AQDLGLELAELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLE
FT                   VIVDRPLQVFHVEVEVRDINDNPPVFPVATKNLFIYESRPLGSRFSLEGASDADIGTNS
FT                   LLSYSLNSSEYFSLDVKRKDEEIKSLGLVLKKLLNREDIPEHNLLITAVDGGKPELTGT
FT                   TQVKITVLDVNDNAPAFEKTFYKVRLPENAPNGTVVVDVDASDLDEGVNKDIVYSFHQD
FT                   MSLEILSKFHLDPISGYITVKGNIDFEETKSFEIQIEAADKGTPPMTDHCTVLVEIVDV
FT                   NDNVPELVIKSLSLPVLENSAPSTVIALISVSDRDSGANGQVTCSLTPQVPFKLVSTFK
FT                   NYYSLVLDSVLDRETISNYNVVVTARDGGSPSLCTTASVSVEVADVNDNAPAFAQPEYT
FT                   VFVKENNPPGAHIFTVSAMDADAQENALVSYSLVERRVGERLLSSYVSVHAESGKVFAL
FT                   QPLDHEELELLQFQVSARDAGVPALGSNVTLQVFVLDENDNAPTLLGPHAGSAVSELVS
FT                   RTVGAGHVVTKVRAVDADSGYNAWLSYELQSAAGSGRLPFRVGLYTGEISTTRVLDETD
FT                   APRQRLLVLVKDHGEPVLTATATLLVSLVESGHTPNTPSRTLVDSAGREASLVDINVYL
FT                   IIAICAVSSLLVLTLLLYLALRCSTAPTEGGPGKPMLVCSSAVGTWSYSQQRRQRVCSG
FT                   EGPPKTDLMAFSPSLTPCPVNQDKEDKLVGDIDFSIK"
FT   gene            20831332..>20833824
FT                   /locus_tag="mCG_140838"
FT                   /note="gene_id=mCG140838.1"
FT   mRNA            20831332..>20833824
FT                   /locus_tag="mCG_140838"
FT                   /product="mCG140838"
FT                   /note="gene_id=mCG140838.1 transcript_id=mCT171722.1
FT                   created on 23-APR-2004"
FT   CDS             20831440..>20833824
FT                   /codon_start=1
FT                   /locus_tag="mCG_140838"
FT                   /product="mCG140838"
FT                   /note="gene_id=mCG140838.1 transcript_id=mCT171722.1
FT                   protein_id=mCP94641.1"
FT                   /protein_id="EDK97187.1"
FT                   /translation="MEFSWGSGQESQRLLLSFLLLAIWEAGNSQIHYSIPEEAKHGTFV
FT                   GRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSI
FT                   HLEVIVDRPLQVFHVEVEVRDINDNPPRFPTTQKNLFIAESRPLDTWFPLEGASDADIG
FT                   INAVLTYRLSPNDYFSLEKPSNDERVKGLGLVLRKSLDREETPEIILVLTVTDGGKPEL
FT                   TGSVQLLITVLDANDNAPVFDRSLYTVKLPENVPNGTLVVKVNASDLDEGVNGDIMYSF
FT                   STDISPNVKYKFHIDPVSGEIIVKGYIDFEECKSYEILIEGIDKGQLPLSGHCKVIVQV
FT                   EDINDNVPELEFKSLSLPIRENSPVGTVIALISVSDRDTGVNGQVTCSLTSHVPFKLVS
FT                   TFKNYYSLVLDSALDRETTADYKVVVTARDGGSPSLWATASVSVEVADVNDNAPVFAQP
FT                   EYTVFVKENNPPGAHIFTVSAMDADAQENALVSYSLVERRVGERLLSSYVSVHAESGKV
FT                   FALQPLDHEELELLRFQVSARDAGVPALGSNVTLQVFVLDENDNAPTLLEPEAGVSGGI
FT                   VSRLVSRSVGAGHVVAKVRAVDADSGYNAWLSYELQSSEGNSRSLFRVGLYTGEISTTR
FT                   ILDEADSPRQRLLVLVKDHGDPAMIVTATVLVSLVENGPVPKAPSRVSTSVTHSEASLV
FT                   DVNVYLIIAICAVSSLLVLTLLLYTALRCSTVPSESVCGPPKPVMVCSSAVGSWSYSQQ
FT                   RRQRVCSGEYPPKTDLMAFSPSLSDSRDREDQLQSAEDSSGK"
FT   gene            20838989..>20841475
FT                   /locus_tag="mCG_140839"
FT                   /note="gene_id=mCG140839.1"
FT   mRNA            20838989..>20841475
FT                   /locus_tag="mCG_140839"
FT                   /product="mCG140839"
FT                   /note="gene_id=mCG140839.1 transcript_id=mCT171723.1
FT                   created on 23-APR-2004"
FT   CDS             20839130..>20841475
FT                   /codon_start=1
FT                   /locus_tag="mCG_140839"
FT                   /product="mCG140839"
FT                   /note="gene_id=mCG140839.1 transcript_id=mCT171723.1
FT                   protein_id=mCP94642.1"
FT                   /protein_id="EDK97188.1"
FT                   /translation="MVYFQRGSPGFRRLLISFVLLAAWEAGSGQLHYSIPEEAKHGTFV
FT                   GRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSI
FT                   HLEVIVDRPLQVFHVEVEVKDINDNPPKFSRPEQRLFILESRMPDSRFPVEGASDLDIG
FT                   ANAALSYKINPNEYFDLDVKRNEEETSVLQLVLKKPLDREETQEHRLLLIAIDGGKPEL
FT                   TGTVQLLIDVLDANDNAPEFDKSIYNVRLLENTPNGTLVIKLNASDADEGINKEILYFF
FT                   SNLVLDDVKSKFTIDSSSGEIKVKGELDYEDCKVYEINIDAVDRSAFPLAGHCKIIVKL
FT                   VDVNDNVPEMAITSIFLPIKEDAPLATVIALISVSDRDSGANGQVTCSLTPHIPFKLVS
FT                   TFKNYYSLVLDRALDRETIANYDVVVTARDGGSPSLWATASVSVEVADVNDNVPAFAQP
FT                   EYTVFVKENNPPGAHIFTVSAMDADAQENALVSYSLVERRVGERLLSSYVSVHAESGKV
FT                   FALQPLDHEELELLQFQVSARDAGVPALGSNVTLQVFVLDENDNAPTLLGPQGSGGTIE
FT                   LLSRSVSSGHVVAKVRAVDADSGYNAWLSYELQPATGAVRSPFRVGLYTGEISTTRVLD
FT                   EADMPRQRLLVLVKDHGEPPLTATATFLVSLVENSQTPKVSSRVLVGTSGSDSTLIDVN
FT                   VYLIIAICAVSSLLVLTLLLYTAIRCSATPTDGACAPGKPVLVCSSAVGTWSYSQQRRQ
FT                   RVCSGEGPPKTDLMAFSPSLPQGPSSTEN"
FT   gene            20846317..>20848825
FT                   /locus_tag="mCG_140840"
FT                   /note="gene_id=mCG140840.1"
FT   mRNA            20846317..>20848825
FT                   /locus_tag="mCG_140840"
FT                   /product="mCG140840"
FT                   /note="gene_id=mCG140840.1 transcript_id=mCT171724.1
FT                   created on 23-APR-2004"
FT   CDS             20846444..>20848825
FT                   /codon_start=1
FT                   /locus_tag="mCG_140840"
FT                   /product="mCG140840"
FT                   /note="gene_id=mCG140840.1 transcript_id=mCT171724.1
FT                   protein_id=mCP94643.1"
FT                   /protein_id="EDK97189.1"
FT                   /translation="MDFTTEGRLGTRCMLLSLLLLAAWEAGSGQLHYSVPEEAKHGTFV
FT                   GRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSVECSI
FT                   HLEVIVDRPLQVFHVEVEVRDINDNPPVFSVKEQRMLIYESRLPDSLFPLEGASDADVG
FT                   LNSMLTYKLSPSEYFGLDVKSNSDGNKQIRLLLKKSLDREDAPEHKLLLTATDGGKPEL
FT                   TGSVQLLVTVLDVNDNAPTFQHPEYEVRILENSDNGTTVIRLNASDKDEGTNSAISYSF
FT                   NRLVPPKTLEQFSIDADTGEIITQGNLDFEQVDVYKIHVDATDKGHPPMVGHCTVLVKV
FT                   LDENDNVPQITLTSLSLPVREDAALSTVIALISVSDLDSGSNGQVTCSLSPHVPFKLVS
FT                   TFKNYYSLVLDSALDRETTADYQVVVTARDGGSPSLWTTASVSVEVADVNDNAPSFAQP
FT                   DYTVFVKENNPPGAHIFTVSAMDADAQENALVSYSLVERRVGERLLSSYVSVHAESGKV
FT                   FALQPLDHEELELLQFQVSARDAGVPALGSNVTLQVFVLDENDNAPTLLGPWTPGSGGV
FT                   VSELVSPSVGAGQVVTKVRAVDADSGYNAWLSYELHPLAGGTRSLFRVGLYTGEISTTR
FT                   ALEEADAPRHRLLVLVKDHGEPALIATATVLVSLVENSQTPKASSRAQGATGQEVSLVN
FT                   VNVYLIIAICAVSSLLVLTLMVYTALRCSVPPTEGVCGAGKPVLVCSSAVGSWSYSQQR
FT                   RQKVCSGEGPPKTDLMAFSPSLPPCPVVGEHQDLNDDHCSR"
FT   gene            20852492..>20854968
FT                   /locus_tag="mCG_140841"
FT                   /note="gene_id=mCG140841.1"
FT   mRNA            20852492..>20854968
FT                   /locus_tag="mCG_140841"
FT                   /product="mCG140841"
FT                   /note="gene_id=mCG140841.1 transcript_id=mCT171725.1
FT                   created on 23-APR-2004"
FT   CDS             20852587..>20854968
FT                   /codon_start=1
FT                   /locus_tag="mCG_140841"
FT                   /product="mCG140841"
FT                   /note="gene_id=mCG140841.1 transcript_id=mCT171725.1
FT                   protein_id=mCP94644.1"
FT                   /protein_id="EDK97190.1"
FT                   /translation="MRIKRQQFEMVNLRGYNWKSQQLLLFLIIVAAWEAGSGQLHYSVP
FT                   EEAKHGTFVGRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREEL
FT                   CGRSAECSIHLEVIVDRPLQVFHVEVEVKDINDNPPMFPATQKALFILESRLLDSRFPL
FT                   EGASDADVGSNALLTYRLSTNEHFSLDVPPNHEQVKPLGLVLRKPLDREEAAEIRLLLT
FT                   ATDGGKPELTGTVQLLITVLDVNDNAPVFDRSLYTVKLPENVPNGTLVIKVNASDLDEG
FT                   VNGDVMYSFSSDVSSDIKSKFHMDTVSGEITVIGIIDFEESKAYKIPLEARDKGFPQLP
FT                   GHCTILVEVVDANDNAPQLTVSSLSLPVSEDSQPGRVVTLISVFDRDSGANGQVTCSLT
FT                   PHIPFKLVSTFKNYYSLVLDSALDRETIANYDVIVTARDGGSPSLWATASVSVEVADVN
FT                   DNAPLFAQPEYTVFVKENNPPGAHIFTVSAMDADAQENALVSYSLVERRVGERLLSSYV
FT                   SVHAESGKVFALQPLDHEELELLQFQVSARDAGVPALGSNVTLQVFVLDENDNAPTLLG
FT                   PLANGVGGTMNEVVSRALVPGQVVAKVRAVDEDSGYNAWLSFELQPVAGGVRSPFRVGL
FT                   YTGEISTTRALEETDALRQCLLVLVKDHGEPSLTATATVLLSLVDSGQTQKVSSKVSAG
FT                   ASRVDQRLVDVNVYLIIAICAVSSLLVLTLLLYTALRCSATPTDGACAPGKPMLVCSSA
FT                   VGSWSYSQQRRQRVCSGEGPPKTDLMAFSPSLPQGPSSTDN"
FT   gene            20858747..20868265
FT                   /pseudo
FT                   /locus_tag="mCG_1050347"
FT                   /note="gene_id=mCG1050347.0"
FT   mRNA            join(20858747..20860220,20867343..20868265)
FT                   /pseudo
FT                   /locus_tag="mCG_1050347"
FT                   /note="gene_id=mCG1050347.0 transcript_id=mCT194353.0
FT                   created on 23-APR-2004"
FT   gene            20871017..20873529
FT                   /locus_tag="mCG_140836"
FT                   /note="gene_id=mCG140836.1"
FT   mRNA            20871017..20873529
FT                   /locus_tag="mCG_140836"
FT                   /product="mCG140836"
FT                   /note="gene_id=mCG140836.1 transcript_id=mCT171720.1
FT                   created on 23-APR-2004"
FT   CDS             20871149..20871715
FT                   /codon_start=1
FT                   /locus_tag="mCG_140836"
FT                   /product="mCG140836"
FT                   /note="gene_id=mCG140836.1 transcript_id=mCT171720.1
FT                   protein_id=mCP94639.1"
FT                   /protein_id="EDK97191.1"
FT                   /translation="MLCLGGAVPDDQLLVLSLLLIAVWEVGSGQLHYSIPEEAKHGTFV
FT                   GRIAQDLELQLPELVPGLFQLDSKGFGDLLEVNLQNGILFVNSRIDREELCGRSAECSI
FT                   HLEVIVDRPLQVFHVEVEVRDINDNPPMFPATQKALFIPESRLLDSRFPLEGASDADVG
FT                   SNALLTYRLSTNEHSLWMYRPTTSR"
FT   gene            <20876564..>20879044
FT                   /locus_tag="mCG_140842"
FT                   /note="gene_id=mCG140842.1"
FT   mRNA            <20876564..>20879044
FT                   /locus_tag="mCG_140842"
FT                   /product="mCG140842"
FT                   /note="gene_id=mCG140842.1 transcript_id=mCT171726.1
FT                   created on 23-APR-2004"
FT   CDS             20876564..>20879044
FT                   /codon_start=1
FT                   /locus_tag="mCG_140842"
FT                   /product="mCG140842"
FT                   /note="gene_id=mCG140842.1 transcript_id=mCT171726.1
FT                   protein_id=mCP94645.1"
FT                   /protein_id="EDK97192.1"
FT                   /translation="MRLGNRPEDIRTCVHLRWHIHGLLRQENASVVISKCLRHGAWRLL
FT                   LWLLLLATWDVGSGQLHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRVVSKDRGDL
FT                   LEVNLQNGILFVNSRIDREELCGQNAECSIHLEVIVDRPLQVFHVEVEVRDINDNPPIF
FT                   SVAEQKILVAESRLLDSRFPLEGASDADVGENSMLTYKLSSNEFFILDIVNKRGKGKFP
FT                   VLVLRKLIDREENPQLKLLLTATDGGKPEFTGSVSLLIQVLDVNDNAPVFDRSVYEVKM
FT                   YENQENKTLVIWLNATDSDEGINKEVEYSFSSLASSIIRQKFLINEKTGEIKINGAIDF
FT                   EESNNYEIHVDATDKGYPPMVAHCTVLVEILDENDNAPEIVLTSLSLPVKEDAPLGSVI
FT                   ALISVSDKDSGVNGQVTCSLTNHVPFKLVSTFKNYYSLVLDSALDRETTADYKVVVTAR
FT                   DGGSPSLWATASVSVEVADVNDNAPAFAHPEYTVFVKENNPPGVHIFTVLAVDADAQEN
FT                   ALVSYSLVERRVGERLLSSYVSVHAESGKVFALQPLDHEELELLQFQVSARDAGVPALG
FT                   SNVTLQVFVQDENDNPPTLLGHQSGGPAGEFSQLVSRSVGAGHVVSKVRAVDADSGYNA
FT                   WLSYELHPTVGARSPFRVGLYTGEISMTRALDESDLPRQRLLVLVKDHGEPMLIATATV
FT                   LVSLVENGQVPKASSQGLPNSSRREASLMDVNVYLIIAICAVSSLLVLTLLLYTALRCS
FT                   AVPMQAGCGLGKPTLVCSSAVGTWSYSQQRQQRVCSGEGPPKTDLMAFSPSLTPCPVAE
FT                   VGMESHSVGGDVPGK"
FT   gene            20883852..>20886385
FT                   /locus_tag="mCG_140843"
FT                   /note="gene_id=mCG140843.1"
FT   mRNA            20883852..>20886385
FT                   /locus_tag="mCG_140843"
FT                   /product="mCG140843"
FT                   /note="gene_id=mCG140843.1 transcript_id=mCT171727.1
FT                   created on 23-APR-2004"
FT   CDS             20884004..>20886385
FT                   /codon_start=1
FT                   /locus_tag="mCG_140843"
FT                   /product="mCG140843"
FT                   /note="gene_id=mCG140843.1 transcript_id=mCT171727.1
FT                   protein_id=mCP94646.1"
FT                   /protein_id="EDK97193.1"
FT                   /translation="MSCVAMKYCHESWCLLLSLLLFAIWEPGSGQLRYSVPEEAKHGTF
FT                   VGRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECS
FT                   IHLEVIVDRPLQVFHVEVEVRDINDNPPVFPTTEKNLFVSESRALDSHFSLEGASDADI
FT                   GTNALLTYRLSPSEYFSLEVPTTDELVKPLQLVLKKPLDRERASELHLVVKATDGGKPE
FT                   LTGTLELHITVLDANDNAPAFDRAIYRVKLVENARNGTVVIRLNASDLDEGSNGQILYS
FT                   FAADVSPKTEATFHIDSVSGEIKVNGKIDFEETNLWKIQAEAVDKGSPPMFGHCTILIE
FT                   VLDINDNAPKIIVTSLSLPVQEDAPVGTVIALISVMDPDSTVNGQVTCSLSPHVPFKLV
FT                   STFKNYYSLVLDSALDRETTADYKVVVTARDGGSPALWATASVSVEVADVNDNAPAFAQ
FT                   SEYTVFVKENNPPGVHVFTVLAMDADAQENALVSYSLVERRVGERLLSSYVSVHAESGK
FT                   VFALQPLDHEELELLQFQVTAKDAGVPALGSNVTLQVFVLDENDNAPTLLPHGAVGAGG
FT                   AVSELVPRSVGSGHVVAKVRAVDADSGYNAWLSYELQFRAGSVRSPFRVGLYTGEISIT
FT                   RALDEADAPRQRLLVLVKDHGEPALTATATVLVSLVESNQAPKASSRVLGPAASESSVV
FT                   DVNVYLIIAICAVSSLLVLTLVLYTALRCSALPTEVTCGPGKPMLVCSSAVGSWSYSQQ
FT                   RRQRVCSGEGPPKTDLMAFSPSVPPGLGSGDSGVQQEIFEN"
FT   gene            20889392..>20891961
FT                   /locus_tag="mCG_140844"
FT                   /note="gene_id=mCG140844.1"
FT   mRNA            20889392..>20891961
FT                   /locus_tag="mCG_140844"
FT                   /product="mCG140844"
FT                   /note="gene_id=mCG140844.1 transcript_id=mCT171728.1
FT                   created on 23-APR-2004"
FT   CDS             20889539..>20891961
FT                   /codon_start=1
FT                   /locus_tag="mCG_140844"
FT                   /product="mCG140844"
FT                   /note="gene_id=mCG140844.1 transcript_id=mCT171728.1
FT                   protein_id=mCP94647.1"
FT                   /protein_id="EDK97194.1"
FT                   /translation="MLSFQRRGSCTLPPLRWLLLLAAWEAGSGQLHYSIPEEAKHGTFV
FT                   GRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSI
FT                   HLEVIVDRPLQVFHVEVEVRDINDNPPVFPLREQRLLISESKQPDSRFPLEGASDADIG
FT                   ENAVLVYRLSQNEYFSLEPPINSKQTKRPSLILKKVLDREKTPELNLLLTATDGGKPEL
FT                   TGTVQLWVRVLDVNDNDPVFDHLEYKVRIMENAAKETLVITLNATDLDEGANGQLVYSL
FT                   MSIKPTGRHLFTLDEKNGELRVNGTLDYEENKLYEIEVLATDKGTPPMVGHCVVLVEIL
FT                   DTNDNSPEVTLTSLSLPVREDAQPNTVIALISVSDLDSGINGQVTCSLTPNVPFKIVST
FT                   FKNYYSLVLDSSLDRERVSTYDLVVIARDGGSPSLSATVSVSVEVADVNDNAPVFAQPE
FT                   YTVFVKENNPPGAHIFTVSAMDADAQENALVSYSLVERRVGERLLSSYVSVHAESGKVF
FT                   ALQPLDHEELELLQFQVSARDAGVPALGSNVTLQVFVLDENDNAPTLLPHGAVGAGGAV
FT                   SELVSRSVGSGHVVTKVRAVDADSGYNAWLSYEVQLGTGGVRSPFRVGLYTGEISTTRA
FT                   LDEVDSPRQTLLVLVKDHGEPALTATATVLVSLVESGQAPKSFSQASGRASAPEASLVD
FT                   VNVYLIIAICAVSSLLVLTLLLYTALRCSALPMVNEATGGPGKPMLVCSSEVGSWSYSQ
FT                   QRRQRVCSGEVLPKTDLMAFSPSLPPNLGRDERERQESESSHPGQVSFLQIPLF"
FT   gene            20892737..20893091
FT                   /pseudo
FT                   /locus_tag="mCG_1050348"
FT                   /note="gene_id=mCG1050348.1"
FT   mRNA            20892737..20893091
FT                   /pseudo
FT                   /locus_tag="mCG_1050348"
FT                   /note="gene_id=mCG1050348.1 transcript_id=mCT194354.1
FT                   created on 04-JUN-2004"
FT   gene            20898710..>20901292
FT                   /locus_tag="mCG_140835"
FT                   /note="gene_id=mCG140835.1"
FT   mRNA            20898710..>20901292
FT                   /locus_tag="mCG_140835"
FT                   /product="mCG140835"
FT                   /note="gene_id=mCG140835.1 transcript_id=mCT171719.1
FT                   created on 23-APR-2004"
FT   CDS             20898899..>20901292
FT                   /codon_start=1
FT                   /locus_tag="mCG_140835"
FT                   /product="mCG140835"
FT                   /note="gene_id=mCG140835.1 transcript_id=mCT171719.1
FT                   protein_id=mCP94638.1"
FT                   /protein_id="EDK97195.1"
FT                   /translation="MLLFSQSGPGSRCLLLSFLLLTTWEAGSGQLHYSIPEEAKHGTFV
FT                   GRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSLECSI
FT                   HLEVIVDRPLQVFHVEVEVRDINDNPPVFPETNKNIVIAESRPPETRFPLDGASDADIG
FT                   VNSALTYRLDPSDYFALDTQNNRERTSSLSLVLKKSLDREEIQEYSLLLTASDGGKPEL
FT                   TGTVQLLITILDVNDNAPEFDRFVYKVKVLEDALNGTLVINLNATDPDEGINGDIIYSF
FT                   RRPVSPAVVHAFNIDSNSGEVRTKGLLDFEEIKLYEIPVEAVDKGNIPMTGHCTLLVEL
FT                   LDVNDNAPEVTITSLSLPVREDAQPSTVIALVSVSDRDSGDNGQVTCSLTPHLPFKLVS
FT                   TFKNYYSLVLDSALDRETTADYKVVVTARDRGSPSLWSTASVSVEVADVNDNAPAFAQP
FT                   EYTVFVKENNPPGAHIFTVSAMDADAQENALVSYSLVERRVGERLLSSYVSVHAESGKV
FT                   FALQPLDHEELELLQFQVSARDAGVPSLGSNVTLQVFVLDENDNAPTLLPHRAVGAVGT
FT                   VSELVPRSVGSGHVVAKVRAVDADSGYNAWLSYELQLAAGGMRSPFRVGLYTGEISTTR
FT                   SLDEADAPRQRLLVLVKDHGEPALTATATVLVSLVENGQAPKISSLASESTASSEASLV
FT                   TVNVYLIIAICAVSSLLVITLLLYTALRCSARSTDGACAPGKPMLVCSSAVGSWSYSQQ
FT                   RRQRVCSGEGPPKTDLMAFSPSLPPVLGSAEDTCQRERQVEHLKE"
FT   gap             20901904..20901923
FT                   /estimated_length=20
FT   gap             20911198..20911217
FT                   /estimated_length=20
FT   gap             20915237..20915343
FT                   /estimated_length=107
FT   gap             20917783..20917998
FT                   /estimated_length=216
FT   gene            20951754..20953495
FT                   /pseudo
FT                   /locus_tag="mCG_145677"
FT                   /note="gene_id=mCG145677.0"
FT   mRNA            20951754..20953495
FT                   /pseudo
FT                   /locus_tag="mCG_145677"
FT                   /note="gene_id=mCG145677.0 transcript_id=mCT185103.0
FT                   created on 04-JUN-2003"
FT   gene            <20961889..>20962261
FT                   /locus_tag="mCG_1031860"
FT                   /note="gene_id=mCG1031860.1"
FT   mRNA            <20961889..>20962261
FT                   /locus_tag="mCG_1031860"
FT                   /product="mCG1031860"
FT                   /note="gene_id=mCG1031860.1 transcript_id=mCT149564.0
FT                   created on 06-JUN-2002"
FT   CDS             20961889..>20962261
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031860"
FT                   /product="mCG1031860"
FT                   /note="gene_id=mCG1031860.1 transcript_id=mCT149564.0
FT                   protein_id=mCP69325.0"
FT                   /protein_id="EDK97196.1"
FT                   /translation="MVGWGMAVLCWWVSCGAAAGQLEYSVLEETEPGVTVGNIASDLKL
FT                   SAAVLSLRNFRFLSNYRESYFGVDLGSGSLVVQELADREQLCPAKASCILTYELMFEDP
FT                   LELHKIRVHLLDTNDNSPLF"
XX
CO   join(AAHY01136740.1:1..55186,gap(20),AAHY01136741.1:1..17726,gap(66),
CO   AAHY01136742.1:1..43071,gap(20),AAHY01136743.1:1..28967,gap(30),
CO   complement(AAHY01136744.1:1..4924),gap(314),
CO   complement(AAHY01136745.1:1..2023),gap(20),AAHY01136746.1:1..37793,gap(20),
CO   AAHY01136747.1:1..40328,gap(20),AAHY01136748.1:1..1193,gap(20),
CO   complement(AAHY01136749.1:1..1077),gap(20),AAHY01136750.1:1..77995,gap(20),
CO   complement(AAHY01136751.1:1..35812),gap(145),
CO   complement(AAHY01136752.1:1..2111),gap(456),
CO   complement(AAHY01136753.1:1..25723),gap(46),
CO   complement(AAHY01136754.1:1..3781),gap(20),AAHY01136755.1:1..16185,
CO   gap(201),AAHY01136756.1:1..9779,gap(20),AAHY01136757.1:1..30709,gap(1277),
CO   AAHY01136758.1:1..6397,gap(83),complement(AAHY01136759.1:1..5120),gap(20),
CO   AAHY01136760.1:1..14197,gap(101),AAHY01136761.1:1..3269,gap(117),
CO   AAHY01136762.1:1..21522,gap(20),AAHY01136763.1:1..16806,gap(20),
CO   complement(AAHY01136764.1:1..8803),gap(20),AAHY01136765.1:1..10072,
CO   gap(1895),AAHY01136766.1:1..997,gap(20),AAHY01136767.1:1..1230,gap(710),
CO   AAHY01136768.1:1..3200,gap(20),AAHY01136769.1:1..1344,gap(20),
CO   AAHY01136770.1:1..2501,gap(20),AAHY01136771.1:1..4417,gap(20),
CO   complement(AAHY01136772.1:1..1459),gap(20),AAHY01136773.1:1..29970,
CO   gap(508),AAHY01136774.1:1..1084,gap(126),
CO   complement(AAHY01136775.1:1..13087),gap(134),AAHY01136776.1:1..7938,
CO   gap(122),AAHY01136777.1:1..78163,gap(1194),AAHY01136778.1:1..49051,gap(20),
CO   AAHY01136779.1:1..17618,gap(500),AAHY01136780.1:1..18992,gap(575),
CO   AAHY01136781.1:1..13814,gap(140),AAHY01136782.1:1..445,gap(34),
CO   AAHY01136783.1:1..106604,gap(675),AAHY01136784.1:1..15710,gap(20),
CO   complement(AAHY01136785.1:1..3576),gap(20),AAHY01136786.1:1..15451,
CO   gap(2901),AAHY01136787.1:1..20372,gap(2861),AAHY01136788.1:1..19015,
CO   gap(20),AAHY01136789.1:1..32864,gap(20),complement(AAHY01136790.1:1..9791),
CO   gap(20),AAHY01136791.1:1..60654,gap(20),AAHY01136792.1:1..29579,gap(207),
CO   AAHY01136793.1:1..19451,gap(20),AAHY01136794.1:1..8059,gap(20),
CO   AAHY01136795.1:1..48567,gap(147),AAHY01136796.1:1..125904,gap(20),
CO   complement(AAHY01136797.1:1..5125),gap(225),AAHY01136798.1:1..15426,
CO   gap(116),complement(AAHY01136799.1:1..21814),gap(20),
CO   complement(AAHY01136800.1:1..29218),gap(20),
CO   complement(AAHY01136801.1:1..2098),gap(4912),AAHY01136802.1:1..1704,
CO   gap(27470),AAHY01136803.1:1..1139,gap(20),
CO   complement(AAHY01136804.1:1..1022),gap(20),AAHY01136805.1:1..4022,gap(20),
CO   AAHY01136806.1:1..1396,gap(3012),AAHY01136807.1:1..9101,gap(683),
CO   AAHY01136808.1:1..1490,gap(676),AAHY01136809.1:1..31469,gap(1229),
CO   AAHY01136810.1:1..3228,gap(89),AAHY01136811.1:1..16135,gap(30),
CO   AAHY01136812.1:1..7192,gap(8305),complement(AAHY01136813.1:1..1116),
CO   gap(20),AAHY01136814.1:1..3137,gap(610),complement(AAHY01136815.1:1..2958),
CO   gap(603),AAHY01136816.1:1..4025,gap(805),
CO   complement(AAHY01136817.1:1..13294),gap(309),
CO   complement(AAHY01136818.1:1..9720),gap(20),AAHY01136819.1:1..51659,gap(92),
CO   AAHY01136820.1:1..2135,gap(20),AAHY01136821.1:1..1221,gap(20),
CO   AAHY01136822.1:1..20089,gap(36),AAHY01136823.1:1..1703,gap(20),
CO   AAHY01136824.1:1..1582,gap(1612),AAHY01136825.1:1..28044,gap(3599),
CO   AAHY01136826.1:1..2789,gap(43),AAHY01136827.1:1..13833,gap(25),
CO   AAHY01136828.1:1..1529,gap(20),AAHY01136829.1:1..97671,gap(20),
CO   AAHY01136830.1:1..7264,gap(20),AAHY01136831.1:1..4318,gap(7256),
CO   AAHY01136832.1:1..48046,gap(153),AAHY01136833.1:1..6482,gap(20),
CO   AAHY01136834.1:1..3745,gap(20),AAHY01136835.1:1..15463,gap(320),
CO   complement(AAHY01136836.1:1..2271),gap(46),AAHY01136837.1:1..26093,gap(20),
CO   AAHY01136838.1:1..10714,gap(2325),AAHY01136839.1:1..5740,gap(1008),
CO   AAHY01136840.1:1..11556,gap(20),AAHY01136841.1:1..15824,gap(20),
CO   AAHY01136842.1:1..44817,gap(20),AAHY01136843.1:1..65953,gap(20),
CO   AAHY01136844.1:1..30458,gap(299),complement(AAHY01136845.1:1..3334),
CO   gap(20),AAHY01136846.1:1..49216,gap(2219),
CO   complement(AAHY01136847.1:1..691),gap(315),AAHY01136848.1:1..2509,gap(172),
CO   AAHY01136849.1:1..11601,gap(217),AAHY01136850.1:1..6408,gap(20),
CO   AAHY01136851.1:1..26192,gap(241),AAHY01136852.1:1..29848,gap(504),
CO   AAHY01136853.1:1..1983,gap(4092),AAHY01136854.1:1..41640,gap(428),
CO   AAHY01136855.1:1..44518,gap(20),AAHY01136856.1:1..38328,gap(20),
CO   AAHY01136857.1:1..13538,gap(20),AAHY01136858.1:1..12292,gap(20),
CO   AAHY01136859.1:1..1017,gap(20),complement(AAHY01136860.1:1..1569),gap(20),
CO   AAHY01136861.1:1..159846,gap(94),complement(AAHY01136862.1:1..13288),
CO   gap(20),complement(AAHY01136863.1:1..4253),gap(20),AAHY01136864.1:1..26171,
CO   gap(20),AAHY01136865.1:1..1355,gap(20),complement(AAHY01136866.1:1..4793),
CO   gap(20),complement(AAHY01136867.1:1..43646),gap(465),
CO   complement(AAHY01136868.1:1..1666),gap(4592),AAHY01136869.1:1..138251,
CO   gap(20),AAHY01136870.1:1..10941,gap(681),AAHY01136871.1:1..8335,gap(56),
CO   AAHY01136872.1:1..1321,gap(2489),AAHY01136873.1:1..5107,gap(20),
CO   AAHY01136874.1:1..100775,gap(216),AAHY01136875.1:1..22956,gap(220),
CO   AAHY01136876.1:1..4589,gap(20),AAHY01136877.1:1..3965,gap(250),
CO   AAHY01136878.1:1..2017,gap(880),AAHY01136879.1:1..3733,gap(300),
CO   AAHY01136880.1:1..3945,gap(1815),AAHY01136881.1:1..7296,gap(20),
CO   complement(AAHY01136882.1:1..35933),gap(564),
CO   complement(AAHY01136883.1:1..1424),gap(508),
CO   complement(AAHY01136884.1:1..12720),gap(20),AAHY01136885.1:1..38464,
CO   gap(20),AAHY01136886.1:1..29068,gap(604),
CO   complement(AAHY01136887.1:1..17151),gap(20),
CO   complement(AAHY01136888.1:1..11077),gap(20),
CO   complement(AAHY01136889.1:1..4175),gap(614),AAHY01136890.1:1..4602,gap(20),
CO   complement(AAHY01136891.1:1..25418),gap(20),
CO   complement(AAHY01136892.1:1..3464),gap(107),
CO   complement(AAHY01136893.1:1..4104),gap(308),
CO   complement(AAHY01136894.1:1..16016),gap(507),AAHY01136895.1:1..4869,
CO   gap(20),AAHY01136896.1:1..33541,gap(20),AAHY01136897.1:1..19287,gap(5402),
CO   AAHY01136898.1:1..17679,gap(2624),AAHY01136899.1:1..57628,gap(3530),
CO   AAHY01136900.1:1..72484,gap(41),AAHY01136901.1:1..68744,gap(20),
CO   AAHY01136902.1:1..14780,gap(95),AAHY01136903.1:1..2899,gap(200),
CO   AAHY01136904.1:1..11382,gap(20),complement(AAHY01136905.1:1..4454),gap(62),
CO   complement(AAHY01136906.1:1..8902),gap(338),AAHY01136907.1:1..940,gap(926),
CO   AAHY01136908.1:1..19892,gap(5332),complement(AAHY01136909.1:1..2528),
CO   gap(20),AAHY01136910.1:1..47480,gap(5825),AAHY01136911.1:1..8073,gap(368),
CO   AAHY01136912.1:1..19891,gap(20),AAHY01136913.1:1..10438,gap(20),
CO   AAHY01136914.1:1..49951,gap(1612),complement(AAHY01136915.1:1..3530),
CO   gap(31),AAHY01136916.1:1..3207,gap(159),AAHY01136917.1:1..3824,gap(97),
CO   complement(AAHY01136918.1:1..3837),gap(201),AAHY01136919.1:1..42063,
CO   gap(20),AAHY01136920.1:1..2327,gap(400),AAHY01136921.1:1..16129,gap(20),
CO   AAHY01136922.1:1..2409,gap(20),AAHY01136923.1:1..4192,gap(93),
CO   AAHY01136924.1:1..14219,gap(20),complement(AAHY01136925.1:1..18617),
CO   gap(20),AAHY01136926.1:1..7220,gap(554),AAHY01136927.1:1..21693,gap(20),
CO   AAHY01136928.1:1..3343,gap(20),AAHY01136929.1:1..1247,gap(20),
CO   AAHY01136930.1:1..25611,gap(1004),AAHY01136931.1:1..7421,gap(81),
CO   complement(AAHY01136932.1:1..10642),gap(133),AAHY01136933.1:1..28959,
CO   gap(20),AAHY01136934.1:1..11527,gap(443),
CO   complement(AAHY01136935.1:1..1352),gap(747),AAHY01136936.1:1..21002,
CO   gap(597),AAHY01136937.1:1..18413,gap(586),
CO   complement(AAHY01136938.1:1..99828),gap(47),AAHY01136939.1:1..79705,
CO   gap(595),AAHY01136940.1:1..22815,gap(1251),AAHY01136941.1:1..86052,gap(20),
CO   AAHY01136942.1:1..16243,gap(1316),AAHY01136943.1:1..12236,gap(431),
CO   complement(AAHY01136944.1:1..1656),gap(1275),AAHY01136945.1:1..2080,
CO   gap(20),complement(AAHY01136946.1:1..25531),gap(56),
CO   AAHY01136947.1:1..38199,gap(77),complement(AAHY01136948.1:1..3670),gap(20),
CO   AAHY01136949.1:1..47964,gap(362),complement(AAHY01136950.1:1..13995),
CO   gap(20),AAHY01136951.1:1..6288,gap(20),complement(AAHY01136952.1:1..44658),
CO   gap(20),AAHY01136953.1:1..3179,gap(22),AAHY01136954.1:1..8795,gap(20),
CO   AAHY01136955.1:1..2494,gap(20),AAHY01136956.1:1..11747,gap(2586),
CO   AAHY01136957.1:1..34750,gap(20),AAHY01136958.1:1..1986,gap(20),
CO   AAHY01136959.1:1..16939,gap(990),complement(AAHY01136960.1:1..2178),
CO   gap(20),AAHY01136961.1:1..1286,gap(20),complement(AAHY01136962.1:1..1287),
CO   gap(2951),complement(AAHY01136963.1:1..10543),gap(85),
CO   AAHY01136964.1:1..8238,gap(1446),AAHY01136965.1:1..7210,gap(100),
CO   AAHY01136966.1:1..5943,gap(20),AAHY01136967.1:1..56161,gap(20),
CO   AAHY01136968.1:1..43308,gap(31),AAHY01136969.1:1..6545,gap(990),
CO   complement(AAHY01136970.1:1..3111),gap(256),AAHY01136971.1:1..9704,
CO   gap(229),AAHY01136972.1:1..6760,gap(477),AAHY01136973.1:1..12192,gap(20),
CO   AAHY01136974.1:1..6443,gap(20),complement(AAHY01136975.1:1..1411),gap(20),
CO   AAHY01136976.1:1..1480,gap(20),AAHY01136977.1:1..2332,gap(20),
CO   AAHY01136978.1:1..10717,gap(1218),complement(AAHY01136979.1:1..1339),
CO   gap(20),AAHY01136980.1:1..103742,gap(1744),AAHY01136981.1:1..10586,gap(20),
CO   AAHY01136982.1:1..21039,gap(351),AAHY01136983.1:1..6338,gap(143),
CO   AAHY01136984.1:1..44726,gap(20),AAHY01136985.1:1..4197,gap(20),
CO   AAHY01136986.1:1..22087,gap(20),AAHY01136987.1:1..1127,gap(223),
CO   AAHY01136988.1:1..12065,gap(89),AAHY01136989.1:1..9461,gap(222),
CO   AAHY01136990.1:1..84148,gap(294),AAHY01136991.1:1..19945,gap(20),
CO   AAHY01136992.1:1..36240,gap(20),AAHY01136993.1:1..16425,gap(20),
CO   complement(AAHY01136994.1:1..1132),gap(20),AAHY01136995.1:1..30126,
CO   gap(157),AAHY01136996.1:1..7711,gap(152),AAHY01136997.1:1..30251,gap(3706),
CO   AAHY01136998.1:1..38446,gap(20),complement(AAHY01136999.1:1..5110),gap(86),
CO   AAHY01137000.1:1..633,gap(139),AAHY01137001.1:1..12894,gap(20),
CO   AAHY01137002.1:1..84446,gap(121),AAHY01137003.1:1..2627,gap(20),
CO   AAHY01137004.1:1..21607,gap(306),AAHY01137005.1:1..35635,gap(1938),
CO   AAHY01137006.1:1..69507,gap(4083),AAHY01137007.1:1..12023,gap(106),
CO   AAHY01137008.1:1..6459,gap(66),AAHY01137009.1:1..29620,gap(20),
CO   complement(AAHY01137010.1:1..9844),gap(20),AAHY01137011.1:1..12339,gap(20),
CO   AAHY01137012.1:1..7650,gap(302),AAHY01137013.1:1..8326,gap(69),
CO   AAHY01137014.1:1..5072,gap(20),AAHY01137015.1:1..9302,gap(143),
CO   AAHY01137016.1:1..10327,gap(20),AAHY01137017.1:1..44795,gap(20),
CO   AAHY01137018.1:1..38759,gap(576),AAHY01137019.1:1..19249,gap(965),
CO   AAHY01137020.1:1..773,gap(642),AAHY01137021.1:1..2869,gap(86),
CO   complement(AAHY01137022.1:1..1387),gap(51),AAHY01137023.1:1..5254,gap(20),
CO   AAHY01137024.1:1..17670,gap(20),AAHY01137025.1:1..5760,gap(20),
CO   AAHY01137026.1:1..19189,gap(25),AAHY01137027.1:1..12994,gap(167),
CO   AAHY01137028.1:1..13008,gap(108),complement(AAHY01137029.1:1..9089),
CO   gap(20),complement(AAHY01137030.1:1..55430),gap(20),
CO   AAHY01137031.1:1..64325,gap(109),complement(AAHY01137032.1:1..51863),
CO   gap(20),AAHY01137033.1:1..39692,gap(80),AAHY01137034.1:1..34788,gap(184),
CO   AAHY01137035.1:1..21937,gap(20),AAHY01137036.1:1..71951,gap(202),
CO   AAHY01137037.1:1..28560,gap(20),complement(AAHY01137038.1:1..20409),
CO   gap(114),complement(AAHY01137039.1:1..54105),gap(20),
CO   AAHY01137040.1:1..7195,gap(20),AAHY01137041.1:1..3509,gap(296),
CO   AAHY01137042.1:1..26839,gap(20),AAHY01137043.1:1..14811,gap(1124),
CO   AAHY01137044.1:1..2804,gap(20),complement(AAHY01137045.1:1..51313),gap(20),
CO   complement(AAHY01137046.1:1..20790),gap(1427),
CO   complement(AAHY01137047.1:1..19689),gap(20),
CO   complement(AAHY01137048.1:1..2250),gap(602),
CO   complement(AAHY01137049.1:1..45673),gap(20),
CO   complement(AAHY01137050.1:1..28493),gap(55),
CO   complement(AAHY01137051.1:1..29108),gap(243),AAHY01137052.1:1..1665,
CO   gap(2467),AAHY01137053.1:1..1784,gap(1404),AAHY01137054.1:1..10805,gap(50),
CO   AAHY01137055.1:1..41273,gap(1970),AAHY01137056.1:1..1174,gap(20),
CO   AAHY01137057.1:1..10188,gap(1707),AAHY01137058.1:1..25917,gap(74),
CO   AAHY01137059.1:1..52058,gap(216),complement(AAHY01137060.1:1..459),
CO   gap(160),AAHY01137061.1:1..8008,gap(432),
CO   complement(AAHY01137062.1:1..13211),gap(20),AAHY01137063.1:1..7986,gap(20),
CO   AAHY01137064.1:1..41272,gap(38),AAHY01137065.1:1..21397,gap(20),
CO   AAHY01137066.1:1..5248,gap(20),AAHY01137067.1:1..3173,gap(3369),
CO   AAHY01137068.1:1..22721,gap(493),AAHY01137069.1:1..1215,gap(442),
CO   AAHY01137070.1:1..45045,gap(4719),AAHY01137071.1:1..7489,gap(20),
CO   AAHY01137072.1:1..25207,gap(20),AAHY01137073.1:1..24343,gap(59),
CO   AAHY01137074.1:1..7464,gap(32),AAHY01137075.1:1..14171,gap(3903),
CO   AAHY01137076.1:1..11000,gap(155),AAHY01137077.1:1..9237,gap(20),
CO   AAHY01137078.1:1..3521,gap(280),AAHY01137079.1:1..21090,gap(20),
CO   AAHY01137080.1:1..28329,gap(20),AAHY01137081.1:1..29283,gap(20),
CO   complement(AAHY01137082.1:1..2550),gap(20),AAHY01137083.1:1..1160,gap(20),
CO   AAHY01137084.1:1..9905,gap(62),AAHY01137085.1:1..19703,gap(94),
CO   AAHY01137086.1:1..4679,gap(20),AAHY01137087.1:1..9491,gap(412),
CO   AAHY01137088.1:1..91024,gap(3316),AAHY01137089.1:1..63384,gap(20),
CO   AAHY01137090.1:1..19271,gap(153),AAHY01137091.1:1..15851,gap(141),
CO   AAHY01137092.1:1..2842,gap(20),AAHY01137093.1:1..1286,gap(205),
CO   AAHY01137094.1:1..39082,gap(50),AAHY01137095.1:1..1491,gap(34),
CO   complement(AAHY01137096.1:1..2695),gap(84),
CO   complement(AAHY01137097.1:1..6828),gap(452),AAHY01137098.1:1..17176,
CO   gap(67),AAHY01137099.1:1..4455,gap(20),AAHY01137100.1:1..20495,gap(20),
CO   AAHY01137101.1:1..34632,gap(4235),complement(AAHY01137102.1:1..6966),
CO   gap(152),complement(AAHY01137103.1:1..2657),gap(20),
CO   AAHY01137104.1:1..18097,gap(84),AAHY01137105.1:1..11785,gap(48),
CO   AAHY01137106.1:1..19542,gap(73),complement(AAHY01137107.1:1..16076),
CO   gap(35),AAHY01137108.1:1..28162,gap(20),AAHY01137109.1:1..15602,gap(111),
CO   AAHY01137110.1:1..57680,gap(20),AAHY01137111.1:1..18300,gap(27),
CO   AAHY01137112.1:1..29912,gap(20),complement(AAHY01137113.1:1..4124),
CO   gap(389),AAHY01137114.1:1..19512,gap(41),AAHY01137115.1:1..83731,gap(252),
CO   complement(AAHY01137116.1:1..113283),gap(56),
CO   complement(AAHY01137117.1:1..8319),gap(20),AAHY01137118.1:1..3657,gap(153),
CO   complement(AAHY01137119.1:1..4026),gap(226),AAHY01137120.1:1..5887,gap(29),
CO   AAHY01137121.1:1..14257,gap(7396),AAHY01137122.1:1..1121,gap(2520),
CO   AAHY01137123.1:1..44467,gap(20),AAHY01137124.1:1..15409,gap(20),
CO   AAHY01137125.1:1..15992,gap(72),AAHY01137126.1:1..8847,gap(331),
CO   AAHY01137127.1:1..20457,gap(187),AAHY01137128.1:1..18532,gap(20),
CO   complement(AAHY01137129.1:1..1286),gap(20),AAHY01137130.1:1..17467,
CO   gap(146),AAHY01137131.1:1..1137,gap(262),AAHY01137132.1:1..5050,gap(20),
CO   AAHY01137133.1:1..9914,gap(20),complement(AAHY01137134.1:1..8399),gap(20),
CO   complement(AAHY01137135.1:1..7247),gap(20),AAHY01137136.1:1..5151,gap(20),
CO   complement(AAHY01137137.1:1..1322),gap(20),AAHY01137138.1:1..22647,
CO   gap(837),AAHY01137139.1:1..7804,gap(20),AAHY01137140.1:1..22969,gap(405),
CO   AAHY01137141.1:1..16110,gap(20),complement(AAHY01137142.1:1..7063),
CO   gap(683),complement(AAHY01137143.1:1..5743),gap(20),
CO   AAHY01137144.1:1..36310,gap(3360),AAHY01137145.1:1..5702,gap(6238),
CO   AAHY01137146.1:1..53600,gap(4387),AAHY01137147.1:1..1043,gap(20),
CO   AAHY01137148.1:1..30558,gap(20),AAHY01137149.1:1..8345,gap(20),
CO   AAHY01137150.1:1..65222,gap(107),complement(AAHY01137151.1:1..26007),
CO   gap(104),AAHY01137152.1:1..59570,gap(80),
CO   complement(AAHY01137153.1:1..2087),gap(83),
CO   complement(AAHY01137154.1:1..8767),gap(242),AAHY01137155.1:1..10225,
CO   gap(411),AAHY01137156.1:1..5911,gap(136),AAHY01137157.1:1..2153,gap(224),
CO   AAHY01137158.1:1..11157,gap(1581),AAHY01137159.1:1..84116,gap(181),
CO   complement(AAHY01137160.1:1..16595),gap(47),AAHY01137161.1:1..42745,
CO   gap(55),AAHY01137162.1:1..16867,gap(20),AAHY01137163.1:1..20406,gap(20),
CO   complement(AAHY01137164.1:1..2138),gap(20),
CO   complement(AAHY01137165.1:1..13141),gap(20),AAHY01137166.1:1..18888,
CO   gap(20),AAHY01137167.1:1..36605,gap(117),AAHY01137168.1:1..7041,gap(20),
CO   AAHY01137169.1:1..9417,gap(20),AAHY01137170.1:1..26081,gap(20),
CO   complement(AAHY01137171.1:1..12099),gap(20),AAHY01137172.1:1..10690,
CO   gap(64),AAHY01137173.1:1..65904,gap(77),AAHY01137174.1:1..39979,gap(20),
CO   complement(AAHY01137175.1:1..1484),gap(30),AAHY01137176.1:1..23488,gap(20),
CO   complement(AAHY01137177.1:1..29997),gap(582),AAHY01137178.1:1..3978,
CO   gap(155),AAHY01137179.1:1..3861,gap(20),AAHY01137180.1:1..1152,gap(20),
CO   AAHY01137181.1:1..40811,gap(20),complement(AAHY01137182.1:1..2114),gap(28),
CO   complement(AAHY01137183.1:1..24330),gap(100),
CO   complement(AAHY01137184.1:1..14312),gap(206),
CO   complement(AAHY01137185.1:1..10262),gap(84),AAHY01137186.1:1..24123,
CO   gap(1701),AAHY01137187.1:1..47632,gap(3622),AAHY01137188.1:1..33523,
CO   gap(4276),AAHY01137189.1:1..3558,gap(20),
CO   complement(AAHY01137190.1:1..16976),gap(270),AAHY01137191.1:1..1218,
CO   gap(289),complement(AAHY01137192.1:1..20821),gap(55),
CO   complement(AAHY01137193.1:1..4031),gap(98),
CO   complement(AAHY01137194.1:1..30860),gap(20),
CO   complement(AAHY01137195.1:1..13736),gap(20),
CO   complement(AAHY01137196.1:1..3231),gap(1065),AAHY01137197.1:1..9599,
CO   gap(2312),AAHY01137198.1:1..9484,gap(252),AAHY01137199.1:1..11818,gap(20),
CO   AAHY01137200.1:1..26622,gap(20),AAHY01137201.1:1..8282,gap(20),
CO   complement(AAHY01137202.1:1..30709),gap(88),AAHY01137203.1:1..1489,gap(29),
CO   AAHY01137204.1:1..3169,gap(375),complement(AAHY01137205.1:1..29678),
CO   gap(20),complement(AAHY01137206.1:1..24048),gap(92),
CO   AAHY01137207.1:1..22195,gap(353),complement(AAHY01137208.1:1..3910),
CO   gap(20),AAHY01137209.1:1..2929,gap(20),AAHY01137210.1:1..5381,gap(202),
CO   complement(AAHY01137211.1:1..16975),gap(701),
CO   complement(AAHY01137212.1:1..6989),gap(20),
CO   complement(AAHY01137213.1:1..11220),gap(936),AAHY01137214.1:1..7437,
CO   gap(20),AAHY01137215.1:1..706,gap(181),complement(AAHY01137216.1:1..49781),
CO   gap(20),complement(AAHY01137217.1:1..9427),gap(20),
CO   complement(AAHY01137218.1:1..6745),gap(4974),AAHY01137219.1:1..92018,
CO   gap(261),complement(AAHY01137220.1:1..1574),gap(20),
CO   AAHY01137221.1:1..21930,gap(20),AAHY01137222.1:1..6965,gap(3152),
CO   AAHY01137223.1:1..5311,gap(560),AAHY01137224.1:1..5775,gap(88),
CO   AAHY01137225.1:1..17306,gap(29),AAHY01137226.1:1..11898,gap(20),
CO   AAHY01137227.1:1..23140,gap(20),complement(AAHY01137228.1:1..9760),
CO   gap(285),AAHY01137229.1:1..43010,gap(116),AAHY01137230.1:1..15483,gap(294),
CO   AAHY01137231.1:1..2798,gap(20),AAHY01137232.1:1..24660,gap(82),
CO   AAHY01137233.1:1..39153,gap(30),AAHY01137234.1:1..17016,gap(570),
CO   AAHY01137235.1:1..43542,gap(20),AAHY01137236.1:1..16938,gap(20),
CO   AAHY01137237.1:1..12215,gap(20),complement(AAHY01137238.1:1..1308),gap(20),
CO   AAHY01137239.1:1..72152,gap(20),AAHY01137240.1:1..70606,gap(1011),
CO   AAHY01137241.1:1..5914,gap(122),AAHY01137242.1:1..19447,gap(45),
CO   AAHY01137243.1:1..12583,gap(20),AAHY01137244.1:1..23100,gap(20),
CO   AAHY01137245.1:1..25051,gap(97),AAHY01137246.1:1..80079,gap(20),
CO   AAHY01137247.1:1..57906,gap(94),AAHY01137248.1:1..69336,gap(20),
CO   AAHY01137249.1:1..28358,gap(170),AAHY01137250.1:1..1876,gap(224),
CO   AAHY01137251.1:1..10522,gap(1766),AAHY01137252.1:1..20261,gap(196),
CO   AAHY01137253.1:1..23317,gap(20),complement(AAHY01137254.1:1..22535),
CO   gap(35),complement(AAHY01137255.1:1..28817),gap(73),
CO   AAHY01137256.1:1..27301,gap(20),AAHY01137257.1:1..3624,gap(20),
CO   AAHY01137258.1:1..7288,gap(822),AAHY01137259.1:1..22888,gap(272),
CO   AAHY01137260.1:1..30216,gap(20),AAHY01137261.1:1..16562,gap(652),
CO   AAHY01137262.1:1..52481,gap(20),AAHY01137263.1:1..11529,gap(20),
CO   AAHY01137264.1:1..3577,gap(20),AAHY01137265.1:1..66070,gap(20),
CO   AAHY01137266.1:1..13853,gap(20),AAHY01137267.1:1..34314,gap(81),
CO   AAHY01137268.1:1..50786,gap(2571),AAHY01137269.1:1..10868,gap(20),
CO   AAHY01137270.1:1..27463,gap(197),AAHY01137271.1:1..20820,gap(3650),
CO   AAHY01137272.1:1..16823,gap(20),complement(AAHY01137273.1:1..8253),gap(20),
CO   complement(AAHY01137274.1:1..10648),gap(20),AAHY01137275.1:1..6924,gap(38),
CO   AAHY01137276.1:1..35518,gap(20),AAHY01137277.1:1..34826,gap(1972),
CO   AAHY01137278.1:1..18266,gap(196),complement(AAHY01137279.1:1..6539),
CO   gap(172),AAHY01137280.1:1..21887,gap(20),AAHY01137281.1:1..4623,gap(20),
CO   AAHY01137282.1:1..43065,gap(20),AAHY01137283.1:1..48193,gap(20),
CO   complement(AAHY01137284.1:1..3835),gap(100),AAHY01137285.1:1..8522,
CO   gap(184),AAHY01137286.1:1..39642,gap(866),AAHY01137287.1:1..127613,gap(20),
CO   AAHY01137288.1:1..8970,gap(20),AAHY01137289.1:1..63316,gap(175),
CO   complement(AAHY01137290.1:1..2648),gap(20),
CO   complement(AAHY01137291.1:1..6476),gap(20),AAHY01137292.1:1..13514,
CO   gap(235),complement(AAHY01137293.1:1..127793),gap(144),
CO   AAHY01137294.1:1..26256,gap(20),AAHY01137295.1:1..26128,gap(2579),
CO   complement(AAHY01137296.1:1..4491),gap(97),
CO   complement(AAHY01137297.1:1..73723),gap(20),AAHY01137298.1:1..23053,
CO   gap(20),AAHY01137299.1:1..23005,gap(20),AAHY01137300.1:1..40643,gap(20),
CO   AAHY01137301.1:1..40522,gap(20),AAHY01137302.1:1..20250,gap(1375),
CO   AAHY01137303.1:1..18833,gap(30),AAHY01137304.1:1..8605,gap(20),
CO   AAHY01137305.1:1..40880,gap(27),AAHY01137306.1:1..10296,gap(20),
CO   AAHY01137307.1:1..165355,gap(47),AAHY01137308.1:1..2211,gap(481),
CO   AAHY01137309.1:1..9778,gap(20),AAHY01137310.1:1..8818,gap(20),
CO   AAHY01137311.1:1..7451,gap(20),AAHY01137312.1:1..25117,gap(237),
CO   AAHY01137313.1:1..1416,gap(176),complement(AAHY01137314.1:1..5038),gap(20),
CO   AAHY01137315.1:1..5043,gap(20),AAHY01137316.1:1..21723,gap(20),
CO   complement(AAHY01137317.1:1..1171),gap(20),AAHY01137318.1:1..4699,gap(20),
CO   AAHY01137319.1:1..1012,gap(680),AAHY01137320.1:1..13956,gap(20),
CO   AAHY01137321.1:1..20319,gap(20),AAHY01137322.1:1..22810,gap(20),
CO   AAHY01137323.1:1..1479,gap(24),AAHY01137324.1:1..33073,gap(135),
CO   AAHY01137325.1:1..31678,gap(29),AAHY01137326.1:1..4463,gap(387),
CO   AAHY01137327.1:1..13546,gap(397),complement(AAHY01137328.1:1..5705),
CO   gap(20),AAHY01137329.1:1..29742,gap(65),AAHY01137330.1:1..14266,gap(173),
CO   complement(AAHY01137331.1:1..6944),gap(20),
CO   complement(AAHY01137332.1:1..14897),gap(126),AAHY01137333.1:1..18701,
CO   gap(20),AAHY01137334.1:1..1228,gap(20),AAHY01137335.1:1..1110,gap(20),
CO   AAHY01137336.1:1..12870,gap(20),AAHY01137337.1:1..5727,gap(4502),
CO   AAHY01137338.1:1..2335,gap(244),AAHY01137339.1:1..4946,gap(4093),
CO   complement(AAHY01137340.1:1..1198),gap(20),AAHY01137341.1:1..51691,gap(20),
CO   AAHY01137342.1:1..6894,gap(224),AAHY01137343.1:1..34437,gap(63),
CO   AAHY01137344.1:1..22961,gap(20),AAHY01137345.1:1..2155,gap(1696),
CO   AAHY01137346.1:1..11728,gap(20),AAHY01137347.1:1..29095,gap(55),
CO   AAHY01137348.1:1..22257,gap(3818),AAHY01137349.1:1..104844,gap(214),
CO   AAHY01137350.1:1..38889,gap(20),AAHY01137351.1:1..1153,gap(20),
CO   complement(AAHY01137352.1:1..1376),gap(20),AAHY01137353.1:1..9930,gap(276),
CO   AAHY01137354.1:1..38498,gap(5525),AAHY01137355.1:1..16221,gap(258),
CO   complement(AAHY01137356.1:1..5309),gap(833),AAHY01137357.1:1..28945,
CO   gap(66),AAHY01137358.1:1..17485,gap(20),AAHY01137359.1:1..19189,gap(20),
CO   AAHY01137360.1:1..20057,gap(20),AAHY01137361.1:1..63308,gap(9764),
CO   AAHY01137362.1:1..18855,gap(252),AAHY01137363.1:1..79233,gap(20),
CO   AAHY01137364.1:1..9233,gap(20),complement(AAHY01137365.1:1..15064),
CO   gap(260),complement(AAHY01137366.1:1..25030),gap(141),
CO   AAHY01137367.1:1..9817,gap(72),AAHY01137368.1:1..6963,gap(353),
CO   AAHY01137369.1:1..45431,gap(20),AAHY01137370.1:1..61935,gap(135),
CO   AAHY01137371.1:1..20549,gap(20),AAHY01137372.1:1..1753,gap(173),
CO   AAHY01137373.1:1..38540,gap(109),AAHY01137374.1:1..18915,gap(20),
CO   AAHY01137375.1:1..18895,gap(68),AAHY01137376.1:1..32108,gap(86),
CO   AAHY01137377.1:1..23417,gap(348),AAHY01137378.1:1..19096,gap(130),
CO   AAHY01137379.1:1..7793,gap(885),AAHY01137380.1:1..31930,gap(20),
CO   AAHY01137381.1:1..21953,gap(4546),AAHY01137382.1:1..66032,gap(20),
CO   AAHY01137383.1:1..5843,gap(109),AAHY01137384.1:1..54223,gap(762),
CO   AAHY01137385.1:1..12869,gap(20),complement(AAHY01137386.1:1..4154),gap(20),
CO   AAHY01137387.1:1..8465,gap(20),complement(AAHY01137388.1:1..1173),gap(20),
CO   complement(AAHY01137389.1:1..4751),gap(437),
CO   complement(AAHY01137390.1:1..69176),gap(20),AAHY01137391.1:1..8271,
CO   gap(215),AAHY01137392.1:1..23303,gap(20),AAHY01137393.1:1..1179,gap(186),
CO   AAHY01137394.1:1..23756,gap(117),AAHY01137395.1:1..42872,gap(277),
CO   AAHY01137396.1:1..4068,gap(544),AAHY01137397.1:1..26564,gap(154),
CO   complement(AAHY01137398.1:1..36912),gap(69),
CO   complement(AAHY01137399.1:1..10334),gap(20),
CO   complement(AAHY01137400.1:1..24472),gap(20),
CO   complement(AAHY01137401.1:1..50922),gap(31),AAHY01137402.1:1..9084,gap(20),
CO   AAHY01137403.1:1..31936,gap(20),complement(AAHY01137404.1:1..11476),
CO   gap(20),complement(AAHY01137405.1:1..5144),gap(31),AAHY01137406.1:1..4191,
CO   gap(60),AAHY01137407.1:1..9925,gap(108),AAHY01137408.1:1..12570,gap(415),
CO   AAHY01137409.1:1..25080,gap(20),complement(AAHY01137410.1:1..42671),
CO   gap(20),complement(AAHY01137411.1:1..6680),gap(129),
CO   complement(AAHY01137412.1:1..33482),gap(155),
CO   complement(AAHY01137413.1:1..766),gap(299),
CO   complement(AAHY01137414.1:1..2865),gap(2671),
CO   complement(AAHY01137415.1:1..4685),gap(36),AAHY01137416.1:1..95053,gap(75),
CO   AAHY01137417.1:1..15174,gap(299),AAHY01137418.1:1..12555,gap(20),
CO   AAHY01137419.1:1..1214,gap(1086),complement(AAHY01137420.1:1..22530),
CO   gap(21),AAHY01137421.1:1..14136,gap(6404),AAHY01137422.1:1..2833,gap(20),
CO   AAHY01137423.1:1..13834,gap(20),complement(AAHY01137424.1:1..1404),gap(20),
CO   AAHY01137425.1:1..1410,gap(20),AAHY01137426.1:1..1583,gap(20),
CO   AAHY01137427.1:1..7371,gap(20),AAHY01137428.1:1..65411,gap(20),
CO   complement(AAHY01137429.1:1..1393),gap(20),AAHY01137430.1:1..20651,gap(20),
CO   AAHY01137431.1:1..1483,gap(764),AAHY01137432.1:1..1507,gap(20),
CO   AAHY01137433.1:1..5173,gap(109),AAHY01137434.1:1..14330,gap(580),
CO   AAHY01137435.1:1..8772,gap(20),AAHY01137436.1:1..1052,gap(1485),
CO   AAHY01137437.1:1..7922,gap(20),AAHY01137438.1:1..1231,gap(20),
CO   AAHY01137439.1:1..10152,gap(356),AAHY01137440.1:1..9054,gap(4472),
CO   AAHY01137441.1:1..1938,gap(192),AAHY01137442.1:1..22796,gap(153),
CO   AAHY01137443.1:1..22253,gap(427),AAHY01137444.1:1..1136,gap(103),
CO   AAHY01137445.1:1..9421,gap(4809),AAHY01137446.1:1..12019,gap(45),
CO   AAHY01137447.1:1..21550,gap(466),complement(AAHY01137448.1:1..2060),
CO   gap(22),AAHY01137449.1:1..28004,gap(20),AAHY01137450.1:1..23191,gap(20),
CO   complement(AAHY01137451.1:1..38594),gap(443),
CO   complement(AAHY01137452.1:1..29252),gap(132),
CO   complement(AAHY01137453.1:1..22430),gap(20),
CO   complement(AAHY01137454.1:1..1048),gap(577),AAHY01137455.1:1..11178,
CO   gap(284),AAHY01137456.1:1..9291,gap(20),AAHY01137457.1:1..34090,gap(1143),
CO   AAHY01137458.1:1..17961,gap(20),complement(AAHY01137459.1:1..11488),
CO   gap(225),AAHY01137460.1:1..7933,gap(357),
CO   complement(AAHY01137461.1:1..16585),gap(736),
CO   complement(AAHY01137462.1:1..6604),gap(286),
CO   complement(AAHY01137463.1:1..7309),gap(20),
CO   complement(AAHY01137464.1:1..6648),gap(20),AAHY01137465.1:1..55451,gap(20),
CO   complement(AAHY01137466.1:1..1152),gap(20),AAHY01137467.1:1..18935,gap(20),
CO   AAHY01137468.1:1..5045,gap(20),AAHY01137469.1:1..48606,gap(20),
CO   AAHY01137470.1:1..37435,gap(1161),AAHY01137471.1:1..56622,gap(20),
CO   AAHY01137472.1:1..11914,gap(5768),AAHY01137473.1:1..10746,gap(3069),
CO   AAHY01137474.1:1..10531,gap(285),AAHY01137475.1:1..20723,gap(63),
CO   AAHY01137476.1:1..9928,gap(27),complement(AAHY01137477.1:1..11160),gap(20),
CO   complement(AAHY01137478.1:1..7027),gap(20),AAHY01137479.1:1..11896,
CO   gap(103),complement(AAHY01137480.1:1..4807),gap(102),AAHY01137481.1:1..673,
CO   gap(20),complement(AAHY01137482.1:1..2389),gap(323),
CO   AAHY01137483.1:1..19386,gap(20),AAHY01137484.1:1..20296,gap(43),
CO   AAHY01137485.1:1..26065,gap(174),AAHY01137486.1:1..42586,gap(20),
CO   AAHY01137487.1:1..15539,gap(20),AAHY01137488.1:1..28836,gap(20),
CO   AAHY01137489.1:1..13303,gap(20),AAHY01137490.1:1..9741,gap(20),
CO   AAHY01137491.1:1..22579,gap(20),complement(AAHY01137492.1:1..6045),gap(20),
CO   AAHY01137493.1:1..36555,gap(71),AAHY01137494.1:1..22098,gap(20),
CO   AAHY01137495.1:1..7561,gap(546),AAHY01137496.1:1..12782,gap(20),
CO   AAHY01137497.1:1..1512,gap(20),AAHY01137498.1:1..1433,gap(735),
CO   complement(AAHY01137499.1:1..2403),gap(20),
CO   complement(AAHY01137500.1:1..1097),gap(834),
CO   complement(AAHY01137501.1:1..48329),gap(20),AAHY01137502.1:1..6401,gap(20),
CO   AAHY01137503.1:1..18107,gap(806),complement(AAHY01137504.1:1..2560),
CO   gap(150),complement(AAHY01137505.1:1..10810),gap(20),
CO   complement(AAHY01137506.1:1..2591),gap(20),AAHY01137507.1:1..8713,gap(132),
CO   AAHY01137508.1:1..11522,gap(20),AAHY01137509.1:1..1550,gap(41),
CO   complement(AAHY01137510.1:1..6801),gap(20),
CO   complement(AAHY01137511.1:1..26967),gap(20),
CO   complement(AAHY01137512.1:1..7620),gap(20),
CO   complement(AAHY01137513.1:1..1255),gap(20),
CO   complement(AAHY01137514.1:1..8733),gap(230),
CO   complement(AAHY01137515.1:1..15338),gap(47),
CO   complement(AAHY01137516.1:1..7618),gap(46),
CO   complement(AAHY01137517.1:1..4229),gap(54),
CO   complement(AAHY01137518.1:1..4391),gap(79),AAHY01137519.1:1..26097,
CO   gap(143),AAHY01137520.1:1..48541,gap(153),
CO   complement(AAHY01137521.1:1..29778),gap(20),AAHY01137522.1:1..5024,
CO   gap(1057),AAHY01137523.1:1..7650,gap(20),
CO   complement(AAHY01137524.1:1..20028),gap(20),
CO   complement(AAHY01137525.1:1..11711),gap(20),
CO   complement(AAHY01137526.1:1..25052),gap(20),
CO   complement(AAHY01137527.1:1..17760),gap(44),
CO   complement(AAHY01137528.1:1..23829),gap(20),
CO   complement(AAHY01137529.1:1..31304),gap(155),
CO   complement(AAHY01137530.1:1..24985),gap(20),
CO   complement(AAHY01137531.1:1..25645),gap(205),
CO   complement(AAHY01137532.1:1..28475),gap(20),
CO   complement(AAHY01137533.1:1..38966),gap(20),
CO   complement(AAHY01137534.1:1..12635),gap(143),
CO   complement(AAHY01137535.1:1..21788),gap(20),AAHY01137536.1:1..9345,gap(20),
CO   complement(AAHY01137537.1:1..1523),gap(198),
CO   complement(AAHY01137538.1:1..2066),gap(400),
CO   complement(AAHY01137539.1:1..6620),gap(459),AAHY01137540.1:1..41916,
CO   gap(328),AAHY01137541.1:1..48470,gap(444),
CO   complement(AAHY01137542.1:1..6206),gap(20),AAHY01137543.1:1..24697,gap(20),
CO   AAHY01137544.1:1..4870,gap(1109),complement(AAHY01137545.1:1..606),
CO   gap(1399),AAHY01137546.1:1..7252,gap(1562),AAHY01137547.1:1..3891,gap(49),
CO   AAHY01137548.1:1..52739,gap(313),AAHY01137549.1:1..29471,gap(242),
CO   AAHY01137550.1:1..39272,gap(25),AAHY01137551.1:1..16909,gap(154),
CO   AAHY01137552.1:1..33078,gap(6810),AAHY01137553.1:1..10466,gap(2032),
CO   AAHY01137554.1:1..58316,gap(186),AAHY01137555.1:1..13192,gap(1743),
CO   AAHY01137556.1:1..5402,gap(3877),AAHY01137557.1:1..16770,gap(54),
CO   complement(AAHY01137558.1:1..55725),gap(20),AAHY01137559.1:1..215837,
CO   gap(6131),AAHY01137560.1:1..38896,gap(92),AAHY01137561.1:1..30371,gap(405),
CO   AAHY01137562.1:1..47017,gap(3129),AAHY01137563.1:1..78846,gap(111),
CO   AAHY01137564.1:1..12731,gap(3964),AAHY01137565.1:1..17238,gap(20),
CO   AAHY01137566.1:1..22199,gap(23),complement(AAHY01137567.1:1..3885),gap(20),
CO   complement(AAHY01137568.1:1..2714),gap(20),AAHY01137569.1:1..34555,
CO   gap(169),AAHY01137570.1:1..7559,gap(3181),
CO   complement(AAHY01137571.1:1..3259),gap(20),AAHY01137572.1:1..39563,
CO   gap(527),complement(AAHY01137573.1:1..2740),gap(181),
CO   complement(AAHY01137574.1:1..2242),gap(20),
CO   complement(AAHY01137575.1:1..1440),gap(20),
CO   complement(AAHY01137576.1:1..1274),gap(20),
CO   complement(AAHY01137577.1:1..10184),gap(127),
CO   complement(AAHY01137578.1:1..3898),gap(20),
CO   complement(AAHY01137579.1:1..18646),gap(20),AAHY01137580.1:1..5478,
CO   gap(147),complement(AAHY01137581.1:1..11339),gap(174),
CO   AAHY01137582.1:1..36313,gap(106),AAHY01137583.1:1..43429,gap(140),
CO   AAHY01137584.1:1..33344,gap(47),complement(AAHY01137585.1:1..4208),
CO   gap(440),AAHY01137586.1:1..11971,gap(153),AAHY01137587.1:1..1365,gap(20),
CO   AAHY01137588.1:1..1208,gap(214),complement(AAHY01137589.1:1..29197),
CO   gap(269),AAHY01137590.1:1..6562,gap(20),complement(AAHY01137591.1:1..1522),
CO   gap(20),AAHY01137592.1:1..21217,gap(34),AAHY01137593.1:1..16805,gap(102),
CO   AAHY01137594.1:1..13708,gap(102),AAHY01137595.1:1..20952,gap(20),
CO   AAHY01137596.1:1..14747,gap(217),AAHY01137597.1:1..1320,gap(540),
CO   AAHY01137598.1:1..11956,gap(20),AAHY01137599.1:1..47398,gap(574),
CO   AAHY01137600.1:1..15963,gap(1533),complement(AAHY01137601.1:1..4191),
CO   gap(20),complement(AAHY01137602.1:1..1262),gap(20),AAHY01137603.1:1..1263,
CO   gap(20),AAHY01137604.1:1..10208,gap(388),AAHY01137605.1:1..5528,gap(2676),
CO   AAHY01137606.1:1..7566,gap(4241),complement(AAHY01137607.1:1..3800),
CO   gap(46),AAHY01137608.1:1..16471,gap(105),
CO   complement(AAHY01137609.1:1..36313),gap(20),AAHY01137610.1:1..3895,gap(31),
CO   complement(AAHY01137611.1:1..1709),gap(2070),
CO   complement(AAHY01137612.1:1..23610),gap(679),AAHY01137613.1:1..3865,
CO   gap(20),AAHY01137614.1:1..1700,gap(20),AAHY01137615.1:1..1186,gap(20),
CO   AAHY01137616.1:1..29512,gap(20),complement(AAHY01137617.1:1..14702),
CO   gap(80),AAHY01137618.1:1..46222,gap(34),AAHY01137619.1:1..41072,gap(63),
CO   complement(AAHY01137620.1:1..12047),gap(20),
CO   complement(AAHY01137621.1:1..34141),gap(20),AAHY01137622.1:1..1008,gap(20),
CO   complement(AAHY01137623.1:1..45491),gap(20),
CO   complement(AAHY01137624.1:1..24747),gap(226),AAHY01137625.1:1..60032,
CO   gap(172),AAHY01137626.1:1..8144,gap(20),AAHY01137627.1:1..67520,gap(26),
CO   AAHY01137628.1:1..28505,gap(508),AAHY01137629.1:1..546,gap(20),
CO   complement(AAHY01137630.1:1..2007),gap(2403),AAHY01137631.1:1..604,gap(20),
CO   AAHY01137632.1:1..42939,gap(66),AAHY01137633.1:1..23591,gap(250),
CO   complement(AAHY01137634.1:1..43938),gap(20),AAHY01137635.1:1..13993,
CO   gap(29),AAHY01137636.1:1..29220,gap(1036),AAHY01137637.1:1..12214,gap(833),
CO   complement(AAHY01137638.1:1..11846),gap(20),
CO   complement(AAHY01137639.1:1..56390),gap(341),AAHY01137640.1:1..21745,
CO   gap(20),AAHY01137641.1:1..2928,gap(186),AAHY01137642.1:1..7451,gap(20),
CO   AAHY01137643.1:1..5134,gap(107),complement(AAHY01137644.1:1..1339),gap(20),
CO   AAHY01137645.1:1..15503,gap(20),AAHY01137646.1:1..12758,gap(4645),
CO   AAHY01137647.1:1..7937,gap(1381),AAHY01137648.1:1..1538,gap(2381),
CO   AAHY01137649.1:1..3064,gap(20),complement(AAHY01137650.1:1..1272),gap(20),
CO   complement(AAHY01137651.1:1..7348),gap(482),
CO   complement(AAHY01137652.1:1..35805),gap(223),AAHY01137653.1:1..981,
CO   gap(552),AAHY01137654.1:1..14181,gap(20),
CO   complement(AAHY01137655.1:1..68747),gap(225),
CO   complement(AAHY01137656.1:1..23006),gap(33),AAHY01137657.1:1..3512,gap(55),
CO   complement(AAHY01137658.1:1..26446),gap(66),
CO   complement(AAHY01137659.1:1..50194),gap(284),AAHY01137660.1:1..5877,
CO   gap(3297),AAHY01137661.1:1..12932,gap(20),AAHY01137662.1:1..63089,gap(49),
CO   complement(AAHY01137663.1:1..6133),gap(20),
CO   complement(AAHY01137664.1:1..13930),gap(20),
CO   complement(AAHY01137665.1:1..11118),gap(20),AAHY01137666.1:1..15281,
CO   gap(20),AAHY01137667.1:1..1434,gap(75),AAHY01137668.1:1..4341,gap(1451),
CO   complement(AAHY01137669.1:1..2096),gap(47),
CO   complement(AAHY01137670.1:1..14371),gap(545),
CO   complement(AAHY01137671.1:1..35551),gap(87),AAHY01137672.1:1..70266,
CO   gap(54),AAHY01137673.1:1..157330,gap(20),AAHY01137674.1:1..7581,gap(885),
CO   AAHY01137675.1:1..5405,gap(195),AAHY01137676.1:1..30798,gap(288),
CO   complement(AAHY01137677.1:1..4605),gap(33),
CO   complement(AAHY01137678.1:1..4623),gap(294),AAHY01137679.1:1..8683,
CO   gap(147),complement(AAHY01137680.1:1..8029),gap(20),
CO   AAHY01137681.1:1..17912,gap(20),complement(AAHY01137682.1:1..15370),
CO   gap(20),complement(AAHY01137683.1:1..20717),gap(20),
CO   AAHY01137684.1:1..57501,gap(20),complement(AAHY01137685.1:1..2606),
CO   gap(102),complement(AAHY01137686.1:1..28680),gap(20),
CO   complement(AAHY01137687.1:1..5974),gap(20),
CO   complement(AAHY01137688.1:1..12325),gap(159),
CO   complement(AAHY01137689.1:1..9262),gap(20),
CO   complement(AAHY01137690.1:1..10221),gap(95),AAHY01137691.1:1..10076,
CO   gap(763),complement(AAHY01137692.1:1..17640),gap(209),
CO   complement(AAHY01137693.1:1..930),gap(66),AAHY01137694.1:1..1532,gap(51),
CO   AAHY01137695.1:1..18846,gap(116),complement(AAHY01137696.1:1..30249),
CO   gap(61),complement(AAHY01137697.1:1..3811),gap(459),
CO   complement(AAHY01137698.1:1..11824),gap(46),AAHY01137699.1:1..19257,
CO   gap(222),complement(AAHY01137700.1:1..3535),gap(80),
CO   complement(AAHY01137701.1:1..6729),gap(20),AAHY01137702.1:1..2798,gap(461),
CO   complement(AAHY01137703.1:1..6451),gap(20),AAHY01137704.1:1..58747,
CO   gap(292),complement(AAHY01137705.1:1..6085),gap(187),
CO   complement(AAHY01137706.1:1..32395),gap(20),
CO   complement(AAHY01137707.1:1..16784),gap(292),AAHY01137708.1:1..21421,
CO   gap(779),complement(AAHY01137709.1:1..2862),gap(20),AAHY01137710.1:1..3402,
CO   gap(147),AAHY01137711.1:1..5851,gap(20),complement(AAHY01137712.1:1..8449),
CO   gap(332),complement(AAHY01137713.1:1..4955),gap(151),
CO   complement(AAHY01137714.1:1..7275),gap(20),
CO   complement(AAHY01137715.1:1..5340),gap(844),
CO   complement(AAHY01137716.1:1..2047),gap(477),
CO   complement(AAHY01137717.1:1..6233),gap(336),AAHY01137718.1:1..8870,gap(56),
CO   AAHY01137719.1:1..17681,gap(20),AAHY01137720.1:1..3911,gap(20),
CO   AAHY01137721.1:1..52593,gap(20),AAHY01137722.1:1..11949,gap(20),
CO   complement(AAHY01137723.1:1..43978),gap(43),AAHY01137724.1:1..50997,
CO   gap(147),AAHY01137725.1:1..5782,gap(37),complement(AAHY01137726.1:1..3402),
CO   gap(20),complement(AAHY01137727.1:1..10198),gap(44),
CO   complement(AAHY01137728.1:1..19715),gap(20),
CO   complement(AAHY01137729.1:1..9932),gap(20),
CO   complement(AAHY01137730.1:1..10292),gap(110),
CO   complement(AAHY01137731.1:1..3221),gap(20),
CO   complement(AAHY01137732.1:1..13388),gap(345),
CO   complement(AAHY01137733.1:1..516),gap(271),AAHY01137734.1:1..9251,gap(438),
CO   AAHY01137735.1:1..6928,gap(283),AAHY01137736.1:1..5919,gap(20),
CO   AAHY01137737.1:1..2339,gap(284),complement(AAHY01137738.1:1..11840),
CO   gap(20),AAHY01137739.1:1..3267,gap(20),complement(AAHY01137740.1:1..15866),
CO   gap(724),complement(AAHY01137741.1:1..5022),gap(43),
CO   complement(AAHY01137742.1:1..17857),gap(124),
CO   complement(AAHY01137743.1:1..7906),gap(20),AAHY01137744.1:1..16831,gap(62),
CO   complement(AAHY01137745.1:1..44282),gap(20),AAHY01137746.1:1..31203,
CO   gap(20),complement(AAHY01137747.1:1..24444),gap(20),
CO   complement(AAHY01137748.1:1..2430),gap(20),
CO   complement(AAHY01137749.1:1..42765),gap(20),AAHY01137750.1:1..45201,
CO   gap(253),AAHY01137751.1:1..15885,gap(160),AAHY01137752.1:1..2553,gap(632),
CO   AAHY01137753.1:1..95849,gap(2686),complement(AAHY01137754.1:1..64829),
CO   gap(20),complement(AAHY01137755.1:1..1146),gap(20),
CO   complement(AAHY01137756.1:1..1351),gap(20),AAHY01137757.1:1..108282,
CO   gap(20),AAHY01137758.1:1..38417,gap(20),AAHY01137759.1:1..234,gap(20),
CO   AAHY01137760.1:1..1733,gap(20),AAHY01137761.1:1..159879,gap(20),
CO   AAHY01137762.1:1..9274,gap(20),AAHY01137763.1:1..4019,gap(107),
CO   AAHY01137764.1:1..2439,gap(216),AAHY01137765.1:1..44264)
//


spacer
spacer